(data stored in ACNUC7421 zone)

EMBL: CP000157

ID   CP000157; SV 1; circular; genomic DNA; STD; PRO; 3052398 BP.
XX
AC   CP000157; AAGG01000000-AAGG01000008; CM000156;
XX
PR   Project:PRJNA13480;
XX
DT   12-JAN-2006 (Rel. 86, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 4)
XX
DE   Erythrobacter litoralis HTCC2594, complete genome.
XX
KW   .
XX
OS   Erythrobacter litoralis HTCC2594
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Erythrobacteraceae; Erythrobacter.
XX
RN   [1]
RP   1-3052398
RA   Giovannoni S.J., Cho J.-C., Ferriera S., Johnson J., Kravits S.,
RA   Halpern A., Remington K., Beeson K., Tran B., Rogers Y.-H., Friedman R.,
RA   Venter J.C.;
RT   ;
RL   Submitted (21-SEP-2005) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 255bcb8e935edf598e53d0c35f32d361.
DR   BioSample; SAMN00622970.
DR   EnsemblGenomes-Gn; EBG00001051773.
DR   EnsemblGenomes-Gn; EBG00001051774.
DR   EnsemblGenomes-Gn; EBG00001051775.
DR   EnsemblGenomes-Gn; EBG00001051776.
DR   EnsemblGenomes-Gn; EBG00001051777.
DR   EnsemblGenomes-Gn; EBG00001051778.
DR   EnsemblGenomes-Gn; EBG00001051779.
DR   EnsemblGenomes-Gn; EBG00001051780.
DR   EnsemblGenomes-Gn; EBG00001051781.
DR   EnsemblGenomes-Gn; EBG00001051782.
DR   EnsemblGenomes-Gn; EBG00001051783.
DR   EnsemblGenomes-Gn; EBG00001051784.
DR   EnsemblGenomes-Gn; EBG00001051785.
DR   EnsemblGenomes-Gn; EBG00001051786.
DR   EnsemblGenomes-Gn; EBG00001051787.
DR   EnsemblGenomes-Gn; EBG00001051788.
DR   EnsemblGenomes-Gn; EBG00001051789.
DR   EnsemblGenomes-Gn; EBG00001051790.
DR   EnsemblGenomes-Gn; EBG00001051791.
DR   EnsemblGenomes-Gn; EBG00001051792.
DR   EnsemblGenomes-Gn; EBG00001051793.
DR   EnsemblGenomes-Gn; EBG00001051794.
DR   EnsemblGenomes-Gn; EBG00001051795.
DR   EnsemblGenomes-Gn; EBG00001051796.
DR   EnsemblGenomes-Gn; EBG00001051797.
DR   EnsemblGenomes-Gn; EBG00001051799.
DR   EnsemblGenomes-Gn; EBG00001051801.
DR   EnsemblGenomes-Gn; EBG00001051803.
DR   EnsemblGenomes-Gn; EBG00001051805.
DR   EnsemblGenomes-Gn; EBG00001051807.
DR   EnsemblGenomes-Gn; EBG00001051809.
DR   EnsemblGenomes-Gn; EBG00001051811.
DR   EnsemblGenomes-Gn; EBG00001051813.
DR   EnsemblGenomes-Gn; EBG00001051814.
DR   EnsemblGenomes-Gn; EBG00001051815.
DR   EnsemblGenomes-Gn; EBG00001051816.
DR   EnsemblGenomes-Gn; EBG00001051818.
DR   EnsemblGenomes-Gn; EBG00001051819.
DR   EnsemblGenomes-Gn; EBG00001051820.
DR   EnsemblGenomes-Gn; EBG00001051821.
DR   EnsemblGenomes-Gn; EBG00001051822.
DR   EnsemblGenomes-Gn; EBG00001051823.
DR   EnsemblGenomes-Gn; EBG00001051825.
DR   EnsemblGenomes-Gn; EBG00001051827.
DR   EnsemblGenomes-Gn; EBG00001051829.
DR   EnsemblGenomes-Gn; EBG00001051830.
DR   EnsemblGenomes-Gn; EBG00001051831.
DR   EnsemblGenomes-Gn; EBG00001051832.
DR   EnsemblGenomes-Gn; EBG00001051833.
DR   EnsemblGenomes-Gn; EBG00001051835.
DR   EnsemblGenomes-Gn; EBG00001051837.
DR   EnsemblGenomes-Gn; ELI_r15155.
DR   EnsemblGenomes-Gn; ELI_t15067.
DR   EnsemblGenomes-Gn; ELI_t15069.
DR   EnsemblGenomes-Gn; ELI_t15071.
DR   EnsemblGenomes-Gn; ELI_t15073.
DR   EnsemblGenomes-Gn; ELI_t15075.
DR   EnsemblGenomes-Gn; ELI_t15077.
DR   EnsemblGenomes-Gn; ELI_t15079.
DR   EnsemblGenomes-Gn; ELI_t15081.
DR   EnsemblGenomes-Gn; ELI_t15083.
DR   EnsemblGenomes-Gn; ELI_t15085.
DR   EnsemblGenomes-Gn; ELI_t15087.
DR   EnsemblGenomes-Gn; ELI_t15089.
DR   EnsemblGenomes-Gn; ELI_t15091.
DR   EnsemblGenomes-Gn; ELI_t15093.
DR   EnsemblGenomes-Gn; ELI_t15095.
DR   EnsemblGenomes-Gn; ELI_t15097.
DR   EnsemblGenomes-Gn; ELI_t15099.
DR   EnsemblGenomes-Gn; ELI_t15101.
DR   EnsemblGenomes-Gn; ELI_t15103.
DR   EnsemblGenomes-Gn; ELI_t15105.
DR   EnsemblGenomes-Gn; ELI_t15107.
DR   EnsemblGenomes-Gn; ELI_t15109.
DR   EnsemblGenomes-Gn; ELI_t15111.
DR   EnsemblGenomes-Gn; ELI_t15113.
DR   EnsemblGenomes-Gn; ELI_t15115.
DR   EnsemblGenomes-Gn; ELI_t15117.
DR   EnsemblGenomes-Gn; ELI_t15119.
DR   EnsemblGenomes-Gn; ELI_t15121.
DR   EnsemblGenomes-Gn; ELI_t15123.
DR   EnsemblGenomes-Gn; ELI_t15125.
DR   EnsemblGenomes-Gn; ELI_t15127.
DR   EnsemblGenomes-Gn; ELI_t15129.
DR   EnsemblGenomes-Gn; ELI_t15131.
DR   EnsemblGenomes-Gn; ELI_t15133.
DR   EnsemblGenomes-Gn; ELI_t15135.
DR   EnsemblGenomes-Gn; ELI_t15137.
DR   EnsemblGenomes-Gn; ELI_t15139.
DR   EnsemblGenomes-Gn; ELI_t15141.
DR   EnsemblGenomes-Gn; ELI_t15143.
DR   EnsemblGenomes-Gn; ELI_t15145.
DR   EnsemblGenomes-Gn; ELI_t15147.
DR   EnsemblGenomes-Gn; ELI_t15149.
DR   EnsemblGenomes-Gn; ELI_t15151.
DR   EnsemblGenomes-Gn; ELI_t15153.
DR   EnsemblGenomes-Tr; EBT00001654056.
DR   EnsemblGenomes-Tr; EBT00001654057.
DR   EnsemblGenomes-Tr; EBT00001654058.
DR   EnsemblGenomes-Tr; EBT00001654059.
DR   EnsemblGenomes-Tr; EBT00001654060.
DR   EnsemblGenomes-Tr; EBT00001654061.
DR   EnsemblGenomes-Tr; EBT00001654062.
DR   EnsemblGenomes-Tr; EBT00001654063.
DR   EnsemblGenomes-Tr; EBT00001654064.
DR   EnsemblGenomes-Tr; EBT00001654065.
DR   EnsemblGenomes-Tr; EBT00001654066.
DR   EnsemblGenomes-Tr; EBT00001654067.
DR   EnsemblGenomes-Tr; EBT00001654068.
DR   EnsemblGenomes-Tr; EBT00001654069.
DR   EnsemblGenomes-Tr; EBT00001654070.
DR   EnsemblGenomes-Tr; EBT00001654071.
DR   EnsemblGenomes-Tr; EBT00001654072.
DR   EnsemblGenomes-Tr; EBT00001654073.
DR   EnsemblGenomes-Tr; EBT00001654074.
DR   EnsemblGenomes-Tr; EBT00001654075.
DR   EnsemblGenomes-Tr; EBT00001654076.
DR   EnsemblGenomes-Tr; EBT00001654077.
DR   EnsemblGenomes-Tr; EBT00001654078.
DR   EnsemblGenomes-Tr; EBT00001654079.
DR   EnsemblGenomes-Tr; EBT00001654080.
DR   EnsemblGenomes-Tr; EBT00001654081.
DR   EnsemblGenomes-Tr; EBT00001654082.
DR   EnsemblGenomes-Tr; EBT00001654083.
DR   EnsemblGenomes-Tr; EBT00001654084.
DR   EnsemblGenomes-Tr; EBT00001654085.
DR   EnsemblGenomes-Tr; EBT00001654086.
DR   EnsemblGenomes-Tr; EBT00001654087.
DR   EnsemblGenomes-Tr; EBT00001654088.
DR   EnsemblGenomes-Tr; EBT00001654089.
DR   EnsemblGenomes-Tr; EBT00001654090.
DR   EnsemblGenomes-Tr; EBT00001654091.
DR   EnsemblGenomes-Tr; EBT00001654092.
DR   EnsemblGenomes-Tr; EBT00001654093.
DR   EnsemblGenomes-Tr; EBT00001654094.
DR   EnsemblGenomes-Tr; EBT00001654095.
DR   EnsemblGenomes-Tr; EBT00001654096.
DR   EnsemblGenomes-Tr; EBT00001654097.
DR   EnsemblGenomes-Tr; EBT00001654098.
DR   EnsemblGenomes-Tr; EBT00001654099.
DR   EnsemblGenomes-Tr; EBT00001654100.
DR   EnsemblGenomes-Tr; EBT00001654101.
DR   EnsemblGenomes-Tr; EBT00001654102.
DR   EnsemblGenomes-Tr; EBT00001654103.
DR   EnsemblGenomes-Tr; EBT00001654104.
DR   EnsemblGenomes-Tr; EBT00001654105.
DR   EnsemblGenomes-Tr; EBT00001654106.
DR   EnsemblGenomes-Tr; ELI_r15155-1.
DR   EnsemblGenomes-Tr; ELI_t15067-1.
DR   EnsemblGenomes-Tr; ELI_t15069-1.
DR   EnsemblGenomes-Tr; ELI_t15071-1.
DR   EnsemblGenomes-Tr; ELI_t15073-1.
DR   EnsemblGenomes-Tr; ELI_t15075-1.
DR   EnsemblGenomes-Tr; ELI_t15077-1.
DR   EnsemblGenomes-Tr; ELI_t15079-1.
DR   EnsemblGenomes-Tr; ELI_t15081-1.
DR   EnsemblGenomes-Tr; ELI_t15083-1.
DR   EnsemblGenomes-Tr; ELI_t15085-1.
DR   EnsemblGenomes-Tr; ELI_t15087-1.
DR   EnsemblGenomes-Tr; ELI_t15089-1.
DR   EnsemblGenomes-Tr; ELI_t15091-1.
DR   EnsemblGenomes-Tr; ELI_t15093-1.
DR   EnsemblGenomes-Tr; ELI_t15095-1.
DR   EnsemblGenomes-Tr; ELI_t15097-1.
DR   EnsemblGenomes-Tr; ELI_t15099-1.
DR   EnsemblGenomes-Tr; ELI_t15101-1.
DR   EnsemblGenomes-Tr; ELI_t15103-1.
DR   EnsemblGenomes-Tr; ELI_t15105-1.
DR   EnsemblGenomes-Tr; ELI_t15107-1.
DR   EnsemblGenomes-Tr; ELI_t15109-1.
DR   EnsemblGenomes-Tr; ELI_t15111-1.
DR   EnsemblGenomes-Tr; ELI_t15113-1.
DR   EnsemblGenomes-Tr; ELI_t15115-1.
DR   EnsemblGenomes-Tr; ELI_t15117-1.
DR   EnsemblGenomes-Tr; ELI_t15119-1.
DR   EnsemblGenomes-Tr; ELI_t15121-1.
DR   EnsemblGenomes-Tr; ELI_t15123-1.
DR   EnsemblGenomes-Tr; ELI_t15125-1.
DR   EnsemblGenomes-Tr; ELI_t15127-1.
DR   EnsemblGenomes-Tr; ELI_t15129-1.
DR   EnsemblGenomes-Tr; ELI_t15131-1.
DR   EnsemblGenomes-Tr; ELI_t15133-1.
DR   EnsemblGenomes-Tr; ELI_t15135-1.
DR   EnsemblGenomes-Tr; ELI_t15137-1.
DR   EnsemblGenomes-Tr; ELI_t15139-1.
DR   EnsemblGenomes-Tr; ELI_t15141-1.
DR   EnsemblGenomes-Tr; ELI_t15143-1.
DR   EnsemblGenomes-Tr; ELI_t15145-1.
DR   EnsemblGenomes-Tr; ELI_t15147-1.
DR   EnsemblGenomes-Tr; ELI_t15149-1.
DR   EnsemblGenomes-Tr; ELI_t15151-1.
DR   EnsemblGenomes-Tr; ELI_t15153-1.
DR   EuropePMC; PMC2655494; 19168610.
DR   EuropePMC; PMC3535987; 23114762.
DR   EuropePMC; PMC5989583; 29620507.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000157.
DR   SILVA-SSU; CP000157.
XX
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group.  Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3052398
FT                   /organism="Erythrobacter litoralis HTCC2594"
FT                   /strain="HTCC2594"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:314225"
FT   gene            complement(join(3051232..3052398,1..6063))
FT                   /locus_tag="ELI_15060"
FT                   /note="ELI_00005"
FT   CDS_pept        complement(join(3051232..3052398,1..6063))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_15060"
FT                   /product="hypothetical protein"
FT                   /note="COG3210 Large exoprotein involved in heme
FT                   utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_15060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC65104"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041248"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ8"
FT                   /protein_id="ABC65104.1"
FT                   /translation="MFARHLRKTLAIGTALTLGLAASPAFAQLINAGDLVNARDSAGNP
FT                   NQLTVTNPNASTANVSVLAPVVVANWNNFNVPTGTTANFTNASAAPTASVLNRVTGGNF
FT                   SDIGGTINANGVNLWLINPNGILFGSNTSVSANSFYASTLDVADQDFFDFYEGTNLFAN
FT                   GTNVFELIGVSSAGIISPSGASFTTNGNLLFASHSLNLTATFNSGSGTAVFAASDNVRV
FT                   ISQPASPLSVSISRSGGTGSNSQFIGGSVTGASIYAGAHFLTNTGVTSLLQIDATLTAT
FT                   QAYATGDGIRLETSRGLVLGTTRLELNGAATSPSFVRLISNNVRATQSITGGSVSIVDG
FT                   NVELGDVTATNGDLSIASGMLVAGNLRATGSVIASGSTSATIASVTADSDLNGAGTVVL
FT                   NSAFGSLTVTGSTTGAVANLMSAGQLSAGDIAATRGGVLVRTSNGSAPLAVGPISVGAI
FT                   SATGGDVTVLSVGSNVASTQTGAITSSGSILAESSAGGSLSLGVLSAGTTITLNTTGST
FT                   AVGGVNSAQSLATDAGGTTTFSGDVTTGTLTINDNLTSARNITVTNGGIVLNNALTAET
FT                   LTATGAITLNGTGAFSLTGAVANSDGIDAEGVAIGATTLPTSLTITGATSGGSVDLQAA
FT                   GNLQLGNVASTAGFVDLDSTGGAITTGAVSATGGSALLTAPGAITTSSIGSSAAIDVDS
FT                   TGGGNLDLGNMTAGTTISLDTSGSMTAGTATAGGALGVGASADPSSVTFSGNISAAGID
FT                   LDSIGAITSKDLLATGGSVDVQASAGSVTTGTITGNGPSPVIVKAGGATSDIATGAIRS
FT                   DGSDIFLTAGRNIASGNIATSLGATATTGSVLLHSNGAMQLVDLTAGTDIVVTSNNGAV
FT                   TAGNMLAGDDIRVVAASDIQFTSTTTTGLGADNTSYTFVQPAGTGSYVTGAETQTGSNI
FT                   ALNSASGNIAGGAIDKRGSFGNATLTAPGAITTSSILSLGGIDIESTGSGALNLGNLNA
FT                   LLPITLDTAGSVAFNNVVVGASLFDIGRTLAPSSVTGTGTINAMVLSARTTGALTLDNA
FT                   NQIMGLGTITAGGPVTLNSTINLGINGPVAATGQDVTIKSSGNLTIGAGGSITGKIVGL
FT                   SASGNFINNRGAAAINASDHWVVYSAAPSGNTFNGLDSGNTAIWNATIGSLAPSAVSDN
FT                   RYVFAFRPTVTVASTNASKVYGTNLTGALGSNWTASGFQPGVAGAFLADTQGNVLSGAP
FT                   TVSSSGSAANADVSGSPYTISLAQGTLATSRGYSLSLSDAGRLTITPKAITASVSANSK
FT                   TYDGTTAGTGSVTLNGVVAGDAVGTSGTTFTFADKNAGTGKTVSVSGTALTGADAGNYT
FT                   LSVPASTLADILKRFLSFRVIVDNKVYDGTTSASGSIDLVGIVGSDNVFAQDPSFAFND
FT                   KNVGTDKSVSFGFTLGGADSQNYQAAAPLNAARASITPKPIGLVATANSKTYDGTTAGT
FT                   GSVTLNGVVAGDAVGTSGTTFTFADKNAGTGKTVSVSGTALTGTDAGNYTLSVPASTLA
FT                   DILAKAITASVSANSKTYDGTTAGTGSVTLNGVVAGDAVGTSGTTFTFADKNAGTGKTV
FT                   SVSGTALTGTDAGNYTLSVPASTLADILAKAITASVSANSKTYDGTTAGTGSVTLNGVV
FT                   AGDAVGTSGTTFTFADKNAGTGKTVSVSGTALTGTDAGNYTLSVPASTLADILAKAITA
FT                   SVSANSKTYDGTTAGTGSVTLNGVVAGDAVGTSGTTFTFADKNAGTGKTVSVSGTALTG
FT                   ADAGNYTLSVPASTLADILAKAITASVSANSKTYDGTTAGTGSVTLNGVVAGDAVGTSG
FT                   TTFTFADKNAGTGKTVSVSGTALTGADAGNYTLSVPASTLADILKRFLSFRVIVDNKVY
FT                   DGTTSASGSIDLVGIVGSDNVFAQDPSFAFNDKNVGTDKSVSFGFTLGGADSQNYQAAA
FT                   PLNAARASITPKPIGLVATANSKTYDGTTAGTGSVTLNGVVAGDAVGTSGTTFTFADKN
FT                   AGTGKTVSVSGTALTGTDAGNYTLSVPASTLADILAKAITASVSANSKTYDGTTAGTGS
FT                   VTLNGVVAGDAVGTSGTTFTFADKNAGTGKTVSVSGTALTGTDAGNYTLSVPASTLADI
FT                   LAKAITASVSANSKTYDGTTAGTGSVTLNGVVAGDAVGTSGTTFTFADKNAGTGKTVSV
FT                   SGTALTGTDAGNYTLSVPASTLADILAKAITASVSANSKTYDGTTAGTGSVTLNGVVAG
FT                   DAVGTSGTTFTFADKNAGTGKTVSVSGTALTGADAGNYTLSVPASTLADILRRLVSITA
FT                   DNQNKVEGSADPQLTFTVTSGSLVAGDSFSGSLSRESGEAPAIYEITIGTLSAGDNYTL
FT                   EFNPGLLTIVPDNSNAERVEVPVIFRSVPLPGSSGTGPQNSQSSVTIERNALCSSETEE
FT                   CATE"
FT   gene            complement(6086..7825)
FT                   /locus_tag="ELI_00010"
FT   CDS_pept        complement(6086..7825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00010"
FT                   /product="hypothetical protein"
FT                   /note="COG2831 Hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62094"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ7"
FT                   /protein_id="ABC62094.1"
FT                   /translation="MPKNVLSRAVLTSAYALATACVAVGGSLSAQSLPSREQIELPQPT
FT                   APDLNPNISVDREDVRQAPCPFDASELTANITTVTFSGPDNRVLPADIAALLADIVPGE
FT                   GMLPISQLCDLRDEAARRLDDAGYIAAVTIPEQQISNEARSARLSVILARLAEVQVVGD
FT                   QGGQAGRIAARVERLKNLYPLRIADLERELLLASDNPGLDVALNLVAAPNGQPGEVIGQ
FT                   LRVIRKPFAITASANNLGSRALGREIGSVRAELYGLTGLADVTFIGASATLDFEEQWTI
FT                   QGGHYFSLDSGLTFGGSLAYAESRPTIGLPLKADSLLGAIEAYYPVTRTVTSRGILGGG
FT                   LEIINQDSVLSAGGVTVPVTRDKLRVAFAKLEGTQREFAPDGRVISLLSGTIQLRKGLD
FT                   IFDATQRGTADGLYFPSKLEGDPTALLVRGGYSISQRFGDFALLTQLQGQYSGVPLLAF
FT                   EEFSVGNYTIGRGYDPASTSGDSALGVRVQPSVVFRSGRTTIEPYGFVDAVRIWNKDTF
FT                   TTENGRSLSSAGLGARVYFADRFVLDAAWAHPFDKPLNVPGSSRAPGRFLVSLTASFGP
FT                   SAR"
FT   gene            8104..9186
FT                   /locus_tag="ELI_00015"
FT   CDS_pept        8104..9186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00015"
FT                   /product="regulatory protein, LuxR"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62095"
FT                   /db_xref="GOA:Q2NDZ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ6"
FT                   /protein_id="ABC62095.1"
FT                   /translation="MPISLEEAYDALADESLFSALIDSFGERLGARSYAGGWASNNSVE
FT                   QIVAFKGFETDQVQQYLAGFAEIDPWTVAFLKRPVYGRFVDMLDYVDSDAYARSALYKR
FT                   FFEPEGIDVFYAVAFMMLTDATQSGLTFHRGKKDGEFGPDAIAAVNEDAGDLARLFHLK
FT                   VRMSQLLHKVTDWEKLLSRVNVELYLIDRSGRLVDCNETARLMLQQEQGLLVQAGRISA
FT                   TDPLTRAALERILGAAQKNRLEATDSFTVGSGGSARRLVVLPVESASGDLRLALIGESK
FT                   KQLGAEVEPMLRAAYRLSPIEASIMIRLANGEGPKAISVSRSVSQETTKTQYRSAMRKM
FT                   DCRTLTDAIIAVRRLPGAWS"
FT   gene            complement(9236..10564)
FT                   /locus_tag="ELI_00020"
FT   CDS_pept        complement(9236..10564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00020"
FT                   /product="hypothetical protein"
FT                   /note="COG3307 Lipid A core - O-antigen ligase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62096"
FT                   /db_xref="GOA:Q2NDZ5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ5"
FT                   /protein_id="ABC62096.1"
FT                   /translation="MNGMIGWAKREPYWAFGLALGFLPVVSALLFRTYSHHVAPLWFEQ
FT                   IRQFDLLFVAFEIGVIVAARSSGMSYAAAFQSLTKSQIAALCLWLATFWWSSVLVSEIP
FT                   AFSILRAFLWIIHLGFALAIFHLFRDVTRQDLETLAKALLLGLVVYVPILVAHFAMAPS
FT                   AQSMPDGEIIWTSALPGYLSVRLFGFYTATLAALAVGLLWDRHEYQREDWWLYAMLALS
FT                   LTLTFWSGTRGGMLAVACLLLALPVLTRRRPSTWWLTSIVAIAIVAVAASELLFQPNNA
FT                   FGISRVGTEPGRDVTAGRWDLWMIALDLIAQRPVLGWGESALVWVLQNEAGHQQPHNLA
FT                   LQLLLSWGAIATLAAAFLAVAAARILLRHASRIPELVPLLALVLSLLIMSGADGILYNP
FT                   RTALLLFFATAMGLAKVARLRGDEEIFAIRPVSETDSALPGYP"
FT   gene            10683..11807
FT                   /locus_tag="ELI_00025"
FT   CDS_pept        10683..11807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00025"
FT                   /product="putative dolichol-phosphate mannosyltransferase"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62097"
FT                   /db_xref="GOA:Q2NDZ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ4"
FT                   /protein_id="ABC62097.1"
FT                   /translation="MYAYKLDEFAQQAGRLDCAIIVPILNEAANIQPLIEKIGTVLTGY
FT                   DAEIIFVDDGSTDGSLEILESIAAANRSIRVIRRIGRRGLSSAVVEGFLSTVAPVVAVM
FT                   DGDLQHDESVLPAMIAALQSGEADLAYGSRYAGGGSVGDWAADRLMISNVATRMAGSVM
FT                   KTPLSDPMSGFFAIRRELFLDIAPRLSQAGYKILLDIVASHPEPIRVKQVPYKFRTRTA
FT                   GESKLDSMVVLEYVELLLEKLVGRLVPVKLLMFGAVGLVGTLVHLALLWGALTGLGASF
FT                   AIAQGSATLGAMTFNFALNNVFTYRDRKLTGWRWVTGWLSFCAACGIGAVANVGIGTLL
FT                   YTEAWSWWIAGLAGALIGSVWNYAATSWLTWRKR"
FT   gene            11783..13297
FT                   /locus_tag="ELI_00030"
FT   CDS_pept        11783..13297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00030"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62098"
FT                   /db_xref="GOA:Q2NDZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ3"
FT                   /protein_id="ABC62098.1"
FT                   /translation="MADLAQTLTSRPAQWGWLREGSLSLGLALALAALLIRYPAFGDPN
FT                   YHIDEGFYLFVGQQMQHGLLPYLDIWDRKPAGLFLLYGTIASFGGIVAYQLTAGVFAWA
FT                   TACVVAAVVGRFADRTAAVLAGVLYLCLIGALAGGGGQSPIFYNLFVALAGLLVLQVIE
FT                   ARSDAPGWRGDAAMVLCGLALTIKPTAVVEGAFFGLALLIVRWLCSRALIATMLLGVRL
FT                   AVFGALPTLLIWAWFAAMGGFAEYWFATMQSIFMTASPPAEAGWMRLRYLLAITWLPLA
FT                   LALAGVAMLLRTPEHLGQPQAWFVAGWLGAALLGFLTVPNFYDHYALPVATAVAVACGA
FT                   LFARPTTGPVLGAAACLYVLYASGFPAAQLDRAARSAEGYASAQATIARHIGDGCLFAY
FT                   DAPPALYRGFRVCDGTRYLFPEHLSNQREAAAIGADPVEELARVLEGKPAVIVASAEPT
FT                   VETPNRATRELIEAHLAGRYTLVGTAELADVVRPQTIEIWATKSSR"
FT   gene            13421..15073
FT                   /locus_tag="ELI_00035"
FT   CDS_pept        13421..15073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00035"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62099"
FT                   /db_xref="GOA:Q2NDZ2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ2"
FT                   /protein_id="ABC62099.1"
FT                   /translation="MSEWIDLARQACAAARDFAEAARVVAAVAVAPEGRPDPVLVEREQ
FT                   RLVHGYAWIGTTVAALEATADWASRAEAAGRFVDVDELVLKIGFGEYLHQLASGVPMSQ
FT                   NEIVRPGELGLDRAASTLCDNTATARFMTEGNTAANRTKLAVLLAEGARPDEAFGDETL
FT                   DLIREQFRAFTADKITPHAHQWHMDDALIPMEVVQEMAALGVFGVCIAEKHGGLGLGKT
FT                   AMCLVSEELSRGWICAGSLGTRSEIAGELIGENGTAEQKAKFLPQIADGSILPTAVFTE
FT                   PDTGSDLASVRMRGVRQADGSWQVSGAKTWITHAARADLMTMLVRTDPGTPGYGGLSML
FT                   LAEKTRGTDADPFPDTGIDGSEIEVLGYRGMKEYALGFDGFAVAADGLLGGAEGQGFKQ
FT                   LMRTFEGARIQTAARAIGVAWNAFDLGLQYALERKQFGKPLLAFPRVADKLALMVAELV
FT                   LARELTYSAARHKDKGDRCDIEAGQAKLLAARTAWSNADNALQIHGGNGYALEYPISRV
FT                   LCDARILNIFEGAGEIQAQVIGRGTLKAQPSAA"
FT   gene            complement(15055..17964)
FT                   /locus_tag="ELI_00040"
FT   CDS_pept        complement(15055..17964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ1"
FT                   /protein_id="ABC62100.1"
FT                   /translation="MPEILNLQSMIDFAKLGEEKAFVEAIYTLGKQYHETFKDIDGPSD
FT                   AMELLRLVADNADDADLKAAFAGVGAGDIFDDLAAQATRLDALLDKIPDKLMTVLEPLD
FT                   SFGSDSTRAENKFGAIDWLKLDEETSASGGGSGQASYEFEFEGGLKLDTTANTTWSYSD
FT                   TLPANLMCMRAGGSLKTKAAGSVPLPFGRVGGGADARAEAGIEYYFAPADRDQFYGLAL
FT                   ASRFDDLVNPFDFDSVWNGFASSDLAAVHYRFDGEAGVELKLALAKAFSVGHAIDAKLG
FT                   ASVEAALRIAGQWNLSLMRDVASPGQQRILLKLSRSRSETSNLAASLGIDVDMTKLSGP
FT                   VHEILQDALGKWDAVLEDVQPYLTPGTLLRQEAGEFLTAKATELVENADLRAALVRDLE
FT                   GVIAAGQPGKSELVDWMTGQLTGALDSAQGWARNKAKGVTGMVSALGDGVPALSEARFG
FT                   DLLTAKADELIGKVGSNLAEMIDGKSDNARKNIGRAIDRLGVKIDGNVTSADEAMQAVT
FT                   GLIDRYDTLFRKMVEASKDAARYKISAGIQIEEARQQGSILEFSGAFTADTQEARNAFR
FT                   AITRGRMSALVALLRSQGANGIEVDRTSSLKRFVSSQSGRGFDFVAFGFGLSSKSLLSA
FT                   DTSVLVDGEGNVQIDSKSSLMKRFKGEDAEREITLLSSFALTLAASTPVAPSSAQRALG
FT                   LAVSMGHIDDNLEKHEVLRFVGSLVDAGLIGEASRRLAEQTWTRWAGSGGSDTKIAGRL
FT                   LLKLALDQAGLEKMLLLGSNAGKSSISDEQSMEIRLQSFDIVSQEIGRINPNIRTTIAY
FT                   LEKEEPGKDIDHFVLNWKKARNALRLDHRSADIHDFGNTFLQAARMGEDLVDMIEGFRA
FT                   IYFSVPAVEGEDRPGAWDADDYHDEQKNIAGKSSRWLQLNSSLFWTNSKVHPRVIALLK
FT                   VLALRAKLDIRDRLSLTMTHTGSDTPETVVLLPDQAAEG"
FT   gene            complement(18224..19492)
FT                   /locus_tag="ELI_00045"
FT   CDS_pept        complement(18224..19492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00045"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62101"
FT                   /db_xref="GOA:Q2NDZ0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDZ0"
FT                   /protein_id="ABC62101.1"
FT                   /translation="MPEAYIVDAVRTPRGIGKVGKGALANEHPQHLAATVLKAIKERND
FT                   LDTATVDDVIWSVSTQDGKQAGDMGRMAALDAGYDVTSSGMTLDRFCGGGITSVNLAAA
FT                   QVMSGMADCVVAGGTEMMSLTAEMAKAKMQAGIDLPRMGSGNARLQATHPQSHQGVCGD
FT                   AIASMEGFTREELDEVGYRSQQRAAQAIEEGRFDKSIVPVVDDDGNVILDREEFPRPQT
FT                   TMETLGQLEPAFTKLADIPLDKKGTTFRGLINQKYPDLEIKHFHHAGNSSGVVDGAAGV
FT                   LVASKEYCEKHGLKPRARIVATANMGDDPTLMLNAPVPAAKKVLEKAGMTLDDIDLFEI
FT                   NEAFAVVAAKFVRDLDLDWDKVNVNGGAIALGHPIGATGSMLIGTMVDELERQGKTTGM
FT                   VTMCAAGGMAPAIIVERVDDFVD"
FT   gene            19608..20393
FT                   /locus_tag="ELI_00050"
FT   CDS_pept        19608..20393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00050"
FT                   /product="enoyl CoA dehydratase/isomerase"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62102"
FT                   /db_xref="GOA:Q2NDY9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY9"
FT                   /protein_id="ABC62102.1"
FT                   /translation="MSDTDTQAQTEEVLTETRDGILIITINRPEAKNAMTKAASEGIAA
FT                   ALDRLDSEDDLRVGILTGAGGTFCSGMDLKGFLRGETPSVPGRGFGGLTEQSPAKPLIA
FT                   AVEGYALAGGMELMISCDLIVANSGSKFGIPEAKRGLVAAAGGLMKLPDLIPPKVAMEL
FT                   ALTGDFIDSARAYELGLVNRVTDGSALDAAIELAQAITANGPLAVKVSKQIIEESRGWP
FT                   LEERWKEQGKLMPQIFMSEDAREGAAAFAEKRAPNWKGK"
FT   gene            20396..21544
FT                   /locus_tag="ELI_00055"
FT   CDS_pept        20396..21544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00055"
FT                   /product="hypothetical protein"
FT                   /note="COG1804 Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62103"
FT                   /db_xref="GOA:Q2NDY8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY8"
FT                   /protein_id="ABC62103.1"
FT                   /translation="MAGPLNGIRIVEFAGIGPGPFCGMMLADHGAEVIRIDRASGSRGG
FT                   SQPVTSKDVLARGRKSIAVDLKSAEGVALARKLAASADGIIEGFRPGVMERLGLGPDEL
FT                   LKDNPKLVYGRMTGWGQTGPYAPWAGHDINYIALAGALAHYGRAGGKPTPPINMVGDFG
FT                   GGGMMLAFGMVSALLNVARGGEGQVIDCAMTDGTAVLMSMMHGMKNMGVWSEELGVNLL
FT                   DTGAHFYDTYETADGKFISIGSIEPQFYAELRKLAGLEDDTQFDAQHDRAQWGAMKDKL
FT                   TVLFKTRTRDEWNATMEHTDVCYAPVLTMSEAAQHPHNVARETFIEVGGDTQPAPAPRY
FT                   SGTANANPEPAPMPGDDTDAILSSLGIEADEAAALRDAGTVG"
FT   gene            21572..22714
FT                   /locus_tag="ELI_00060"
FT   CDS_pept        21572..22714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00060"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62104"
FT                   /db_xref="GOA:Q2NDY7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY7"
FT                   /protein_id="ABC62104.1"
FT                   /translation="MLDTSQRFAYNEDHEMFRDTVRKVFSQHLEPHLDEHEEKGIVPRE
FT                   IWKAVGEAGLLCPTVKEENGGLGLDFGFNCVLCEELSYIGSSAGFTLQSDITANYIERL
FT                   GSDEQRAKYLPGMVSGDVITAIAMTEPGAGSDLQGIRTTAIEDGNHLVINGSKTYITNG
FT                   QNADVVIVVAKTDPSQGAKGTSLVLVDADTPGFERGRNLDKIGQHSADTSELFFNDCRV
FT                   PKTNILGQEGRGFIHLMEELPQERLGIAVGAQAAAQRAFDEAVKFTKDRKAFGQTVFEF
FT                   QNTKFTLADLKAELQVGWAHLDWAIKRHLAGELTTEEASAAKLWHTDLQWKAVDTSLQL
FT                   HGGAGYMNEYTIARLWRDARVTRIFGGTNEIMKEVISRGI"
FT   gene            23327..23758
FT                   /locus_tag="ELI_00065"
FT   CDS_pept        23327..23758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00065"
FT                   /product="ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62105"
FT                   /db_xref="GOA:Q2NDY6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDY6"
FT                   /protein_id="ABC62105.1"
FT                   /translation="MAKKIDGYIKLMVPAGTANPSPPLGPALGQRGVNIMEFCKAFNAA
FT                   TDGMEKNAPVPTVITVYADRSFSFVTKQPTATYLIKKAAKIKKGSGETGKVSAGTIKQS
FT                   QVKEIAETKMPDLNANDIDQAMKIIEGSCRAMGLEVVEG"
FT   gene            23763..24455
FT                   /locus_tag="ELI_00070"
FT   CDS_pept        23763..24455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00070"
FT                   /product="ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62106"
FT                   /db_xref="GOA:Q2NDY5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDY5"
FT                   /protein_id="ABC62106.1"
FT                   /translation="MAKQTKKQQEVAKLDPEKLYTVDEAIAVLREHKAKFDETVEVAMN
FT                   LGVDPRHADQMVRGMVSLPSGTGKTVKVAVFAKGDNAEKATAAGADKVGAEDLMEDMQN
FT                   GNLDYDRVIATPDMMGVVGRLGKVLGPKGLMPNPKLGTVTPNVEQAVKDAKGGQVEFRV
FT                   EKMGIIHSGIGKMSFKDEDLKANFKSFTDAIVKAKPSGAKGKYVKKVSLTSSMGPGLKI
FT                   DLAEVEGA"
FT   gene            24695..24871
FT                   /locus_tag="ELI_00075"
FT   CDS_pept        24695..24871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62107"
FT                   /db_xref="GOA:Q2NDY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY4"
FT                   /protein_id="ABC62107.1"
FT                   /translation="MLGSLWAILTIIGPLLLIGVIVYAWKKNRDAPDRTIRQAERGARE
FT                   IYDSEPGDPNSRS"
FT   gene            complement(25033..26010)
FT                   /locus_tag="ELI_00080"
FT   CDS_pept        complement(25033..26010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62108"
FT                   /db_xref="GOA:Q2NDY3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY3"
FT                   /protein_id="ABC62108.1"
FT                   /translation="MTTVYITIDTEYSSGFCNGPGPVDRAENFARSIACLTPEGPAGIT
FT                   HKLKLLNEHGQKAVFFVDPMPALQWGVAAIEDIVAPILEAGQDVQLHCHTEWLALVGAA
FT                   NPLGDRTGRNIKDFTFEEQCVLLAWARDTLVAAGAPKPVAFRAGNYGANDDTLRALAAI
FT                   GMRYDSSHCPALVGSGDNAIALSAQDQRTMLYEGVIEVPVGCIGALGGSLRHAQLTALT
FT                   LQEMLAAIRHAKAQDMNSFTLVSHSFELINRRKLAVNRIVRRRFAGLLRELSQMEGVET
FT                   GTYAETPPLLAGNQRPATPLPPSPIRTGMRYAEQAVSNALYGAL"
FT   gene            complement(26123..26890)
FT                   /locus_tag="ELI_00085"
FT   CDS_pept        complement(26123..26890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00085"
FT                   /product="nucleotide-utilizing enzyme"
FT                   /note="COG1058 Predicted nucleotide-utilizing enzyme
FT                   related to molybdopterin-biosynthesis enzyme MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62109"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY2"
FT                   /protein_id="ABC62109.1"
FT                   /translation="MTVASSDRIWTAGLVVIGDEILSGRTHDKNIAQVASWLQVQGIRL
FT                   AEVRVVPDIQEKIVGAVNALREENDYLFTTGGIGPTHDDITVDAVAEALGVGVVVHPTA
FT                   RAILEKYYADKGGITEARLRMARVPQGAELIPNRMSGAPGIKIGNVHLMAGVPHITAGM
FT                   LDALTGTLEGGMPLKSETIGCWTAESEVAEILRDAEQAHEHCQIGSYPFFRDGKVGANF
FT                   VVRSTDADELASCVHTLCDALATAGHDFTPGGI"
FT   gene            complement(26923..28431)
FT                   /locus_tag="ELI_00090"
FT   CDS_pept        complement(26923..28431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00090"
FT                   /product="monooxygenase, flavin-binding family protein"
FT                   /note="COG2072 Predicted flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62110"
FT                   /db_xref="GOA:Q2NDY1"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY1"
FT                   /protein_id="ABC62110.1"
FT                   /translation="MTIANTDFDVLIVGAGISGIGMAAHMEMHCPDHSYGIVEMRDNLG
FT                   GTWDLFRYPGIRSDSDMHTLGFVFEPWKHEKSIADAPAILDYLNRIVDERGIREHIRYG
FT                   HRVVAADFDRSTAQWTVTIQTKDGEKKRLTANFLYLGSGYYDYDEPYDPGFEFGDFKGQ
FT                   VIHPQFWPEDLDYAGKKVIVIGSGATAVTIVPSMADKAAHVTMLQRTPTWMFSRPAKDG
FT                   LANFLRKILPEETAYRITRWKNIKLQDIGFKRARTKPEKVRKMLYKRIEKALGKDYDKE
FT                   AFTPPYDPWDQRLCLVPDDDLFEAMNSGTASVKTGRIARFVEGGVELESGERLEADIII
FT                   TATGLKLAVAGKIDVSVDGEQIDFAQRYYYKGCMFSNLPNLAVVFGYLNASWTLRADIN
FT                   SDYICRVLNRMKATDTQIAEPVLTEAGEAALEEDDIFDFSSGYIQRGKAIMPKNAVAYP
FT                   WRLNQDYVLDRKRMVEEPVDDDLLAFKRAGANAREPGEILEAAE"
FT   gene            28552..30564
FT                   /locus_tag="ELI_00095"
FT   CDS_pept        28552..30564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00095"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62111"
FT                   /db_xref="GOA:Q2NDY0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDY0"
FT                   /protein_id="ABC62111.1"
FT                   /translation="MSAFRSLPFLALVLTAPAFAQEADEESDDVIIVTGEGLPETPAEP
FT                   AYSVREIARDQIVTTPSGRIEDALGAVAGFQQFRRSDSRSSNPSAQGVTLRALGGNATS
FT                   RALVTLDGVPMQDPFFGYVPFAALVPEQIGSIRVTRGGGSGPFGAGALAGTIALSSADI
FT                   GALGPVTASALVNDRGGTEVFGGAAVRLGEGFVTASGRWDRSQGFFTTPVDQRVPATAR
FT                   AAFDNVSGQIRAVAPLTETLELQARVLAFDDRRTLRFDGADSSASGQDASIRIVGRGDW
FT                   EVDALAYVQARNFTNVVISSTRFVKVLDQSNTPTTGIGGKLEVRPPVGENHVLRIGVDY
FT                   RRAEGELQEQPFSAFTGELRARRRTGGATSDLGFFIENDWTLGNLVLTGGLRADRTAIT
FT                   DGFFREVSAAGLTTVDNVFADQKDWTVTWRGGALFRAGESLSLRAAAYSGLRLPTLNEL
FT                   YRPFVVFPVVTEANAALDVERLEGFEAGLDWAPVDGVAFSLTAFDNRVENAVANVTLTP
FT                   TLRQRQNLPAIDAQGLELGARVSRGAFSFDGTLAYTDAEVDGTGASMALDGNRPPQTPR
FT                   WAAAATVSWKPLENGIISLTLRHVGAQFESDQETDVLPAATTLGAFVQVPLTGGFSLIL
FT                   RGENLTDETIVTRNSDGAIDLGVPRTVWGGVRYGF"
FT   gene            30617..33829
FT                   /locus_tag="ELI_00100"
FT   CDS_pept        30617..33829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00100"
FT                   /product="probable bifunctional P-450:NADPH-P450 reductase"
FT                   /note="COG2124 Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62112"
FT                   /db_xref="GOA:Q2NDX9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX9"
FT                   /protein_id="ABC62112.1"
FT                   /translation="MDAPTALAPIPQPPGKPIVGNAFTVDSSRLIQSLMELAEEYGPIF
FT                   QLEVMGTPLVFVSGADMVAEICDESRFDKTVRGPLKRLRLIAGDGLFTGDTDDPNWAKA
FT                   HHILLPSFSQKAMGSYLPMMTDIASQLMLKWERLNSDDVIDVPMDMVRLTLDTIGVCGF
FT                   GYRFNSFYREDFHPFIEALNRTLDTTQKMRGLPGEKLLKRQQIEQLNEDAAYMNNLVDE
FT                   IIRERRQTGESGQGDLLDFMLSGRDPVTGERLSDENIRYQINTFLIAGHETTSGLLSFT
FT                   LYYLLKNRDVLQRAYAEVDEVLGRNIDQTPTLSQIGRLPYIRAILSEALRLWPTAPAMG
FT                   LAPFEDEVLGGKYAIAKGTFTTVLIPSLHRDKLVWGENPEAFNPDNFSPKAEAARPPHA
FT                   YKPFGNGQRACIGRQFAIQESILVLGMLLQRFELFDHADYQLRIKETLSIKPDGFTIKA
FT                   RLRHDVERGGVATVEPESKTPDQAAAVPSHGTPLLVLYGSNLGSSEGFARELAQRGEFS
FT                   GFDVTMAPLDAHVAKLPTDGAVAIACASYNGMPPDNAAKFVDWLEQADAADAPLSNVSY
FT                   LVLGCGNSDWAATFQVVPRKIDALMEQHGAERLVPAEELDARGDLDTQFHDWLDGLIPQ
FT                   LGDAFDIDLESGFDAVFEPLYTVEITDSITGNTVADRVGAREVEVVANRELKDTSKDEG
FT                   RSTRHLEVRLPEGMEYEPGDHLCVVPVNDPAVVDRLLKRFGLDRDTFVRIESRSDMRGP
FT                   FPSGSTFSVLNLAETAGELQAVATRKDIATLARYSECPNSRAALEALAAPPSADGTDRY
FT                   TSEVLEKRRSVLDMLEEFPACDVPLAVFLELIPFLSPRYYSISSAPEANQGLCSITVGV
FT                   VKGPALAGTGEFKGTCSAYLADLPPGDRFRAVVRKPTAQFRLPDNPETPVIMIGPGTGV
FT                   APFRAFLQRRDHLQEDGAVLGEAMLFFGCRHPDIDYLYREELDDYDQRGVATVHAAFSR
FT                   HDGSRTYVQDLIAREADRVWELIEQDARIYVCGDGARMEPDVRKALMAIYAEKKSSDEA
FT                   SAKAWIDDLVAQDRYLLDVWVG"
FT   gene            33987..35177
FT                   /locus_tag="ELI_00105"
FT   CDS_pept        33987..35177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00105"
FT                   /product="site-specfic recombinase, phage integrase family
FT                   protein"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62113"
FT                   /db_xref="GOA:Q2NDX8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX8"
FT                   /protein_id="ABC62113.1"
FT                   /translation="MGTIVGTGAIIMGKLTAVKAKAIKEAGRYSDGNGLQLVVKASGAK
FT                   SWILRVQHDGKRRDIGLGPLSEVGPAEAREKAVEARKVIRGGGDPSGLKSGSGRISGRP
FT                   PTFRELATSYHDDHKSSWKNAKHREQWLSTLDTYAFPIFGDQPVDRVDSRDVLDCLKPI
FT                   WNAKPETARRVLQRVLRVLNYAHGMGHREHEAPTQSIRAALGKQRSQVRHHASLPYAEM
FT                   PELMAKLEAASGVGAMALRFAILTAARSGEVRGAQWNEMDLAKKTWTVPAERMKARRAH
FT                   AVPLSPAALAILEDAKGLRKKPEGFVFPSSRGIALSDMTLLKAIRAASDQNTTVHGCRT
FT                   SFRVWAAEKTSCPAAAAEAALAHTIHNKAEAAYHRTDYLDIRRQLMADWGAFLAGG"
FT   gene            complement(35602..35787)
FT                   /locus_tag="ELI_00110"
FT   CDS_pept        complement(35602..35787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62114"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX7"
FT                   /protein_id="ABC62114.1"
FT                   /translation="MTVEQENFCTKAVQSQRGELPLMETEHAWHRGLDLDKAVDIAGSN
FT                   QPSVAGFHGAKFPVAN"
FT   gene            complement(36813..37406)
FT                   /locus_tag="ELI_00115"
FT   CDS_pept        complement(36813..37406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00115"
FT                   /product="putative membrane protein"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62115"
FT                   /db_xref="GOA:Q2NDX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX6"
FT                   /protein_id="ABC62115.1"
FT                   /translation="MDRVRRVKLTGQFRPFSRHIRRYFHAYGGWSGVFGSPLFLVSVLI
FT                   AAASYRQWLNPDWVDTIYALVPSLLGFSLGTYAILFSLITARVKGAMRAVKSDDDVSAL
FT                   EQVNATFFHFIFVQVIALVWAFGFDGSAFADLAAATKASLPAIGWGFVVLKLVGSFVGY
FT                   TLLVYSITLVVGAALAIYRLALISDPGETGEQDQ"
FT   gene            complement(37385..38116)
FT                   /locus_tag="ELI_00120"
FT   CDS_pept        complement(37385..38116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62116"
FT                   /db_xref="InterPro:IPR031832"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX5"
FT                   /protein_id="ABC62116.1"
FT                   /translation="MLSLVHKEANDRGFVSGIITTFVKVEFDGRWFDASEMQDATEAQV
FT                   AKVQIPENLHPNAASFYFEFDTEKHRLYVQSYSEGKSLSARQAQTLFESLAAAPRIQAE
FT                   YGKVHVTIVQSRAGLEALFALPVIKEVKITIYKPNPDIFADDFENQIEAHLAQTNSQRI
FT                   SLSYQADPGQSVNPTDEMRAVSEVALENGEVEVRGRDEKGAVTKSTEQMPAELHDKFDP
FT                   DEMSEQNAFRRLIPRWIGLGG"
FT   gene            complement(38530..38618)
FT                   /locus_tag="ELI_t15153"
FT   tRNA            complement(38530..38618)
FT                   /locus_tag="ELI_t15153"
FT                   /product="tRNA-Ser"
FT   gene            38843..39664
FT                   /locus_tag="ELI_00125"
FT   CDS_pept        38843..39664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00125"
FT                   /product="hypothetical protein"
FT                   /note="COG0001 Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62117"
FT                   /db_xref="InterPro:IPR008325"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX4"
FT                   /protein_id="ABC62117.1"
FT                   /translation="MTGISRSLRSAFAGLAACAALAASPLSAQGVETIDPDSAAIDGDL
FT                   AEQPGDQPVYGEPNTPDAEPTLDITPEPAAGAPVAPSWSDPGEVESWSSETVGARQQVP
FT                   PEAAATQASTTYGEDDLIGAANSVFGDGAEGVAKMIQKLLADQGEPNAYIVGREAGGAF
FT                   IVGARYGSGKLFHKVEGERPVYWTGPSIGFDAGANAGNTFVLVYNLYDSEELYERYPAG
FT                   EGQAYVLGGLHASYMRKGDVVLIPIRVGAGLRLGVNAGYMKFSKKQRWLPF"
FT   gene            39756..40934
FT                   /locus_tag="ELI_00130"
FT   CDS_pept        39756..40934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00130"
FT                   /product="tyrosine aminotransferase protein"
FT                   /note="COG1448 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62118"
FT                   /db_xref="GOA:Q2NDX3"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX3"
FT                   /protein_id="ABC62118.1"
FT                   /translation="MLEALEPQAPDALLALIKLFASDDRDEKIDLGVGVYRTDDGATPV
FT                   FKAIKQAEQKLVDIQESKGYLGPEGDIGFVHALMPRIFGKNATMNGHIEGMQTPGGTGA
FT                   CRLAFALAQKAGVGRVLMGVPSWPNHAQILADVGLEVMTFEHAKPDGTANLDALLGALR
FT                   TAGEGDAVLLHGCCHNPTGVDYSAEDWAAIAEALADSPVLPVIDTAYHGLGQGLDEDVA
FT                   GLRTVLAAVPEALVAYSCDKNFGLYRDRVGAFYVKAKSSEQMDAILSNANALARANWSM
FT                   PPDHGGAAVRLVLRSEDMTKVWLDELESMRKRLRWVRDRLAQADNEVPGLDLAPLGRQN
FT                   GMFAMLPLDKDQIQKLRDDHAVYMAGSGRINVAGLTKGNMDKFIGALADVTG"
FT   gene            40921..41487
FT                   /locus_tag="ELI_00135"
FT   CDS_pept        40921..41487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00135"
FT                   /product="acetyltransferase, putative"
FT                   /note="COG1670 acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62119"
FT                   /db_xref="GOA:Q2NDX2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX2"
FT                   /protein_id="ABC62119.1"
FT                   /translation="MSPADLDRQPILEGEALRLRPLGLEDFDALFAVAADPLIWEQHPA
FT                   HDRWQEPVFRVFFADALAHGGALAVIDKRSGAVIGSSRYQGLEPEVGGSIEIGWTFLAR
FT                   EYWGGKANLELKRLMVRHALASVAECRFAVGEENWRSRKAMEKIGGRLSDRVEDRKMAG
FT                   TSARHVHYVIGRSEFAGGPLGATAQ"
FT   gene            41549..41713
FT                   /locus_tag="ELI_00140"
FT   CDS_pept        41549..41713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62120"
FT                   /db_xref="GOA:Q2NDX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX1"
FT                   /protein_id="ABC62120.1"
FT                   /translation="MFRPLFRDQSGSPATEFALVASIISIAALGAFMALGEQSSNQMTK
FT                   VETAYAEVN"
FT   gene            complement(41729..42349)
FT                   /locus_tag="ELI_00145"
FT   CDS_pept        complement(41729..42349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00145"
FT                   /product="riboflavin synthase alpha chain"
FT                   /note="COG0307 Riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62121"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDX0"
FT                   /protein_id="ABC62121.1"
FT                   /translation="MFTGIVTAIGTIESAEQLSDLRVRVRCPYDPADIAIGASIACSGA
FT                   CMTVVDRGGREGDAWFAVDVSGESVSKTASDMWQVGGALNLETALKLGDELGGHIVTGH
FT                   VDAVGTVESAVEVGGSHTVKIRAPKDLAPYIAPKGSITVDGVSLTVNEVTDHDDGSCTF
FT                   SLNIIPHTWEVTTLGRIEAGSEVNLEIDVLARYLRRMESLRAA"
FT   gene            complement(42359..43336)
FT                   /locus_tag="ELI_00150"
FT   CDS_pept        complement(42359..43336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00150"
FT                   /product="riboflavin-specific deaminase/reductase"
FT                   /note="COG0117 Pyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62122"
FT                   /db_xref="GOA:Q2NDW9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW9"
FT                   /protein_id="ABC62122.1"
FT                   /translation="MIGPRGDQDWLAAAARLASRGRPVSAPNPAVGCIIVKQDRVIGRG
FT                   WTRVGGRPHAEAAALEQAGQDARGATIYVTLEPCAHESDRGPSCADLLVAARPQRVVLA
FT                   EVDPDRRTHGAGIARLRRSGITVETLPSPAAAASLAGFLTRERLGRPHVTLKLALSLDG
FT                   CIALASGESQWITGEEARAHCHSRRAMSDAILVGGGTWRADKPRLDVRLPGLEDRSPQR
FT                   VVLTRGVPIDGVRIINEPAQIDRLEAAQYLYVEGGAGAAASFLAENLVDRLDIYRAPIV
FT                   IGGGKPAFGNIGLADLTSAHGSWKLVERRQLGSDCYEAYERQRS"
FT   gene            complement(43336..43785)
FT                   /locus_tag="ELI_00155"
FT   CDS_pept        complement(43336..43785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW8"
FT                   /protein_id="ABC62123.1"
FT                   /translation="MGRLSRFNPAPGVKDFWTEFRRPQPYRIPILLASIAIPGAMLYMF
FT                   ASQETMVPPRSPDVTYITSFAPDRTDDEIIESNIENQLRKDERRERLEEIEARRRALYR
FT                   ELGRASGLDVDAMEAEAEAERIREEAEAEIERRERLDAAGLEEIE"
FT   gene            complement(43844..44566)
FT                   /locus_tag="ELI_00160"
FT   CDS_pept        complement(43844..44566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00160"
FT                   /product="hypothetical protein"
FT                   /note="COG1451 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62124"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW7"
FT                   /protein_id="ABC62124.1"
FT                   /translation="MIEWLRRDPADLSITLGGTNLPLDIRRHPTAKRMVLRLADDGASV
FT                   RVTLPRWGRTDEAIAFAESRAEWLAAQLAKRPAATAIEPGAVLPFHGRDLRIEWDSGRP
FT                   RKPVVDGDRIHVCGPKETLQSRLKRWLQSQAREAFATDLQYYSQVAQLPTPDYSISSAR
FT                   RRWGSCSSSGTVRINWRLIMAPDNVRRSVVAHETAHRVHFDHSPAFYSLLSELYEGDLA
FT                   LADGWLKQHGRTLYAFFG"
FT   gene            complement(44563..45006)
FT                   /locus_tag="ELI_00165"
FT   CDS_pept        complement(44563..45006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00165"
FT                   /product="hypothetical protein"
FT                   /note="COG2983 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62125"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW6"
FT                   /protein_id="ABC62125.1"
FT                   /translation="MGALRDRFWELPLADLSEPEWEALCDGCGRCCLHKIEDADSGEIE
FT                   DTNVACKLLDTETARCTDYRNRKTFVPDCLRLTLKIVEDVAWLPESCAYRRRADGRGLP
FT                   LWHYLLSGDPEAVHRKGAGVAGRVVSENRAGPLEHHIVDWQES"
FT   gene            complement(44994..45587)
FT                   /locus_tag="ELI_00170"
FT   CDS_pept        complement(44994..45587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00170"
FT                   /product="Electron transport protein"
FT                   /note="COG1999 Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62126"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW5"
FT                   /protein_id="ABC62126.1"
FT                   /translation="MLRLPSCAAIALALTLAACNGEQAPPPEAPLAGSTIGGDFELTSE
FT                   SGDTVNWSDFDGQYRIVYFGYAYCPDICPTDVQRAMAGLRQFEQDNPALGAQIQPLFVS
FT                   IDPERDTQEVVAEFTDAFHPRLIGLTGTPEQIEQAASAFKVFYARGEDQPGGGYLMDHS
FT                   NITYLFGPDGEPIATLPTDQGADAVATELALWVR"
FT   gene            45760..46293
FT                   /locus_tag="ELI_00175"
FT   CDS_pept        45760..46293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00175"
FT                   /product="hypothetical protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62127"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW4"
FT                   /protein_id="ABC62127.1"
FT                   /translation="MFSDSYNFLEAVRDRDGNQVTQIIETPGSTLINTRDLATGDTALH
FT                   IVAERRDTVWIRFLTQKGANPNIANKAGVTPLMISASLGNTEGVEALIKAGARHDEGNN
FT                   LGETPLITATHQRNIEMVKLLLSKGADPDRNDNSGRSARDYAEAIGSKRLTMEFEAADA
FT                   ARDGKEQTDYGPRF"
FT   gene            46298..46960
FT                   /locus_tag="ELI_00180"
FT   CDS_pept        46298..46960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00180"
FT                   /product="hypothetical protein"
FT                   /note="COG5590 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62128"
FT                   /db_xref="GOA:Q2NDW3"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW3"
FT                   /protein_id="ABC62128.1"
FT                   /translation="MIDNVQDMTLAELRLALAPAIADSAIFDGWGDDALEMAAEMEGVD
FT                   VDVARLAFKGGQMAMIRAWIENVDARMTSEWPQEKLAELKIRERIRSLVRFRLDAVAGQ
FT                   EEAVRSALAIMSMPQNAGEGIKIGWRTADIMWRLAGDTATDYNHYTKRTILAGIYGATL
FT                   TFFINDDSEDKVETKAFLDRRIDGVMKFEKLKAKFLNSDRETFSVTRFLGRLRYPAR"
FT   gene            47020..47259
FT                   /locus_tag="ELI_00185"
FT   CDS_pept        47020..47259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00185"
FT                   /product="Fe2+ transport system protein A"
FT                   /note="COG1918 Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62129"
FT                   /db_xref="GOA:Q2NDW2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW2"
FT                   /protein_id="ABC62129.1"
FT                   /translation="MTLEGLAPGCCATITSIDWDSIAADDGKRLRALGFDAGVEVSVKH
FT                   RGVFGGRDPLAVTLGRMTIALRRVHAAAVSVSEG"
FT   gene            47273..49111
FT                   /locus_tag="ELI_00190"
FT   CDS_pept        47273..49111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00190"
FT                   /product="Fe2+ transport system protein B"
FT                   /note="COG0370 Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62130"
FT                   /db_xref="GOA:Q2NDW1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW1"
FT                   /protein_id="ABC62130.1"
FT                   /translation="MSTIRTVALVGNPNAGKSALFNKLTGARQKIANYPGVTVERKAGR
FT                   MVLASGEPVELLDLPGSYAFDAASPDEEVTRKVVFGEQEGQRQPDVLVVVLDAANLEQH
FT                   LVFAQEVIELGRPTVVALNMVDLAERDGLTLDPDALGKALGVPVVPTVAVRSRGLDDLV
FT                   AAVSDLPLGDPSPRPHIDLTERRLEAKNITKAAILSKSSRATLESSLDKVLLNPWIGPV
FT                   ILFGLLFVVFQAVFAWADPFIGLIEGATEWLAGLVVATMPEGFVRDLITEGLIAGVGSV
FT                   VVFLPQIVILFAFILVMEATGYMARAAFLMDRLMAGVGLSGRSFIPLLSSFACAIPGIM
FT                   ATRSIADPKDRLTTILIAPLMTCSARLPVYAVIIAAVMPATTVGPGIGLQGLVLFALYV
FT                   AGIVGALLVALVLRRTVTAGAASGFIMELPRYQLPRIRDLLIGLWQRAWVFLRRAGTII
FT                   FAATVILWLLLTFPKADPGENQLDASFAGQIASVMQPVFEPIGFNREMTLSIVPAMAAR
FT                   EVAVASLATTYAVEAEDEEETESALRDQIAARWSLPTALAFLAWFVFAPQCLSTIAVAR
FT                   RETNGWKWPIVMLGYLFALAYIFAGITYWSALALGL"
FT   gene            49127..49657
FT                   /locus_tag="ELI_00195"
FT   CDS_pept        49127..49657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00195"
FT                   /product="single-strand binding protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62131"
FT                   /db_xref="GOA:Q2NDW0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDW0"
FT                   /protein_id="ABC62131.1"
FT                   /translation="MAGSLNKVMLIGNLGQDPEVRSFQNGGKVCNLRIATSETWKDRNS
FT                   GERQERTEWHTVAIFSEGLVNVAERYLKKGSKVYIEGQLQTRKWQDQSGNDRYSTEVVL
FT                   RGYNGTLTMLDGAGGGQGGGGGGGYGGGGQRSGGNNGGWDQGGGGQSGGQSGGGSGGGG
FT                   GSNYDDLDDDIPF"
FT   gene            complement(49684..50208)
FT                   /locus_tag="ELI_00200"
FT   CDS_pept        complement(49684..50208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62132"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV9"
FT                   /protein_id="ABC62132.1"
FT                   /translation="MSAHELSRLVKLRAIKHEPVVVEADEAERAALAARFGITTIDSLR
FT                   AEVALDPDGQRVAATGMLAASITQPCAISGEDFPVAIDEELDFVFVPASESEVAVEGEE
FT                   IELEREDLDEIEYRGDSFDLGEAIAQSLALAIDPYAEGPNADAARERAGIVTEDTPSGP
FT                   LAEALAALKKN"
FT   gene            complement(50205..50723)
FT                   /locus_tag="ELI_00205"
FT   CDS_pept        complement(50205..50723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62133"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV8"
FT                   /protein_id="ABC62133.1"
FT                   /translation="MSLLSKLFQRTPDPKEQLRPLWHQIVKVARSPDLYAECGVADTLE
FT                   GRFDMLSTILAVVMLRVERDPETLSASARLTELFVDDMDGQLREAGIGDPTVGKKLGQL
FT                   MSALGGRTGALREGLAQADDAALVAAIERNVTFSEGGSPACVAKKVRRFAAALDALTYD
FT                   QLLHADLML"
FT   gene            50980..51408
FT                   /locus_tag="ELI_00210"
FT   CDS_pept        50980..51408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00210"
FT                   /product="tmRNA-binding small protein A"
FT                   /note="COG2913 Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62134"
FT                   /db_xref="GOA:Q2NDV7"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV7"
FT                   /protein_id="ABC62134.1"
FT                   /translation="MGLALSSCGTIRESRGYVVDQLLLDRVQPGIDNRQSVAATLGRPT
FT                   FESQFGEPTWYYVSSVTGRRPFVRPRIRTHQVLAVRFDQAGNVIATDISGIEQVAYITP
FT                   DGDKTPTLGRERGFLEDLFGNIGTVGAPGAGAPGGPGR"
FT   gene            51465..52022
FT                   /locus_tag="ELI_00215"
FT   CDS_pept        51465..52022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00215"
FT                   /product="ATP-dependent protease HslVU peptidase subunit"
FT                   /note="COG5405 ATP-dependent protease HslVU (ClpYQ),
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62135"
FT                   /db_xref="GOA:Q2NDV6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV6"
FT                   /protein_id="ABC62135.1"
FT                   /translation="MDTSLNAHGLTQWHGTTIIGVKRGDKIVVAGDGQVSMGNTVMKPN
FT                   AKKVRRIGEGKVVAGFAGATADAFTLFERLERKLDQYSGQLMRAAVELAKDWRTDKYLR
FT                   NLEALMIVADKETLLVLTGNGDVLEPEGGIAAIGSGGNYALAAARALSDYEDDAEQIAR
FT                   KAMAVAAEICVFTNGSVTLETV"
FT   gene            52117..53418
FT                   /locus_tag="ELI_00220"
FT   CDS_pept        52117..53418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00220"
FT                   /product="ATP-dependent protease HslVU ATPase subunit"
FT                   /note="COG1220 ATP-dependent protease HslVU (ClpYQ), ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62136"
FT                   /db_xref="GOA:Q2NDV5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV5"
FT                   /protein_id="ABC62136.1"
FT                   /translation="MTEALTPKAIVAALDEHIIGQKDAKRAVAVALRNRWRRLQLGAEL
FT                   RDEVTPKNILMIGPTGCGKTEISRRLAKLAEAPFIKVEATKFTEVGYVGRDVEQIARDL
FT                   VEEAIRLEKDRRREAVREAASTAAMERLLDALVGDNASEATRESFRERVVQNAMNDVEV
FT                   EVEVSDSPSMPMEIPGLGGNVGMIDLSDMMGKALGRNNKKRRKLKVPDAWDKLVEEEAE
FT                   KRMDQDDVSRVALENAETNGIVFLDEIDKIAVSDVRGGSVSREGVQRDLLPLIEGTTVS
FT                   TKHGPMKTDHVLFIASGAFHVSKPSDMLPELQGRLPIRVELRALEIEDFVRILSETRAN
FT                   LVEQYKALLGTEDVTVEITDDAIREVATIAAQVNESVENIGARRLQTVMERLLEELSFE
FT                   AEEHKGETIVIDAAYVKDKLSELAEDSDLSKYIL"
FT   gene            53415..53825
FT                   /locus_tag="ELI_00225"
FT   CDS_pept        53415..53825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00225"
FT                   /product="hypothetical protein"
FT                   /note="COG3602 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62137"
FT                   /db_xref="InterPro:IPR018717"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV4"
FT                   /protein_id="ABC62137.1"
FT                   /translation="MTRPVAETAATIAGMDPVLDEPLWCFVGGYEPELVIQWMSHALGT
FT                   FREAEGLSLIVPHAVALEHELQADPYARITLRVHSALEGVGLTAAVASALAKAGIACNM
FT                   VAALRHDHAFVPADRAEEALAILKQLQATATL"
FT   gene            complement(53822..55423)
FT                   /locus_tag="ELI_00230"
FT   CDS_pept        complement(53822..55423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00230"
FT                   /product="putative sulfate permease protein"
FT                   /note="COG0659 Sulfate permease and related transporters
FT                   (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62138"
FT                   /db_xref="GOA:Q2NDV3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV3"
FT                   /protein_id="ABC62138.1"
FT                   /translation="MRRVVLHCNIAYLRPLILPVPLASDFPHRTAHRTGFMYSPAAFKR
FT                   DWLSNVRADLLAGIVVSLALIPEAIGFSIIAGVDPRVGLYASIAIAMIIAFTGGRPGMI
FT                   SAATAAVAVVVIPLVRDYGVEYLFAATILMGIFQGIAAVLRLDLLMQFVGRAVITGFVN
FT                   ALAILIFMAQLPELTNVGWETYAMVAVALAIIYLLPRVTTAVPSPLVAIVLLTLLTIWI
FT                   DAPVNTVSDMGELPEGLPYFVWPDVPLTWETLQIIAPYSATMAAVGLIESLLTARIVDD
FT                   MTHTGSNKRRETWGQGVANIGAALVGGMGGCAMIGQSVINVTSGGRGRLSALTAGVTLL
FT                   LLLWLLGPIVGQIPMPALVAVMIMVSIGTFSWTSIPNLRHHPWQASVVMLATVAVVVTT
FT                   HNLALGVLVGVLLSGIFFAAMVMNLFEVTRTREGNTATYTARGQIFFASVERFEAALGP
FT                   ESKQPDPADHVIIDVSDAHFWDISGVGALDKVVERMRANGRSVQVVGLNEASADMVDRH
FT                   AVTDRTGVELGLAPHP"
FT   gene            55558..58404
FT                   /locus_tag="ELI_00235"
FT   CDS_pept        55558..58404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00235"
FT                   /product="peptidase, M16 family protein"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62139"
FT                   /db_xref="GOA:Q2NDV2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV2"
FT                   /protein_id="ABC62139.1"
FT                   /translation="MKSSALAAGAALLALATAQPALADDHTADTPVLSAPEIEFTEWTL
FT                   DNGLRVIALPDDSTRTVYTSVWYDVGSKHDPDGRSGFAHMFEHILSRKTQNMPYNLIYS
FT                   LTADVGGTRNASTGYDRTNYYEIVPAEYLETMLWTHKERMALPVVDEQVFESERGVVKE
FT                   EFRTRVASQPYGPLISLALPENAFDTLPQRRPIIGSIEDLDSAELGDALAFHEAYYGPD
FT                   TATLIVAGNFAIEQLRALVDKYFADIPRRANPLPLDIAPSTVERTEPRSFAMTNPNVPL
FT                   PVVGSLWKLPAANHPDIPALLLLDGILGTGASSRLQEKLVRSGIAVDKAQIMRPSEEGG
FT                   YFATLAFVSPAGDTAVAKQAIDNTLADIRENGVSEAELSEARNEFFAARLNSRQTARGR
FT                   ASELGEALFTSGGDPRAADILLQAITQVTLDDIRRVAAEYLDPSARTDLSYAAGEANPE
FT                   AWRNPVPMPEYVTLPPSGSTPLSVLDESRREPVPGPSAAPAVADPELVQRTLDNGIKLV
FT                   AAQTGDVPIVTITAVMPGGAITDSRELAGVSSLAASLADQGTSRLDAAGLAAALESLGA
FT                   NLSVSPGDEGTLVSVNAPAATIDKAGALLVEVLRDASYPQDQFDIQKARLLDNVKSLRS
FT                   NPSALPSVVSAPILFGDAPYGIGANEATIAAITPADLIAYREKWWRPDTMQLVISGGIP
FT                   AERQVALAQDLFGGWTADGDAPELPGERAGEARPPRTIVVNLPDAGQATVLAAVRAPSR
FT                   AADDYFDLSIANAILGGGSSGRLFEEIRTKRSLSYGAYSGQPSRVDEGYLTASSQTANE
FT                   TVGDVVEVMLGEFDRLSSEDFDPEFIEARRRYLVGSSERRLETSAGFNGAIAGLLQNGL
FT                   DPAEALRYAANLGEVTPERARAAADAYISSEDATLIIAGDASIFLDDLKAIRPDVTVIE
FT                   AADVDFADPLGEIAVAGE"
FT   gene            complement(58405..60222)
FT                   /locus_tag="ELI_00240"
FT   CDS_pept        complement(58405..60222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00240"
FT                   /product="ABC-type transport system ATPase component"
FT                   /note="COG5265 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease and ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62140"
FT                   /db_xref="GOA:Q2NDV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV1"
FT                   /protein_id="ABC62140.1"
FT                   /translation="MPPDYPTKSKADFDGWGTLRRFLPYLWPAGRRDLKARIVGALIMV
FT                   LAAKAIILAMPLAMKGAIDTMAADGDPLTMVALGFVIAYVGARILSLVFDQVRNIVFER
FT                   VGQIATQDLAEDVFARLHQLSLRFHLSRRTGEVTKTIERGTKSIDSMLYFILFNIAPTL
FT                   VELTAVAVIFYALFGWELVVATGVTVVLYIAVTRWITEWRVKLRAEMNDLDGRALSRAV
FT                   DSLLNFETVKYFGAEKREEDRYASAARAYAEAAIKSENSLGLLNITQALITNGLMALAM
FT                   GFVVWRWSQGALTVGDLTAVNLYLMQLFRPLDMLGWVYRTIRQGLVDMAEMFRLMDTQV
FT                   EVIDVPGAPALVADPPTVAFDNVVFGYDPERTILHGLSFEVPAGSRVAIVGPSGAGKST
FT                   IGRLLFRFYDPQAGRILIAGQDIAKVQQQSLREAIGIVPQDSVLFNDTLRYNIAYGREG
FT                   ASEGEILRAADDAAILPFIEKLPDGLETEVGERGLKLSGGEKQRVAIARTLLKGPPILL
FT                   FDEATSALDSGTEQDILGTLQRVSRNHTTLAIAHRLSTISDADTILVLDDGHLEEQGRH
FT                   ADLLRRGGLYAEMWARQQAESEPTAEAAE"
FT   gene            complement(60296..61267)
FT                   /locus_tag="ELI_00245"
FT   CDS_pept        complement(60296..61267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62141"
FT                   /db_xref="GOA:Q2NDV0"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDV0"
FT                   /protein_id="ABC62141.1"
FT                   /translation="MLKRSLAGASTLLAAALAPASAVGNTPEAATAPTEAIDPDVIQAE
FT                   KDRYERLTVPVTIEGQGPYRFMIDTGAQATVVSKKVSHEIGMTPLGRATLVAMGSRREV
FT                   DMVRLNGLEFAGRLFDNLESPLLEGANFGADGILGLDSLQDLRVLIDFKEDRMTVADAD
FT                   SLGGNRGYEIVVKARRRLGQMIITNARIDGIKTSVIIDTGAQNTVANRALQRKMRARLG
FT                   TEVQSTDVNGVLVVGKLGWAKRLQIGGMELSNVPISFADSPAFAALGLEDQPTVIMGMR
FT                   NLQNFERIAIDFSSRRVLFDLPGGSYNVNPYQRVFFPSRVGG"
FT   gene            complement(61370..62833)
FT                   /locus_tag="ELI_00250"
FT   CDS_pept        complement(61370..62833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00250"
FT                   /product="capsular polysaccharide repeat unit transporter"
FT                   /note="COG2244 Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62142"
FT                   /db_xref="GOA:Q2NDU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU9"
FT                   /protein_id="ABC62142.1"
FT                   /translation="MAWRWGSQIVAQVIAWSSTIMVVRLLTPTDYGLFAMTQVVLTALA
FT                   FLSGHGFASSLIQTDDVSRRRIGQVFGLLLLFNGSLAVIQFLSAPMMASYYDEPLVADM
FT                   LRIQAVMFLTIPFTALPSELLAKRLEFRIQGKISMLAATLAAIVALVMAWWGYGVWALV
FT                   YAPISGFVFRAIALTIAARSLVPPVFDLRGARDILHFGGALTVCQMFWIIQSQSDIFIA
FT                   GRVFDTHDLGLYAEALFLTLIVTGRFLPPINDVAFPAYAELHRTGKSLAPYFLKTLRTV
FT                   LLVTAPIYFGLALTAEPAVLTLFGEKWVAMAPIAAGLALAMPAMAIQIVCSPVTNAMGE
FT                   PGVYVRTNAFGAIIFPLSFLVGVASGPFGLVYAWWICAPLLMFWTLLLTLPRIGLTWRK
FT                   LFGELSPIMLANGTMVLAVLALDAFLPDPAPFIELLAKALCGAAVYGLAIRIFWPHLIA
FT                   ETWAMLRQGEPSPAVTTHTDRNSAGHAPA"
FT   gene            63530..65023
FT                   /locus_tag="ELI_r15155"
FT   rRNA            63530..65023
FT                   /locus_tag="ELI_r15155"
FT                   /product="16S ribosomal RNA"
FT   gene            65223..65296
FT                   /locus_tag="ELI_t15067"
FT   tRNA            65223..65296
FT                   /locus_tag="ELI_t15067"
FT                   /product="tRNA-Ile"
FT   gene            65316..65388
FT                   /locus_tag="ELI_t15069"
FT   tRNA            65316..65388
FT                   /locus_tag="ELI_t15069"
FT                   /product="tRNA-Ala"
FT   gene            68935..69008
FT                   /locus_tag="ELI_t15071"
FT   tRNA            68935..69008
FT                   /locus_tag="ELI_t15071"
FT                   /product="tRNA-Met"
FT   gene            69186..71222
FT                   /locus_tag="ELI_00255"
FT   CDS_pept        69186..71222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00255"
FT                   /product="serine protease, trypsin family protein"
FT                   /note="COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62143"
FT                   /db_xref="GOA:Q2NDU8"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU8"
FT                   /protein_id="ABC62143.1"
FT                   /translation="MMVTARWAVFATGLLLAWPFLASAQVVEGSADVDNSAMTEPGPPE
FT                   PEDAEPVNEAQAPDSFDSSFPHNGFITTLVRISPDIVERRAEIVAAIEAQPGWAIGDED
FT                   DAEFEVVPNPEYYQDLLFARIKRREFDRSHSRLPSEAMDIADIMVFHNPETGVSWNDLR
FT                   GKGNFPDPARPKVPHWGLDVPVPVDLGPADGADLISRLQAAMAPVARHHALLGLVNDQG
FT                   GFLKLCVSNDPAPEGYCPVQERGDRPMLLYFKPFYIRAVGEDSLPGSEMTFLAVAPDRA
FT                   IVHLATVPIARVREIGPGGEELSAFTVGDNYEAPARMEEFGDYQVIAIASPDILDPRIW
FT                   QIRPGDPLPQDLCTTEIQLRVCETMRGNYRIVGDRPLTTGLVEFKVFTDAWNAVAPVGG
FT                   GQATREEGLWQAQLFAPRAGSPTGFSGVLSPGGGRRLNFEKSHKCGGSYIGDGYILTAA
FT                   HCVDKVGLRDYQVRLGTLDIRVGGSNFPIESMVIHSRYRQRRDKADIALLRIKTDRRLD
FT                   RLLGKGLVAPAPLAPMGRRLPQNSAVDMTGWGFTSAATPGGDSLVDAEGNTQRNAAKLM
FT                   KVPLKTSATSTCTRHRQLSVYASADIVCTLPAREGTGACFSDSGGPLTRRVGGRRQLVG
FT                   IVSAGIGCAQPGMPTAYTRIANFRSWIERAKVAARVPGKHRIP"
FT   gene            71238..72476
FT                   /locus_tag="ELI_00260"
FT   CDS_pept        71238..72476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00260"
FT                   /product="putative sphingosine-1-phosphate lyase"
FT                   /note="COG0076 Glutamate decarboxylase and related
FT                   PLP-dependent proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62144"
FT                   /db_xref="GOA:Q2NDU7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU7"
FT                   /protein_id="ABC62144.1"
FT                   /translation="MTMPKRGRDWAEVRAEMIDRGAGDAKWRDGKTAVYVFNAGPDIAE
FT                   VQHEAYALYMSENGLGPLAFPSLAQMEREVIEMALSLLRGPEGAAGAMTSGGTDSITMA
FT                   VKAARDFARAEKGLSGPANIVLPKSAHPAFDKAAHLMDIEVRRVPLKDDGSYEADPAAM
FT                   DAACDAATIMMVGSAPNFPHGIVDPIMTLGEVAQARDIWLHTDACVGGYFAPFARMNGV
FT                   DVPPFDFEVPAVRSMSADLHKYGYAAKGASTVLFRSEEYYNHMPFENRDWSGAPMKTPT
FT                   LAGTRPGGAISAAWAVMQVLGVEGYREKQGLVCATRERVEAGVRELGFEVLGNPLLGLI
FT                   AFRHPEHDNYAIYSEMYRKGWFTSLTIEPPALHLMLSPKHAEVIDDYLVDLAAGLETVA
FT                   AGKEGPQVEARYN"
FT   gene            complement(72551..72802)
FT                   /locus_tag="ELI_00265"
FT   CDS_pept        complement(72551..72802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62145"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU6"
FT                   /protein_id="ABC62145.1"
FT                   /translation="MTMKTLVKFAAPAAAALLLAACAEPAAEEEAMEDTAADQTAMEEP
FT                   TDVGAMEEGTMEGEAEGAMEAEEATAEADEFTGPREEQ"
FT   gene            complement(72825..74789)
FT                   /locus_tag="ELI_00270"
FT   CDS_pept        complement(72825..74789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00270"
FT                   /product="putative adenylate cyclase protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62146"
FT                   /db_xref="GOA:Q2NDU5"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU5"
FT                   /protein_id="ABC62146.1"
FT                   /translation="MEPTDDKSGESIPAQEAPWAFVSYSREDRPAALKVIEALKAAGIA
FT                   VWWDGLLEGGARYNEITEDRLENAYAVIVLWSHASTKSHWVHDEAMRGRDRHCLVPASI
FT                   DGSEPPLGFRQFQCVTLASKPGPLDPAGLADLVQTVQRMHPDSREGTAAHFVSHPAPSP
FT                   DTGRFSVDRRLAIGGGIAALAGVGGLAAWQFGVFGGTRSNSIAVLPFETIGGGEDQTWF
FT                   ADGLAAEIRARLAQNPLLKVAAKASSNTFRETEADAKEIASKLKVAFLLNGDVRREGDQ
FT                   LRVTAALTDGSTGFTERQLSFDRAIDGVFEIQSAIAAAVIAELTAQIEGRNTGEQIGGT
FT                   DNVAAYEAFLRGNELFDAGTDQNTDRQALAKFEEAVAIDPGYAAAHAGKSRAISVIGNL
FT                   YTAPENRAEVYGSAAEAAREAVRLAPEFADGHSALGFAFANRLDMQAARDPYERSYQLG
FT                   AGDAEILSRYAKFRSRIGDADGASAAIERAVGLDPLNARVFVFYGNIAYAAGRYAEAID
FT                   HFDEARALQPQLSSYHYSKGLAQLELGDFEAARDSFAADPFFVWQKTGGAIVEHKLGNT
FT                   AAAKAHYQALKAEYGDESSYQYVQILSQWGDIEGALAALGEAERLRDSGLVWLYYDPLL
FT                   APIRETDEYRALIKRFGFV"
FT   gene            74986..76926
FT                   /locus_tag="ELI_00275"
FT   CDS_pept        74986..76926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00275"
FT                   /product="hypothetical protein"
FT                   /note="COG3872 Predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62147"
FT                   /db_xref="GOA:Q2NDU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU4"
FT                   /protein_id="ABC62147.1"
FT                   /translation="MVVGVTGHRSSHPSFPENSARLRAVIEDIFAKIDAALQAGGTGCT
FT                   CTTALVTLLADGADHLAANAALERSWKLVTPLPFGRKLNAAINSGVATAADAKALLAGE
FT                   PVADQTVADRAKNIELLADQACLFEMADEDEAICKLLLAALDHPDDRSALEKFQLAAAR
FT                   RAALAGTVLVEQSDLVIAIWDGQSVDSVGGTGHTVSAALETGCPVVWIDPGNPEQWQVF
FT                   RSAEGLATGHARHKDSPAELTKCVRQAVDIDLAKSRESHAGLEAISPICWHGTSSFWSH
FT                   AYRRIEAFFGTSRWRDKVGWIAMRYELPSEIGEGSQKAMLTGLATLPGADGDLPARVER
FT                   EVLRRFAWTDAISSRLADRYRSSMVWNFILGAMAIIVGIFYLPLVDVAQKWIFALAEFI
FT                   LLVVIIGNTALATKRRVHGRWFETRRAAEYLRHSPFLLALGIARPPGHWPQGVRTSWPE
FT                   WYARHALRAVGLPEVRVDSSYLRGVLEFLRDHHVDPQRDYHLDKAARLNRVRHKLDRIS
FT                   EISFILAVITVASYLLLAFFAGRGMVDPGWLDKAAKWFTVAAVALPTLGGAIAAIRYFA
FT                   DFERFADISDVTARRLGHVSQRIATLLNAPEERLDLGRVARVVHDTDDIVFSEIQAWQA
FT                   VFSGKRTTIPA"
FT   gene            76881..77390
FT                   /locus_tag="ELI_00280"
FT   CDS_pept        76881..77390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00280"
FT                   /product="hypothetical protein"
FT                   /note="COG1226 Kef-type K+ transport systems, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62148"
FT                   /db_xref="GOA:Q2NDU3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU3"
FT                   /protein_id="ABC62148.1"
FT                   /translation="MAGGLQRQKDDDTGMIEALGISFVLIALTIAIHYEALRATSNWIV
FT                   DLPIYPRARMIVVLAVAMVSHLVQVVLYAFAYLWMDAQGTMGDVGGVENPAFADMFYFS
FT                   ITSYTTLGIGDLFPHGHIRLVSGIEALNGLVLVGWTASFTYLKMERYWRVPEEVARDDF
FT                   GTTKND"
FT   gene            complement(77403..78968)
FT                   /locus_tag="ELI_00285"
FT   CDS_pept        complement(77403..78968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62149"
FT                   /db_xref="GOA:Q2NDU2"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR040771"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU2"
FT                   /protein_id="ABC62149.1"
FT                   /translation="MTIRGESRAMPTNPEHVPVIIGVGQINDRPADPREGLDPVGLMAE
FT                   ALRRADADGGGGWLEDCQSLGIVGQIAWPQINPVAGKVAEALGIDPAHVEETTPHGDNP
FT                   IRLLNEAANRIGAGEAVICAVTGGEALRTAGALAKMKAAEEAANSPEKAKPKEHDALRD
FT                   ASHRRKLGYAQSYGLVVPVDVYPLYENAFRAAQGQTLTEGQAESGAIWAGFSQVAARTE
FT                   AAWIREPRQAEEIIEPTADNRPIAFPYTKLQVANSAVNQGAGFIVTSLAEARRRGVSED
FT                   RLVFVGAGASAFEPDSILARDSYTASAGMETSIRKAMELNAVPADDLDHVELYSCFPCV
FT                   PKMARRTLGWPLEKPMTVFGGLTFGGGPIGNYMSHAVACMVEKLRGGGTGLLFANGGYA
FT                   THSHTIVLSAQPIEGVGFPQDFDYNDAAEKARDDVPPLDKTYSGPATIETYTVHYKRDG
FT                   SPRVGTVVARTPDGARTLAVVPPEDAATIALLTDGKVEPVGQKGRIVRAGHGEWDGMGV
FT                   WNTA"
FT   gene            79066..80559
FT                   /locus_tag="ELI_00290"
FT   CDS_pept        79066..80559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00290"
FT                   /product="hypothetical protein"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62150"
FT                   /db_xref="GOA:Q2NDU1"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU1"
FT                   /protein_id="ABC62150.1"
FT                   /translation="MTDISATGLPPLPTRTRWLYGTGLMASGIKTTAFSTYLLLYFNQV
FT                   LGVPVDIVSQAIFLTLLIDAIADPLIGRWSDRTRSRLGRRHPFLFAAAVPAGLFFAATW
FT                   FPPDGLSDFGMGVWVFCLASLTRACMSLFEIPSSALGAELTDDYTERTRIFALRFWFGY
FT                   IGAFGFGAFCLAVFFAETPEYPRGQLNPEGYVGFAITGGILIALAVLTCAFGTRSRIPY
FT                   LRQVRERASKLSPMDHLREMGSAFAHRPFLAIFGYSLSKQVAIGMYVSSTIYFNTFIFG
FT                   LNAGQLAILTVEQLVAATCAVPLAPILARKMGKRNAAMAMGFGGICIGVMPLILTFFGL
FT                   FYPKGDPMLLPALFIVGAIYHTMIATSLMNSSGMIADTIEDFAVKSDRHNAGVFFSVNS
FT                   FTTQASAGLGILMSGIVLQAANFPEDADPLGVSQAISNSLIVWYVPLVVGLWAIGTFLL
FT                   LFYPITEASHRANVEKLAAREARLNAQTVRDSPEAGSPG"
FT   gene            80659..81870
FT                   /locus_tag="ELI_00295"
FT   CDS_pept        80659..81870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00295"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62151"
FT                   /db_xref="GOA:Q2NDU0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDU0"
FT                   /protein_id="ABC62151.1"
FT                   /translation="MATAADTRPEDDLDAFRAEVKDFLKASFPDSLKGKGNVMRTVEGP
FT                   GEETPEEKAWREAMGEKGWGTPTWPKEYNGGGLTKKQAKVLEQEMAMAGAWNPIGGMGV
FT                   MMFGPTLLEFGSHEQKLEHIPPITRGEVRWCQGYSEPNAGSDLASLQTSAEDKGDHYLV
FT                   NGQKTWTSGGQWADKCFCLVRTDRSDKHKGISFLLIDMDSPGVDVKPITMISGMSPFCE
FT                   TFFTDVKVPKENLVGEEGQGWTIGKRLLQHERTNISGGGALAALNAQPLSKIAEHYLGT
FT                   DEQGRLNDPEMRAKIAEFEMAWNTFLLTARRAMEESKAQGGVSEISSILKNVGSKLGQQ
FT                   RAELLIEIMGFRGLGWEGEGFTDKELQHVRGWLFGKATTIYGGSTEIQNNIIAKRILGM
FT                   LDHQ"
FT   gene            81900..82964
FT                   /locus_tag="ELI_00300"
FT   CDS_pept        81900..82964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00300"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62152"
FT                   /db_xref="GOA:Q2NDT9"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT9"
FT                   /protein_id="ABC62152.1"
FT                   /translation="MAVLNEEQTMLRDMAQEWTKNESPVAAWRKVRNEGKNFDPEAWDA
FT                   MAEMGWTGVIIPENFGGSDFGWMSLGLVVEETGKTLTASPLVASSLAASAIILGGSQAQ
FT                   KEKYLPRLASGELVGTLAFDDAARHTGATSSATVSDGKLSGTKPFVHEAESAGLFVVLA
FT                   SDGVYFVEKGDGVALSDRNLTDQRDHAEVTFDGAPAEKLADGGDDLAEQILDRARILTA
FT                   AEMLGMAQQVFDETLAYLKQRTQFNQVLSSFQALQHRMADLFTDLELMRTAVEAGLQAL
FT                   DTGFKVPEAACLAKSRANDVLHTMSRQGIQLHGGIGMTDEYDVGFYLKRARVLEASWGN
FT                   SGFLKDRHAKLAGY"
FT   gene            83125..84384
FT                   /locus_tag="ELI_00305"
FT   CDS_pept        83125..84384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00305"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62153"
FT                   /db_xref="GOA:Q2NDT8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT8"
FT                   /protein_id="ABC62153.1"
FT                   /translation="MQHDVWSRHHAFVESNLRRNYAATLIHGVFGMTGFRLIYAPTIIP
FT                   AYLYVQTGSAAAVGLGMALLQLGGTLSPVLSGARVESRNHILPYAITVGSLMRMMVLAM
FT                   ALTAWFLEGRALFAATLAIFLALGFFQGAQRVAFQMLMAKVIPIDRRGRLQGVRNLLGG
FT                   GIAAVLAWAAGVYFIEQQWLGNGYATTFLFAFILTTIGLLVLQFGIKEPSAPTIRQPVP
FT                   LRERWGQFAELLRHRTYRFFLLAHGFSSIARVGLPFWTLYVGERLGLDGYVIGALSLAY
FT                   LASETVSNVLWGQIGDRYGFRLVYLGALFCSLVGLTLLVAGEGAMLYAAFAALGFGMSG
FT                   WMMAALTLVLEFGAHEDIPMRIALTTTVEGAVSSTGPIIAGLAIAALGFMPLIVAAFLS
FT                   LGLALAVVFWRVSEPRSQLS"
FT   gene            complement(84372..86108)
FT                   /locus_tag="ELI_00310"
FT   CDS_pept        complement(84372..86108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00310"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62154"
FT                   /db_xref="GOA:Q2NDT7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT7"
FT                   /protein_id="ABC62154.1"
FT                   /translation="MSETNVLGWSKPDGWPAMSLQQVHDTLCAPGMPFEYETVDVRGIP
FT                   TRVWKNAPPSLRALAVHARSHGERLFTIYEDERVTYDAWYRAVAALATEFRKRGIAKGD
FT                   RVALAMRNLPEWPVVFFAATSIGAICVPLNAWWTGDELEFGLADSGAKLLVCDAERWER
FT                   IAPHREACPDLADVLVSRMGGDDLSVERLEDLIGTPHSWPTLPDAEMPEADIAPDDPAT
FT                   IFYTSGTTGRPKGALGSHRNLTTNILSSAYAAARTALRRGEVPPAGVQKVGLTVIPLFH
FT                   VTACSASMMGALFAGHTLIFLYRWDTVKAFEIIEREKVNLTGGVPTIAWQMIEHPDRDK
FT                   YDLSSLESIAYGGAPAAPELVRKIYEVFGAMPGNGWGMTETMATVTSHTAEDYLNRPES
FT                   CGPPVPVADLKITDEAGRELPVGEVGELWARGPMTVIEYWNRPEASAETFVDGWVRTGD
FT                   LARLDEEGFCYIVDRAKDMVIRGGENIYSSEVENVLYDHPAVTDAALIGLPHKQLGEEP
FT                   AAVVHLAPGMTASETELQSWVAERLARFKVPVRILFVQDTLPRNANGKILKKDLGALFQ
FT                   DS"
FT   gene            86199..87443
FT                   /locus_tag="ELI_00315"
FT   CDS_pept        86199..87443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00315"
FT                   /product="Beta-lactamase"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62155"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT6"
FT                   /protein_id="ABC62155.1"
FT                   /translation="MTAPFDCADPASLGFDESRLARIAAFLKDSYIDSGRLPMTQLVVA
FT                   RDGHPVYYDKQGRMGEEREDLRDDAIFRIASMTKPVTSIAFMQLVERCKVALEEPVTKV
FT                   LPEFKDLRVYAGGGGGTVPFMPGTPTHPMRFIDLITHMSGLTYGLQNRTNIDAVYREHN
FT                   LDFARSRHDSDEFIDILAKLPLEFAPGQGWNYSVATDALGVCVERISGMRLGDYFQQHI
FT                   FGPLGMVDTAFGVGDDARLVDAYQYVPGKPPHKIDAGPGSKLAQDGRFDSGGGGLCGTI
FT                   ADYHRFTKMLLNGGELDGARIVGPKTLRQMRTNHLPDGADLTEMSSSLFSESNNAGTGF
FT                   GLGFAMVIDPARTLMPSSLGEFYWGGAYSTAFFVDPVEGITCVFMTQVYPSSTYPIRRQ
FT                   LKTLIYSALTESRAA"
FT   gene            87456..89492
FT                   /locus_tag="ELI_00320"
FT   CDS_pept        87456..89492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00320"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62156"
FT                   /db_xref="GOA:Q2NDT5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT5"
FT                   /protein_id="ABC62156.1"
FT                   /translation="MTSPIRTERHDDVLVIISDNPPVNALGQAVRQGLKDGVEEAMGDD
FT                   AIKAVVIRCDGRTFFAGADITEFGKPPQGPNLPETLDAMEAGDKPVVAAIHGTALGGGC
FT                   EVALACHYRVAVPSAKLGLPEVKLGLIPGAAGTQRLPRVVGVEAALPMVVNGNPIPAAK
FT                   AEAIGLVDKIVGEDSLEADAIAFAREQIGKPVPRSSEGTAHEDGVKNPDLFDEFRARNA
FT                   RKIRGFDAPDAAVKAVKAATERPYAEGVKKERELFTGLMSGTQSAAMRHYFFAERAANK
FT                   IDNVDPKTPLIDIQKVGVIGAGTMGGGIAMNFLSAGIPVTILEMKQDALDRGTGVIAKN
FT                   YERTAKKGRMKPEQVEQAMGLLNPTLDYADLADCDLVIEAVYENMDVKKEVFAKLDETV
FT                   KQGAILASNTSYLNIDEIAQATKRPGYVLGLHFFSPANVMKLLEIVRGAETRDDVLLTS
FT                   MKLAKKIGKVAVVAGVCDGFIGNRMLSPRQKQANELIMEGAKYWEVDDVLLEFGFPMGP
FT                   FQMADLAGIDIGWHRDPSKVTTIREALCAAERFGQKNGKGFYDYDEARQRTPSEEVQAI
FT                   IADFARKEGTEQRDISKDEIRERLLYPMVNEGAMILDEGMAQRASDIDVVWINGYGWPL
FT                   YTGGPMFWADTVGLDTIVAGLEKHGLPVSEYLRRKAEAGERFN"
FT   gene            89732..91057
FT                   /locus_tag="ELI_00325"
FT   CDS_pept        89732..91057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00325"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62157"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT4"
FT                   /protein_id="ABC62157.1"
FT                   /translation="MKYSLRHSIAFGALASALAFMPSAASAQANPQQAGAGDSQVEDQG
FT                   RTIVVTGSLIRGTPEDAALPVDVYTSEDLAKQGVDSPLEFIKELPSVGAVLGDTNQFST
FT                   SAQGFQGVGSINLRGLGPQRTLVLVNGKRTILTPGAGFVDTQLIPLFALERVEILKDGA
FT                   GTTYGSDAIAGVANFITRSDFVGLELQGDYSLISGSDNDYSLSALAGFEFGDANIVIGA
FT                   GWQHRSELPTTERDYTALPYTVNPSGFSALSTPGLFAATYLTGQPDNPATPGNEALNTV
FT                   TRPDRGCNELGGFQDGAICRFTFIPFDNIVEDEDRYQVFGQFTVDLSDRVRFQADAMWA
FT                   RSDLESINYSPAFPPTQGPRGSGFLSAFTTSPNNPGVAPFLAQQGLPANNPGPLVAVTN
FT                   VLFRPLAISATRSIPIAVRAPALPATRPIASAAASTSNSMTA"
FT   gene            91273..92739
FT                   /locus_tag="ELI_00330"
FT   CDS_pept        91273..92739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00330"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62158"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT3"
FT                   /protein_id="ABC62158.1"
FT                   /translation="MPGNENSAELLRFLQIPNGTVEEESQFVFDLVLSGDTGFALPGGN
FT                   VAFAVGFQYRDTNFNSRPINDESNLDINPCFREGDRSCVGTSTEGVGPFIFLGGSRPVD
FT                   LDQSVYAFFGEVQLPITDRIEAQAAIRFEDYGGAVGSTINPKGSIRFEATDWLTFRGSV
FT                   GTTFRGPIPSQVAPISVTALQGFTAAGGNFKSLDIFGNPNDLGPETAFTYNIGAIMNVP
FT                   LGAGNVIFSVDYWSIDLEDRITTTPGDAIASLVGNGQTTGTAPVDCSSPLANLITFSGN
FT                   TCIQGTTTGLDISRVRTDWVNGPDVKISGLDFALTVNVPLGETADLSFGGNAVWNLDYS
FT                   FDEFVVQGVVTEEAYDAIGFGNYFRDPNTVPEWRANGFVNVGWEPFNVRYSVTHIDGVT
FT                   DDRCVTRPAPCFSTSAGPTDFGIESGSYTQHDIALTVDVDLGFVEAQLQAAIKNFTDAE
FT                   PATAQLPLGFNPFIGNAIGRNYRFGIRTRF"
FT   gene            92814..94118
FT                   /locus_tag="ELI_00335"
FT   CDS_pept        92814..94118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00335"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62159"
FT                   /db_xref="GOA:Q2NDT2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT2"
FT                   /protein_id="ABC62159.1"
FT                   /translation="MATATGIAGGAPAGEVSDRARKVTLFLLTVTYFFSYMDRQILAIL
FT                   LEDIKADLLLSDTQLGLLSGFAFALFYATLGIPVAALADRMNRINIISIALALWSAMTA
FT                   ACGLAQNFIQLLAARVGVGIGEAGSSPPSHSIIADLYPAEKRALALSIYSLGVTLGAAA
FT                   GQMFGGNLTYFFDWRVAFIVIGLPGVMLAIFVKLFATEPPRRAEPGAVDSEDQPSIGEG
FT                   FTTILSNRSARWMIAGVTLTSMIGYALTGWTPAYLIRIFDLNTLQVGNIVAPLLAIAGV
FT                   ASGLGGGWLANRMTARDGLWRQPWMIAILKTIALPFLIWFYLAGDAWMAVGVYFVAVLF
FT                   QSSYLGPTFAVIQTLAPLKMRAVWAAITLLIINLIGLGLGPTMVGVLSDLFAPRFGNES
FT                   LRYALLVVAAATPVAILCYWRAAVLMKHDYPKAAV"
FT   gene            complement(94126..94752)
FT                   /locus_tag="ELI_00340"
FT   CDS_pept        complement(94126..94752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00340"
FT                   /product="glutathione S-transferase"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62160"
FT                   /db_xref="GOA:Q2NDT1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT1"
FT                   /protein_id="ABC62160.1"
FT                   /translation="MPTLYTMPGTCSLAANIAVAWTEAPISVRNMEYGDHKKDDYLAIN
FT                   PKGKVPALQFDDGEVLTELAAILSYIGAAHGTAGYARDTKLGRKEAEALSYMISEVHAA
FT                   YGPHFAAQNFAESEGAQHEVKQGAYHRLRGHYEWMEERLSDSGGGFYLGEKSFADAFLY
FT                   VLTRWIDQTPLSLSDYPQLAEFRNRMEQDKGVQNALEQQAMEPMG"
FT   gene            complement(94849..95835)
FT                   /locus_tag="ELI_00345"
FT   CDS_pept        complement(94849..95835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00345"
FT                   /product="radical SAM domain protein"
FT                   /note="COG0535 Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62161"
FT                   /db_xref="GOA:Q2NDT0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDT0"
FT                   /protein_id="ABC62161.1"
FT                   /translation="MASRSKSRNAPAGASPFAVEAARLPEEKFSDPDWTAKGEPRASVP
FT                   LVQLDTLWLNTGTLCNLACASCYIESSPTNDALVYLSHAHAAPFLDEAGAIGTPEIGFT
FT                   GGEPFMNPDFVPMLADTLERGFEALILSNAMKPMRRHEAALLDMRERFGDRLTIRVSLD
FT                   HHTKAVHEAERGPRSWEVAIDGLQWLSRNGFSLAVAGRMLPDESEADERAGYARLFAEH
FT                   DIAVDAGDPMRLVLFPEMDEDKDIAEITTACWQILGQDPKDIMCATSRMVVHRKGEPEP
FT                   RVTACTLIPYDPGFDMGATLDEASRPVKLNHPHCARFCVLGGASCSA"
FT   gene            complement(95835..97253)
FT                   /locus_tag="ELI_00350"
FT   CDS_pept        complement(95835..97253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00350"
FT                   /product="mercuric reductase, putative"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62162"
FT                   /db_xref="GOA:Q2NDS9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS9"
FT                   /protein_id="ABC62162.1"
FT                   /translation="MKFTHDVIVIGGGAAGLTAAGGCALFGLKVALIEGHKMGGECLNN
FT                   GCVPSKALITAAKRAAEARKQKRFGVELAAPNVEWSGVHTHIHRAIAEIEPHDSAERFE
FT                   EMGCEVIQDWARVTGKQSVEIGGRTLTAPRIVIATGSGPSVPPIPGLDAVPYLTNENIF
FT                   DLEAQPDHLVIIGGGVIGMEMAQSFARLGSKVTVIEPGRPMGRDDEDSVAVVMEVMKKE
FT                   GVTFVQGKAEKVEGRNGAITVHVDNGEQVSGSHLLIAVGRKARVSGFGLEDLGVELGNN
FT                   GIKVDERRRTSVKNIYAIGDCREGPRLTHVSGYEGSNVALEITLGIPTKVDYKALPWCT
FT                   YTEPEVAQIGLTEAEAKEKFGDKVTVVKEGFDHNERAITEGDTKGHMKVILKGKKVLGA
FT                   SIVGKNAGELLLPFSQTITGKSSTFAMGSAIVSYPTRSEITKAAAFAAWEPTVFGAIPK
FT                   KYAGFVAKVRRAFA"
FT   gene            97352..98407
FT                   /locus_tag="ELI_00355"
FT   CDS_pept        97352..98407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00355"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62163"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS8"
FT                   /protein_id="ABC62163.1"
FT                   /translation="MNIENSRDYYGKVLQGSEDLKTDACCTAEAPPPAILSAMMNVHED
FT                   VRARYYGCGLVAPQAIEGCHILDLGSGSGQDAYILAQLVGEHGSVTGVDTTPEQLAVAS
FT                   EHLEWHRERFGYAKSNVSFVEGDIEKLDQLSLPGGHFDVIVSNCVINLVADKQAVFAAA
FT                   HKLLKEGGELYFSDVYADRRVPHHLQNDPVLHGECLSGALYWGDFLAQAKAAGFADPRL
FT                   VTSRPLGIGDAGVAAKLDGISFYSATYRLFKLGELEMQCEDYGQAVRYKGTVAHQPRVF
FT                   ELDGHHHIETGRLFPICGNSWKMLANTRFAEHFEFFGDFSQHYGVFPDCGVSVPFGADE
FT                   GSVPATAAACC"
FT   gene            98407..99444
FT                   /locus_tag="ELI_00360"
FT   CDS_pept        98407..99444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00360"
FT                   /product="hypothetical protein"
FT                   /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62164"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS7"
FT                   /protein_id="ABC62164.1"
FT                   /translation="MRILITGAAGLIGGEVSARLAQAGHRVNAFVRSNPDVLANDGTIA
FT                   AVDEVLTGDLSQENMGLDPATLDRLAGEVELVLHCAALTRFDLDEEAYRATNIDGTARA
FT                   LELARRAGAGFLHVSTAYVCGERSGAIGEDDALPKRGFTNGYEASKAEAEALVRASGVP
FT                   FVIARPSIVVGDSKTGAIRQFDTIYAAFKLIAEGRVQHMPVKHGATLDFVPVDHVAAGL
FT                   VALVEQFEAAQGCAYHLVSGGPVSVGDFASAIGSFPHFDAPILVDAERFDPAILPPMER
FT                   RLFRRVAALYAAYFQRNPRFDDSNLRALTGLEPPSMDQEMLRKLIQYCIDVGFLKTPEL
FT                   QRTSG"
FT   gene            complement(99426..100151)
FT                   /locus_tag="ELI_00365"
FT   CDS_pept        complement(99426..100151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00365"
FT                   /product="hypothetical protein"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62165"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS6"
FT                   /protein_id="ABC62165.1"
FT                   /translation="MTKSVALVIPLLDEEKALPALIEVVRTLDPQPAEIIAVDGGSTDR
FT                   TRGIVREAGWTLVETAKGRALQINAGVKAAQSSLVCILHADTIPPPDMVQVIRETLEDN
FT                   RIALASFTPLITGEKTRWFTSAHNFIKTWYAPLLTRPHLFFRGVRLLFGDHAMFFRRAD
FT                   FLVIGGCTPGDAVMEEADLCVKFAELGRIEMVRRVVRTSDRRIAAWGPVKANWIYFKVG
FT                   MLWAFGLRSRMEKNYPDVR"
FT   gene            complement(100148..100726)
FT                   /locus_tag="ELI_00370"
FT   CDS_pept        complement(100148..100726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00370"
FT                   /product="hypothetical protein"
FT                   /note="COG3222 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62166"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS5"
FT                   /protein_id="ABC62166.1"
FT                   /translation="MSQPSLYIFCRWPAPGKAKTRLIPRFGEAGAAAIYAKLLQHTIAV
FT                   ARASGLPFELRVTGAEPDVFRSAFGEDLAITDQGDGSLSEKLARVPPPAIVIGSDCPGL
FT                   TEQHLWAASDTLALEEVVIGPASDGGYYLLGYNSDARFAFEGIAWSTDKVFEQTLGRFT
FT                   ERGMRAGILPELSDVDEPDDLEEWPDFLP"
FT   gene            complement(100723..102075)
FT                   /locus_tag="ELI_00375"
FT   CDS_pept        complement(100723..102075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00375"
FT                   /product="Na(+) driven multidrug efflux pump"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62167"
FT                   /db_xref="GOA:Q2NDS4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS4"
FT                   /protein_id="ABC62167.1"
FT                   /translation="MSENAKLTRGSIPGHLVSQTLPMIIGVAAIMSIGLVDAYFIGQLG
FT                   SEQLAAISFIFPITVAITSLGVGIMVGINSVVARALGEGDDDMAARRANFGIVFAIGCG
FT                   LVFAISLFVLLDPLFRLMNAEDALLPFIQTYMRPYLMGFPLLLAIMGFNGVLRGQGEAR
FT                   KTSYVSLTYAAANWVLDPLLITGAFGFEGFGIAGAAYATVIGWLLGVGMAWWLMRGTPL
FT                   PVDFGLLRRCSLTEPMKAITRVAGPAAFSNAINPIGLSVLTALVAVEGQAAVAGFGAAG
FT                   RLQSFAVVPLLGLSGSIGAIVGQNWGAHQRDRAKQATLYAGGFCIVWGLSIAVALFAAG
FT                   EWFAGFFTDDPAVVDEFARYLTIAAWGYAGYGLLIVGNGILNAVDRAGWALAQSCFRVF
FT                   AVMVPFAWLLRGSWGSDAIYGAELAANLVGGAVAMALVWWILNRKPAGQTA"
FT   gene            102179..102730
FT                   /locus_tag="ELI_00380"
FT   CDS_pept        102179..102730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00380"
FT                   /product="probable isoquinoline 1-oxidoreductase (alpha
FT                   subunit)oxidoreductase protein"
FT                   /note="COG2080 Aerobic-type carbon monoxide dehydrogenase,
FT                   small subunit CoxS/CutS homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62168"
FT                   /db_xref="GOA:Q2NDS3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS3"
FT                   /protein_id="ABC62168.1"
FT                   /translation="MPRLTVNDRPVEYDMDPEIPLLWALRDASNLTGTKYGCGTGDCGA
FT                   CMVIIDGAALRSCLITLEEAEGRFVTTIEGLSRDRSHPVQQAMVAEQAIQCGFCTPGIV
FT                   MAAAALIQRNAAPSKEEIEQAIPNLCRCGVYPRLVRAIQRAGRVERRQERISAAPAPGI
FT                   DPADAAEAVPAMTPPEPDEE"
FT   gene            complement(102762..104855)
FT                   /locus_tag="ELI_00385"
FT   CDS_pept        complement(102762..104855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00385"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62169"
FT                   /db_xref="GOA:Q2NDS2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS2"
FT                   /protein_id="ABC62169.1"
FT                   /translation="MTRFTHRIALLSTAALLGYTTSVTAAETAAEEGPERDYLPAEIVV
FT                   TGAVGEYAVEDGSTGTKTPTPLIDVPQTVTFITDDQLEDQSIRQLGEALRYVPGVSLET
FT                   GEGHRDEIFIRGQETTADFYLDGLRDDAQYYRPLYNVARVEVLKGANALIFGRGGGGGV
FT                   VNRVSKTADLGEAFGEFDASADTFGAFALLGDVNAPLSDSAALRVNATYEEFDSHRDFY
FT                   EGRFIGISPTLTARLGPDTTLTATYSYDDDSRVVDRGIPSLAGVPLMGFEDTFFGDPDF
FT                   NRTDAEVHILRSRIEHAFSDQLSVNASVQYADYDKIYQNIVPGGTDGTTVSLSGYQDAQ
FT                   TRENLIGQANLVWQVETAGVENTFLFGVEAMDQQSTNQRSNVQFAGTNTTPLADVITVP
FT                   AFSLGPLGRDRDSSLSTFSAYVQDQLSFGIVEIVAGLRYERFDLETVELLTGVPGSRVD
FT                   EEVSPRAAIILKPQENLSFYASYAESFLPQSGDQFFLLTPTTEAFEPEKFTNYEIGAKW
FT                   SVKPGLLATASIFRLDRDNTRATDPNNTGLTILTGASRTEGFELNVIGDITPNWHTNIG
FT                   YTYLDGEITSQSTFGAAGQRLQQLPKHQISAWNRFDVTEAFGLGFGVIYQDEQFASFSN
FT                   NVTLPDYWRFDAAAYYTVNDRISLQVNIENLFDETYFPSAHGDNNIQPAEPFSARFGVR
FT                   VKI"
FT   gene            104968..105354
FT                   /locus_tag="ELI_00390"
FT   CDS_pept        104968..105354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00390"
FT                   /product="arsenate reductase"
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62170"
FT                   /db_xref="GOA:Q2NDS1"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS1"
FT                   /protein_id="ABC62170.1"
FT                   /translation="MTNAIDHSKGLTIPMKATIWHNPKCGTSRKTLAILENLSKVELTV
FT                   VEYLKEPPTADKLRQLYTDAGIVPNEGLRLRGTDAEERGLPDADAESVLAAMVADPILI
FT                   NRPLVETEKGVRLCRPQDTVLEIL"
FT   gene            complement(105351..106736)
FT                   /locus_tag="ELI_00395"
FT   CDS_pept        complement(105351..106736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00395"
FT                   /product="multidrug resistance protein, putative"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62171"
FT                   /db_xref="GOA:Q2NDS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDS0"
FT                   /protein_id="ABC62171.1"
FT                   /translation="MADADPSKTAITQPPPTSLPKGISRGRLVLLFAVMLVTAAGNTAM
FT                   QSVMPSIGTSLGVADVWISLAYSWSALLWVACAPMWARRSDKRGRKSMMALGMIGFILS
FT                   FILCGLVLWFGLAGMLSALWTLLLFALCRSLYGLFGSAAPPAVQAYVASRTPRSERTQA
FT                   LAVVASSFGLGTVIGPALAPLLVFPGAGLTGPFLAFAAIGLVTLILLRLRLPDDEPQFA
FT                   ARGKAFDAPYGSGAARHARDRDDSDDEDMGEMQALPDSDPPDLRWRDKRLLPWMWAGLL
FT                   GGHAQAMILGISGFLVLDRLGLRDTPEAGAGPVGIVLMVGAVATLLAQWGLIPTLQMGP
FT                   RASTLWGMALAVVGVVIFGVADDLHAIALGFAVASLGFGLYRPGFTAGASLAVTRPEQG
FT                   QVSGKVASINGASYIYAPALGVWLYGHSDWLGFAVIIGFCLAVFVLGYRSLQSDDYLTI
FT                   DRG"
FT   gene            106833..107462
FT                   /locus_tag="ELI_00400"
FT   CDS_pept        106833..107462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00400"
FT                   /product="phospholipid N-methyltransferase"
FT                   /note="COG3963 Phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62172"
FT                   /db_xref="GOA:Q2NDR9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR9"
FT                   /protein_id="ABC62172.1"
FT                   /translation="MPDNEASAIARLRDRIGQRASRTLGQWGVFFRGFLEHPRMVGSII
FT                   PSSRYTIDKMLAPVDWDRCDLFVEYGPGVGTFCLPVLERMKGTGRLVAIDTNPLFVDFL
FT                   NRTIKDSRFTAVLGSAEDVEEIVRFAGHEQADYVLSGLPFSTLPGGVGEKIVAATERVL
FT                   RPGGAFMAYQFTAAVRDLMRTDFRRIDSGFEFWNFLPVKLFWAWKD"
FT   gene            complement(107466..108290)
FT                   /locus_tag="ELI_00405"
FT   CDS_pept        complement(107466..108290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62173"
FT                   /db_xref="GOA:Q2NDR8"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR8"
FT                   /protein_id="ABC62173.1"
FT                   /translation="MKFDMNRAWDDARAMLAGNSQMVLVIAGVFFFLPYFALMLLVPDM
FT                   SQNPAMQPGGDPDAAMAAFSAMYAEIWWVVILLAILQGVGMLALYALLRHSDRPTVGQA
FT                   IGFGFRGLLPYIGAALLQGVIFMLALAVPLGIAFATGSGVVIALVGLLAVVAAIYLYTK
FT                   FSLTTPVIGLEKEFNPLKAIARSWKLTKGNSLRLWLFYFLLILAFMVLSLVIGMIVGLV
FT                   FGLMGASVALVGNGLVSSLINAAFVCLFLAVLAAAHRQLSGGSPEEIGETFE"
FT   gene            108361..109020
FT                   /locus_tag="ELI_00410"
FT   CDS_pept        108361..109020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00410"
FT                   /product="lipoate-protein ligase B"
FT                   /note="COG0321 Lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62174"
FT                   /db_xref="GOA:Q2NDR7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDR7"
FT                   /protein_id="ABC62174.1"
FT                   /translation="MSDPLSDIEWRVEPGQVQYRTALDAMDARNAAIAAGDARELIWLL
FT                   EHPPVYTAGTSANAAELLDPRFEVVEAGRGGRYTYHGPGQRVGYALLDLRKRGKDVRRF
FT                   VHAIEDWVIATLRTFGVESWSVDGRVGIWTKDIDGAEAKIGAIGVRVRRWVTMHGFSVN
FT                   LDPDLSHFAGIVPCGIDEFGVTSLARLGISLAPEEWDAALQGRAGQFLAQLEGEPL"
FT   gene            109017..109334
FT                   /locus_tag="ELI_00415"
FT   CDS_pept        109017..109334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62175"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR6"
FT                   /protein_id="ABC62175.1"
FT                   /translation="MKRISIAMVALAFPLAGCGDDPAPVAETTDDAGAQGEILGGTISD
FT                   SMLPVDTLQSQSPSMASEGEGGADGDGGGDAGSPDPTSDNAPQATPEPAGEPVETAEDE
FT                   G"
FT   gene            complement(109331..110191)
FT                   /locus_tag="ELI_00420"
FT   CDS_pept        complement(109331..110191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00420"
FT                   /product="citrate lyase beta chain"
FT                   /note="COG2301 Citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62176"
FT                   /db_xref="GOA:Q2NDR5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR5"
FT                   /protein_id="ABC62176.1"
FT                   /translation="MAHRSWLLVPADNDAKLAKVPAVGADVVVLDLAAVAERNKLEARE
FT                   HAVTFMTKMQRQLTAKKPFAQWVRINPIGSPHWKDDLIAAMAQKPAGIVLPRAMGPQQV
FT                   QMLAAEIYELEQGGPAAHNSTRILPQVGDAPEAALMISDFAKDPHPRIIGLSWDAGALA
FT                   AASHMNTVDNDAIRAIRAQLLLTAKARGLLAIESPSGLVKRQEALEAVVNRARINGFDG
FT                   MMARHPAQIAAIDKAFAPTEEELVAARAILSAFELHPEAQVLTVDGRAVDRIGLERARR
FT                   LLDAG"
FT   gene            complement(110209..111318)
FT                   /locus_tag="ELI_00425"
FT   CDS_pept        complement(110209..111318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00425"
FT                   /product="Putative oxidoreductase"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62177"
FT                   /db_xref="GOA:Q2NDR4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR4"
FT                   /protein_id="ABC62177.1"
FT                   /translation="MHDSLFQPLTMGALETKNRIFMAPLTRGRAAEPMFVPNEMMATYY
FT                   RQRAGAGMILTEATGISREGLGWPSAPGIWSDEQAEAWKPTTDAVHEEGGLIVLQLWHM
FT                   GRIVHPYFLDGEPPVSASATKAPGEAHTPVGKQEYATARAMTPEDIQRTIGDYRNAAEK
FT                   AKQAGFDGVQLHGANGYLIDQFLRDGTNLRTDEYGGPPENRTRFMREVLEALIDVWGAD
FT                   RVGIRLSPNGETQGCDDSDPATAFGAAAKVCEDLGLAFVELREPGPEGTFGQTDVPKQS
FT                   PLIRSLYSGALILNSDYTAEEAEADVSSGKCDAVSFGRPYISNPDLERRIAAGAHTNPN
FT                   KDVPKSWYFPIPEGYIDYPTLEEEQAQVA"
FT   gene            111377..112330
FT                   /locus_tag="ELI_00430"
FT   CDS_pept        111377..112330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00430"
FT                   /product="hypothetical protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62178"
FT                   /db_xref="GOA:Q2NDR3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR3"
FT                   /protein_id="ABC62178.1"
FT                   /translation="MEGATVEKVSGDKADGSSSAPQWLLLTALLAGNVALALGPWSVRL
FT                   ADSGPVSAAFWRLALALPFLAILARATGQKLGGIPTKTLLLVALGSVAFAMDLSSWHIG
FT                   IERTRLGNATLFGNSGSIVLLFWGFIISRTLPRGLEWLAIVFALGGAAILMGRSLDISV
FT                   ATLMGDLFCLDAGMFYAVYLLTLQNARGTIGAWSLLVWVGIFACPVLLALAALNGEPIW
FT                   PGTQGGGWGPLVALSFLSQLVGQGLLVFSLRHFPPLIIGLALLTQPAVAALYGFGVFGE
FT                   VLGGLDIIGMVLLGSALVVARATQRSQPAIISSKPA"
FT   gene            complement(112297..113622)
FT                   /locus_tag="ELI_00435"
FT   CDS_pept        complement(112297..113622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00435"
FT                   /product="hypothetical protein"
FT                   /note="COG4325 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62179"
FT                   /db_xref="GOA:Q2NDR2"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR2"
FT                   /protein_id="ABC62179.1"
FT                   /translation="MWARFRAAWQAVNASYWFYPGLFALGAILLAFLTIYLDRNGWAER
FT                   LGELAWIQPARPEGASNMLTVIAGSMIGVASTVFSITIAAVAYASGNYGPRLLTNFMED
FT                   RGNQFSLATFIGTFVYALTVLRAVRTGEETSLLDVNNVNEMAGFVPQLSLLTAYILMAI
FT                   SIAVLVFFLNHIPASIRINSVLKGIGERLIADIQRLFPETSTGEVEMAAPRGRSVAAKG
FT                   VGYVQRIDFKRLERIAKAAGGHIKLGVRTGDFVHPDVPLAYWADDDELDDLRDDEIQQC
FT                   FTFGGMRTPAQDLHFLIDELVEIGLRALSPGINDPFTAITSIHWLGAATAELAHRDLVR
FT                   TFNEDEDADADRLILLDDDFAHFVGRGFGAMRSALATSPTAARVAFDCLANAATTLNDA
FT                   SRLRVLRVEGEQLMRQARENLAGPDLEMIEARYAGFEEIMAG"
FT   gene            complement(113884..114912)
FT                   /locus_tag="ELI_00440"
FT   CDS_pept        complement(113884..114912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00440"
FT                   /product="quinolinate synthase"
FT                   /note="COG0379 Quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62180"
FT                   /db_xref="GOA:Q2NDR1"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR1"
FT                   /protein_id="ABC62180.1"
FT                   /translation="MTAETKLPTGTDLIAEIDRLRKERNAVILAHYYQTPDIQDLADYV
FT                   GDSLQLSQMAAETDADVIAFCGVKFMADTAKILSPEKTVVLPDMDAGCSLEDSCPPEKF
FT                   KAFREAHPDHIALTYINCSTEVKALSDVIVTSSSAETILQQIPKDQKIIFGPDRHLGGY
FT                   LSRKFDREMLLWPGVCIVHEAFSETELLKLKQQHPDAPIAAHPECPPTIIDHADYVGST
FT                   SGILKFAKEFEGDTLIVATEPHIIHQMEKALPEKNFIGAPGADGNCSCNICPYMALNTL
FT                   EKLYVALRDLEPRIEIEEELRLKAKKSLDRMLEMASDSVGKGDIGEVEIEDIPEEDIPS
FT                   GD"
FT   gene            115028..116647
FT                   /locus_tag="ELI_00445"
FT   CDS_pept        115028..116647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00445"
FT                   /product="putative long-chain fatty-acid-CoA ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62181"
FT                   /db_xref="GOA:Q2NDR0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDR0"
FT                   /protein_id="ABC62181.1"
FT                   /translation="MYELDLSEAYCPAQADTPYEERTIEDVLRAQAAERPDALALRELL
FT                   ADGNAGRQWTYAELLVDAERAGRALASRHPAGTRIAIMGGNCPEWVLIQLGAAMAGLVL
FT                   VTVNPSFLPREVRYVLEQSGAGAVYYQPNVRGSALRPVVDEAAAGLAASDYVIDIEDHG
FT                   DLFAGENDGELRATEPRDICMIQYTSGTTGFPKGVLLHQHGLIQSNQDLFRRWNITEGK
FT                   LVMCPFPLFHTAGSAVNVLGCLSQGACLLLVSLFDPVAVAKAIEREKPDVLGGVATMLY
FT                   AILEAAKATGTDVFSVSTVLSGGAMVPPELNRAAQASFGVPILIVYGQTETSPAITAAW
FT                   PTDTGAELVETIGQPCSHMEVAILDPATRSVCAVDEQGEICMRGFNQMVGYNDNPQATA
FT                   ETIDEDGWLHTGDLGRMSARGYVRITGRVKEMIIRGGENLFPAEIEAAMIEHPAIAEVA
FT                   VAGVADEKWGEIVACFMRLAEGHERPGDDDLKTFVRERLSPQKTPAHWIWVTEFPLTGS
FT                   GKIQKFALAEAFEKGEFAAQAA"
FT   gene            complement(116654..117421)
FT                   /locus_tag="ELI_00450"
FT   CDS_pept        complement(116654..117421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62182"
FT                   /db_xref="GOA:Q2NDQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ9"
FT                   /protein_id="ABC62182.1"
FT                   /translation="MATTAAGAGIAQREARFFFIMACLMAATTVGGFGLMAAMGVSSFA
FT                   VPWLYHVHAGVFLSWTALYVAQNTLIFRGNIALHRRMGKLAALLIPVMVVLAIWLTFTT
FT                   LRMLGGPPFFAQAEFLVVNIFHILAFAALAGWALARRRETDWHRRLMFGAMATVGAPGL
FT                   ARLLPLPLTIPYTFAVVFLAAMIFPVVGMIFDKRAHGRVHPAWWWTLAVPIVALVVGEI
FT                   GANTDAAVQFTAEWVAGTPGGERPAEAFLPPGF"
FT   gene            complement(117463..119436)
FT                   /locus_tag="ELI_00455"
FT   CDS_pept        complement(117463..119436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00455"
FT                   /product="TPR domain protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62183"
FT                   /db_xref="GOA:Q2NDQ8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ8"
FT                   /protein_id="ABC62183.1"
FT                   /translation="MGERDDTLKQAQTALQAGDFARGLALAEQVLSDAPDDSDALYMAA
FT                   VAQRFLKQFDDARATMLRLHAASPEFGRAWQEAGHLARNAGDSDAAIAAYARAVQFNPA
FT                   LEASWSAQAKLLRVADRAAEAQAAEAQAHRLVKLPREVLAVMHHLHEGRLLRAEEICRA
FT                   YLRKHPRDVEGMRLLAQIGIKLGILDDAEFLLESAVTFEPDNIQLRLDYMDALRRRQKF
FT                   EQSRTQAEALHKRDPDNPLFQSHLAIESMQTGDYDRAFDLFDKVLVRLPDDPATLTSRG
FT                   HALKTTGRSGDAVASYRAALAAKPDHGDAYYALANLKTYSFSDEEMRAMRAQIDQTNLA
FT                   FMDRVHLCFALGKAHEDREEYEASFAFYEEGNALKRAQTRYSADAMSEELARQKQACTP
FT                   ELFAKHEGAGDPSPDPIFILGLPRAGSTLLEQILASHSQVDGTLELPNILALAHRLRGR
FT                   KAGQSRYPGIVHELDAEQLAACGADFIENTRIHRQGAPFFIDKMPNNFRHIGLIHLILP
FT                   NAKIIDARRDPMDCCFSGFKQLFAEGQEFTYGLTEVGRYYSDYVDLMTHWDEVLPGKVL
FT                   RVQHEDVLDDLEGQTRRMLDYLGLPFEHACLDFHQTDRAVRTASSEQVRQPINRKGQGA
FT                   WKPFEPWLGDLKAALGPLDPTR"
FT   gene            complement(119519..122176)
FT                   /locus_tag="ELI_00460"
FT   CDS_pept        complement(119519..122176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00460"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62184"
FT                   /db_xref="GOA:Q2NDQ7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ7"
FT                   /protein_id="ABC62184.1"
FT                   /translation="MNTLRSSASLGVLAAAIASPAMAQDQQAQAPAQPQQQARQGGVGT
FT                   IVVTATKRSEDLQDVAISVNAIGEEALDELGISTFDDYLVQLPNVTAGGSGPGQSTIYV
FT                   RGLASTTPNLTTAGVAGLAPNVSLYLDEQPLAQPGRNLDVYAADLERIEVLAGPQGTLF
FT                   GASSQAGVVRLITNKPSLAGFDAGFDLETSFTKGGETSYKGEAMVNVPVTNSLALRGVL
FT                   YLDDRGGYIDNVQGTRTLRESARFRPAGTIRDNGVPVNALRGGFQAGANLGNVTFLPTD
FT                   NAGLVEEDFNDTQYSGFRVSALYEFTPDWRLTVSHGRQSIESDGVFFADPALDLDDLEI
FT                   QRFEEDRIEDDYSNTSWTVEGRLAMLDVVYTGAYTDRETEQRVDYTDYLFVGQYLPYYI
FT                   CDGSVTYPGAADPSGTCQPPNLYVASVTDTTVFTQELRFNTPQENRWRVTAGGFYSDLE
FT                   LKERNDFAYPGNVIAQPFGPFKPNFPQDGFTTDPGPFPADTIFRNDIRRTDKQWGIFGE
FT                   LSFDIVPDVLTITGGARYYDIEVDFEGSANGSFCNSFSATDQDAFGTDLNDLYDGDGQF
FT                   TFIGSCDPALRQTFTQGQSIADIQAAGLSLGQATQVFNALQAPDVAKATGTIFKGTLTF
FT                   TPNEDLLFYATYSEGFRPGLLNRPGGATNGAGFTVPFELETDEVKNYEIGWKMDLIDGQ
FT                   LRLNGSAFYVDISRLQTTIFDPSITNLFFSDNAADAEIKGIEGEFTIAPYSVPGLTVAG
FT                   AFSILDTEITDVLTPTTDVVVGDELAYAPSFQGNLRVRYEWEAGDLRFHLQPQLVHSGS
FT                   KFTDIITINRLELDSYTTFAMSAGVAKDNWSVEVFGENLSDTRAQIAGNFINDRARITT
FT                   NRPLTAGIRFSWDY"
FT   gene            complement(122582..124288)
FT                   /locus_tag="ELI_00465"
FT   CDS_pept        complement(122582..124288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00465"
FT                   /product="transporter, BCCT family protein"
FT                   /note="COG1292 Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62185"
FT                   /db_xref="GOA:Q2NDQ6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ6"
FT                   /protein_id="ABC62185.1"
FT                   /translation="MTSDTDTAVSQPAIDPPLCELPVATAERGFYTGFSTHVAIPAKIV
FT                   VSVLIAWAIFFPTHASDTLAIANQTIIRQFAFWYVYLVAFLVVVCLVLALVPQSGSLRI
FT                   GAPGEKPEFSRFSWFSMLFGAGIGIGMLTYSTGEPLAHFQNNPDIIRGLVEPASAAAVP
FT                   SAYEYTFLHWGLSAWATYALVGLAVGYVAYRRNLPLTIRSSLAPIFGLRLSGNSGHLVD
FT                   IVAVVATILGVSVTMGLGVEQFVAGLYRLGFGEWLIKEGGTASDWAIVLALVLLVGAST
FT                   ISALSGVGRGIKWLSNLNMGLSFLLLAVFLVFGAGLYGLQLLGEGLVDHVARLPERMLA
FT                   LWTADGTETGNALAQWQLDWSVFYWAWWIAFAPFVGMFIARISRGRTVREYVLGVILVP
FT                   SLMCFLWMALAGGTAIQLELDGTAQGAILSAGISDQIYATITALMSPGVAYLLSGLIVI
FT                   LLMTYLITSADSAILIVNTINGAGENDGSRNRHILFWGAALALVVGSMLILGGIDAIRI
FT                   TMIIGALPFSVVVALMAISIVKAIVYDVIRKRHGVQTHCEDILAEAAARAE"
FT   gene            complement(124446..125129)
FT                   /locus_tag="ELI_00470"
FT   CDS_pept        complement(124446..125129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00470"
FT                   /product="hypothetical protein"
FT                   /note="COG4258 Predicted exporter"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62186"
FT                   /db_xref="GOA:Q2NDQ5"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ5"
FT                   /protein_id="ABC62186.1"
FT                   /translation="MADNLKNAESSADTLVPEPERQKPLARVQAVPWMIVILLIAAVAW
FT                   LGWKAFGPDELGDPIGTSLVAFEEQNALTVFSAEFAPVVSSEDSRFFGTINTRQVAVIP
FT                   TRVSYSVDLSQVDRSRLDWNEQDETLTVQLPQISVGKPNLDEARAQYLREGIWISREAQ
FT                   DKLTRDNTQLAEREARKQAANPILLNLARDAARQAVTQNLAIPLEVAGYGDVEVVVRFD
FT                   GEAGG"
FT   gene            complement(125114..125986)
FT                   /locus_tag="ELI_00475"
FT   CDS_pept        complement(125114..125986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00475"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62187"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ4"
FT                   /protein_id="ABC62187.1"
FT                   /translation="MADIPPKPWPTGKVERPEPLVARILAPNPSPYTFTGTQTYIVGTE
FT                   GEVAVIDPGPNEPEHIDAIIQAIGDDTVVAIMCTHTHRDHSPAAAPLAEKTGAPIVGCA
FT                   PLVIETDLPRADESFDTTYAPDRVLEDGEAMTGRGWTLRAVHTPGHTSNHLCFALEESG
FT                   ALFTGDHVMGWSTSVVIPPDGDMGDYMASLDKLYNREDRVYYSAHGAPIEKPRQLVRGM
FT                   IGHRRQRENQILRHLGEKPLRLPDFVPLMYKGLDPRLNKAAQMSVQAHLIDLERRGRVT
FT                   HSEDLWQTI"
FT   gene            126049..127521
FT                   /locus_tag="ELI_00480"
FT   CDS_pept        126049..127521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00480"
FT                   /product="Glycerol kinase"
FT                   /note="COG0554 Glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62188"
FT                   /db_xref="GOA:Q2NDQ3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ3"
FT                   /protein_id="ABC62188.1"
FT                   /translation="MRLSDLILVFDEGTTSTRAMLFGLDGSLHGVSQKELTQHYPRPGW
FT                   VEHDAGEIWERTLACARAVVERVGADRIACIGITNQRETVVAWDAQTLEPLTRAIVWQD
FT                   RRTADFCEELRAAGHEAEIQKRTGLLLDPYFSGTKMRWLLDHDERVKQAARKGTLALGT
FT                   IESWLVAKLSGGAHVSDASNASRTQLLALDGAQFDEGLCDLLGVPRRALPEVVDTQGRL
FT                   AEAKPDWLGRAIPITGMVGDQQSATLGQGCLSVGNTKATYGTGAFVLANKGSELPRSDN
FT                   RLLGTVLYQQGGERTYAIEGSVFVAGSLVQWLRDQLGLISSAAETEALARAIPDSGEVV
FT                   IVPALSGLGAPHWRAEARGVIAGLSFSSGKAQIARAALEAMAHQTYDLAQAFAADGAEW
FT                   TGLKIDGGMSANDWMAQDLADMLDLTVERPDFVETTALGAAMSAAVGAGLHPSLEDAAK
FT                   HMRGRVTSFDPAMDAAIREERLARWRKALAAS"
FT   gene            complement(127518..127988)
FT                   /locus_tag="ELI_00485"
FT   CDS_pept        complement(127518..127988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00485"
FT                   /product="probable transcriptional regulator, AraC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62189"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ2"
FT                   /protein_id="ABC62189.1"
FT                   /translation="MEETADLSATIVEELYCEALVLADDVRAAFDLSTPRECNSHDTLR
FT                   IALSSEGLKTTTRVMHTLAWLLNRRAFFRGEMSEYQLQRHGKLPPDRAPDPVMLDQLEL
FT                   PTQLLIAETRTMHARVARLDRAWRERFEFPASPIDELQERLTRAIRQMSESA"
FT   gene            complement(128100..128297)
FT                   /locus_tag="ELI_00490"
FT   CDS_pept        complement(128100..128297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62190"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ1"
FT                   /protein_id="ABC62190.1"
FT                   /translation="MTEAELRKRLEHLRVEHRDMDAAISALTDAGSTDQLQIARLKKRK
FT                   LSLRDQISAIEDQLIPDIIA"
FT   gene            128481..128636
FT                   /locus_tag="ELI_00495"
FT   CDS_pept        128481..128636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00495"
FT                   /product="hypothetical protein"
FT                   /note="COG2841 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62191"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDQ0"
FT                   /protein_id="ABC62191.1"
FT                   /translation="MASAHVDALQSKHAGLEARLHEEMNRPAPDMAKIQHLKKQKLRLK
FT                   EEIAAG"
FT   gene            128718..130985
FT                   /locus_tag="ELI_00500"
FT   CDS_pept        128718..130985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00500"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="COG3605 Signal transduction protein containing GAF
FT                   and PtsI domains"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62192"
FT                   /db_xref="GOA:Q2NDP9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP9"
FT                   /protein_id="ABC62192.1"
FT                   /translation="MSAAASARQILTGLHEVMASRMHAQGKLDRVVEIIGESLDSEVCS
FT                   IYLLREGMLELYATRGLNKEAVHVTRMAIGEGLTGTLVANQETLNLAEARAHPDFQYRP
FT                   ETGEEKFHSFAGVPIVYRERAVGALNVQHMDPRKYEDVEIEALQTTAMVLSELIGAAEL
FT                   IDEEEVGATEAQTGPAQIEGLSLVSGIASGFAVFHQPRVTIDQVVADDIEVERQRVYHA
FT                   FDKMRDQIDGLSQQAEFGKGGEHEDILATYRMFAYDEGWSRRINEAIDSGLTAEAAIER
FT                   VQQRTRMRMREIDDPLLAERMHDLEDLSNRLLRIVSGQLGTAASQGLRRDTILIARNLG
FT                   PAELLEYDRRRLKGVILEEGSLTAHVVIVARAMGIPVLGRVRGLRGVVREGDEILLDSD
FT                   AGMANIRPTQPVADAFDTRFVKSKERQAAYAELRDVEPFTRCGTRIQVLMNAGLREDMS
FT                   NLPLVGADGVGLFRTEFQFLVSATLPQRERQTRLYRDVLDAAGGKEVVFRTVDIGGDKA
FT                   VPYLASEEAENDENPAMGWRALRLALEREGLLKAQARALLEASAGKKLNVMFPMVSEPW
FT                   EFDAAKAVFDDQIAFLRKQKKMLPDEINFGAMLEVPSLAEVLDLLIPKVSFLSIGTNDL
FT                   TQFLFAADRANPKLAARYDWLSPAILRFLRRIVQATTGHNVGLGVCGEMGGRRLEALAL
FT                   LGLGIHRLSITPVSVGPIKELVRQVDLKQIEDAMNGWLASPPPSMREAITAWARERDID
FT                   VE"
FT   gene            131109..131939
FT                   /locus_tag="ELI_00505"
FT   CDS_pept        131109..131939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00505"
FT                   /product="hypothetical protein"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62193"
FT                   /db_xref="GOA:Q2NDP8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP8"
FT                   /protein_id="ABC62193.1"
FT                   /translation="MADNEVTEGTAELSFGAGERLRAERERQDLTLEQIAAKTRIPKRH
FT                   IESIEASDFTALPAAPYAVGFSKTYAKVLGLDPEEIAEQVRTDLGAEDPAERYGQASGL
FT                   EPGDPARVPSRGLVFFSIAAIVLLLAGGFMFYRTFFLPGAGPGSILTAEQQAQAEARAD
FT                   AQEAAAEAAPAAEPGGPVVFTALMDDTWVKFYDGSGRQLMQKQMAEGESYTVPADAQNP
FT                   QIWTGRPYAFSISIGGQTVPKLSEEDRVLKDVPVSAEALLARADEPSETAEPEA"
FT   gene            132126..133052
FT                   /locus_tag="ELI_00510"
FT   CDS_pept        132126..133052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00510"
FT                   /product="hypothetical protein"
FT                   /note="COG1729 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62194"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP7"
FT                   /protein_id="ABC62194.1"
FT                   /translation="MAATLAGVALTPAPALAQDNDEARIRKLEAEVRALQRRVFPGADG
FT                   RFFEPQIDTARTGTSTAPTTSTTAVTDILARLDAVETSLQRLTGQVEENSNTLLGLTTR
FT                   MAALEQGGVAVAATSGAATGAAGGASTTTTRPSGGEGATSSAARTVAAPETTPATAAPS
FT                   PERLAAVQQIAKPQTDDSADDEYSYGFRLWDAGFYPEAQQQLAMFVDKYPDHWRATYGR
FT                   NLLGRAYLDDGKPREAAPWFLRNYQDDRNAARAPDSLLYLAETMIALEDTSRACIALAE
FT                   FGETYPALAAGRLQDQYEANRAKVSCN"
FT   gene            133108..134067
FT                   /locus_tag="ELI_00515"
FT   CDS_pept        133108..134067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00515"
FT                   /product="ATPase"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62195"
FT                   /db_xref="GOA:Q2NDP6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP6"
FT                   /protein_id="ABC62195.1"
FT                   /translation="MRPLWHDIDDDDAPRLGVAVSGGPDSLALLLLANTALPGRVVAAT
FT                   IDHGLRPEAADEAAMVGGLCERLGVLHHTVEVALEPGNTQDRARKARYEALCRCFGEQG
FT                   ADTFATAHHADDQAETLLMRFNRGSGLSGLAGIRARTVLLSPEPLGEYLVVRPLLEWRR
FT                   EELAGIVADAGLAPVQDPSNVDTRYDRVQVRRALADLPWLDPLAMARSARHLQEAEDAV
FT                   RRSSADVYNRCTYREGETVWFHWGHARTVEIEAVRLILLEFGADVPRSSIARLIDQLMS
FT                   EGAGSLGGVVARRAWHRDGPNSETDAWKFEKEPPRRTG"
FT   gene            complement(134089..134769)
FT                   /locus_tag="ELI_00520"
FT   CDS_pept        complement(134089..134769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00520"
FT                   /product="hypothetical protein"
FT                   /note="COG1881 Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62196"
FT                   /db_xref="GOA:Q2NDP5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP5"
FT                   /protein_id="ABC62196.1"
FT                   /translation="MNAMLKWIGGATAATVLVFGGATLASTMMADSATAEAETASHEEA
FT                   IPVDPAKLGGEDAAPEAQVQQASAPVDEEFTVRSILPIDGPIKYGEWHWNTDKAPAEGK
FT                   IVMTVDLKARVISVFKGGHEIGAAAVLLGTDEHPTPLGTFPIKYKMRHNVSEKYDNAPM
FT                   PYSMFLTDDGVALHGSDVENGYASHGCVGMPDDFAAKVFAVAGKGDQVIITDGETLGMG
FT                   ESIL"
FT   gene            complement(134871..137633)
FT                   /locus_tag="ELI_00525"
FT   CDS_pept        complement(134871..137633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00525"
FT                   /product="Putative phosphoenolpyruvate carboxylase"
FT                   /note="COG2352 Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62197"
FT                   /db_xref="GOA:Q2NDP4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP4"
FT                   /protein_id="ABC62197.1"
FT                   /translation="MKSVTDLRERLQDMHSRTAETPLFNPVFQLSLDLSRALEAGELSL
FT                   DDLESMICELETTALEDRAARTRRLLALPGTDTWRLGPDFADFGAFREHWEQPRLHAVF
FT                   TAHPTFLLTPDQASSLASAITGDGSVADAACTATEDRPAVTLVYEHQRAMRAIGHAQDA
FT                   RDRIVGELLSNAAVSFADRWRDLKPLPFRFATWVGYDMDGRTDIKWYDSIGFRLAEKAQ
FT                   RLRRYVAKLEKIDSGHKLLGTLHPALAYAEARAEDFAQDLSDPVDLSDAANRLTADHEH
FT                   KLLSLAPIIAALEEEAQQASEDHAIKLLTLAAAMRADGLGMGWIHFRVNAKQLHNAIRR
FT                   RIEGGDTLEIGSKGAMAVLRKMVAEVEPMRANFGALAIEASTAIRQFLAMAQILHHIDA
FT                   DAPIRMLVAECEQPSTVMAALYFAKLFGIADKVDVSPLFETEAALEHGGRFLDALLQED
FT                   EYRAYARNRGRVCIQTGFSDAGRFVGQVPASLAIERLQGRMADAMRANAMSDVAALVFN
FT                   THGESMGRGAHPASLKDRLEWPLSPWARGRFARGSVRLEPEASFQGGDGYQLFETPELA
FT                   FATLAHIADYEWTEHASGEPDPFYTRTDLSLDFYRAIRTHQREHLESQTYSRAITAFGL
FT                   GMLNSTGSRVSRRQSDVAADRSMNLRQIRAIPHNAILQQLGYPVNVIAGIGTAAEGNEE
FT                   EIAQLLESSPRGQQLMRLARNANALASIKTVAAYGELFNSAYWASRTYRGTEDGISHAC
FT                   QALADYLTKDDRNGVFRRLASRLRVDALKFHRLLEHLPAEDPLPEREQTRRTLGVLQAL
FT                   RLALFKHMFLRAVSLPSFSRANDISRDDVLEMVFTLRIDDALAQMRRAFPTSFPQLDDF
FT                   QMDEPSDWPDDEGEGYGAIGRNYIDPLERAYMLSLRVTTAIANHFGAHG"
FT   gene            complement(137630..138244)
FT                   /locus_tag="ELI_00530"
FT   CDS_pept        complement(137630..138244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00530"
FT                   /product="KDPG aldolase"
FT                   /note="COG0800 2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62198"
FT                   /db_xref="GOA:Q2NDP3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP3"
FT                   /protein_id="ABC62198.1"
FT                   /translation="MSTIESIMRTAPVIPVIVIDDVADAVPLAEALVEGGLRVLEVTLR
FT                   TPAALDAIRAMKQVAGAIVGAGTVINQQDLADALDAGSEFIVSPGLTEPLGKAAIRAEV
FT                   PFLPGIANAGDIMRGLDLGLTHFKFFPAMAAGGLPALKALAAPFGQCKFCPTGGISEDT
FT                   APEWLAFDPILCVGGSWVAPRHPSDFAAVTQSAQAAAKLTP"
FT   gene            complement(138241..139212)
FT                   /locus_tag="ELI_00535"
FT   CDS_pept        complement(138241..139212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00535"
FT                   /product="glucokinase"
FT                   /note="COG0837 Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62199"
FT                   /db_xref="GOA:Q2NDP2"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP2"
FT                   /protein_id="ABC62199.1"
FT                   /translation="MDLVAVDIGGTHARFAIATVAEDGAITLGEPETLHTEDHASFQTA
FT                   WEDFRDRMGGSLPDAISMAVAGPVKTDIIRFTNNPWIIRPPLIAEKLGCGRYTIVNDFE
FT                   AVAHAAARAPAEQFIHLAGPEQDLPAKGTISVLGPGTGLGVAHFWRDGDGGYRVQATEG
FT                   GHGDFAPLDSIEDAILARLRKRHMRVSDERVVSGPAIVDIYHTLAAMEGRAVQELDDVE
FT                   IWTRGTSGDDSLAAAAVDRFCLALGSVAGDIALIQGASGVVIAGGLGYRIRETLTASGF
FT                   EDRFRAKGRFAGLMATLPVKLIVHPQPGLFGAAAAFAREHLS"
FT   gene            complement(139212..141017)
FT                   /locus_tag="ELI_00540"
FT   CDS_pept        complement(139212..141017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00540"
FT                   /product="phosphogluconate dehydratase"
FT                   /note="COG0129 Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62200"
FT                   /db_xref="GOA:Q2NDP1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP1"
FT                   /protein_id="ABC62200.1"
FT                   /translation="MSNLHDTIHKVTQRVIERSKPSRKAYLELMDREADRAPDRSQVSC
FT                   SNLAHAYAGATDDQAVMKAGGAPNIGIVTAYNDMLSAHQPYGRYPERMKIYAREAGATA
FT                   QVAGGTPAMCDGVTQGEDGMELSLFSRDTIAMSTGVALSHAMYESVALLGICDKIVPGL
FT                   LMGALRFGHLPAIFVPSGPMPSGVANKEKQRVRQLYAEGKVGRDELLASEMGSYHSPGT
FT                   CTFYGTANSNQMMMEMMGLHIPGSAFIQPGTKLRQALDRAAVHRLAALTGSKERSLARC
FT                   VDEKAIINAAVGLLATGGSTNHAIHIPAMARAAGVIFDWTDLSELSSAVPLLARVYPNG
FT                   AGDVNHFHDAGGMGYVIGELLEAGLAHRDIATVWDSDLSAYALEPGLDDDALAYRNVGE
FT                   SGDDTMLRPASDPFSPDGGMRLVEGNLGRACFKTSAVDKERWTIEAPCRVFEDQPSVAA
FT                   AFKAGELDRDVVVVVRFQGPRANGMPELHSLTPPLGVLQDRGYRVALVTDGRMSGASGK
FT                   VPAAIHCTPEALGSGPLAKLRDGDVVKLCASNGTLSTSADLDNREAAADPAPDWGVGRE
FT                   MFSMFRMHADGAEQGASPMLAAAGL"
FT   gene            complement(141010..142464)
FT                   /locus_tag="ELI_00545"
FT   CDS_pept        complement(141010..142464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00545"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /note="COG0364 Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62201"
FT                   /db_xref="GOA:Q2NDP0"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDP0"
FT                   /protein_id="ABC62201.1"
FT                   /translation="MSFTADRLLLFGATGDLSQRMLLPSLAALHADHLIGDDLQIIGTA
FT                   RSDLDDAGFRNFAREALEKFMPAERRSDMAGFLNRLSYQPLDATTLEGYKELADKACCS
FT                   EHGTAIFLSTAPSLFEPTIAGLRHAGLAGENVRIGLEKPLGTSLETSCEINDAVAAAFS
FT                   EDRTYRIDHYLGKETVQNLMALRFANILFEPIWNSNYIEHVQITVAETVGLEGRVAFYD
FT                   DAGALRDMVQNHMLQLLALVCMEPPTDFDATAIRDEKVKVLRALRKVDAGETVTGQYRA
FT                   GAIDGKSVPGYDEELGPKDGGDSDTETFVAIKAHVENWRWKGVPFYLRTGKRLPERVTE
FT                   IVVQFRCIPHSIFSSKGATTQPNRLVIGIQPDENVTLNVMAKVPGLGRDGIRLRQVPLN
FT                   IAMPDAFSGKTRRIAYERLLLDLIEGDQTLFVRRDEVEAQWEWIDAIRATWSESDLKPK
FT                   TYSAGTWGPSAAIALAERDGVSWHDE"
FT   gene            complement(142561..143364)
FT                   /locus_tag="ELI_00550"
FT   CDS_pept        complement(142561..143364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00550"
FT                   /product="Transglutaminase-like"
FT                   /note="COG1305 Transglutaminase-like enzymes, putative
FT                   cysteine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62202"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN9"
FT                   /protein_id="ABC62202.1"
FT                   /translation="MKLSITVELQFHAAQPVDCLLQCEVAAMPEQRILSGVTRLPASIA
FT                   IKRVPAQDSVGERFWITAEKDVAITYEAQVEIARSATDSARLGSLSEIHKTELPGEATQ
FT                   YLFDSRFCAAESFQSFVASEFAETRGGARIAAIREWIADHFSYTPGVSGPHTSARDSFV
FT                   ERRGVCRDYAHVMVALARASGIPARYASGYAPDVEPPDFHAVAEVFLADPQGSGGDWVP
FT                   VDATGMAKPDELAIIGVGRDAADVSFLTSFGAVSFSGHNVRVERA"
FT   gene            complement(143492..146833)
FT                   /locus_tag="ELI_00555"
FT   CDS_pept        complement(143492..146833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00555"
FT                   /product="outer membrane protein"
FT                   /note="COG5295 Autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62203"
FT                   /db_xref="GOA:Q2NDN8"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN8"
FT                   /protein_id="ABC62203.1"
FT                   /translation="MKKVFTKRTALLLMASASALAAATPASAQTANDGSECLLDDDDAM
FT                   TAASDRNAEASGADALACGVDARATGPSTTAIGGESVATGPGTTAIGWRAEATAERAQA
FT                   FGHLATAQGVRSLAVGENADAQSDNSTAIGNESIANGIDALALGDTAVATGPSTSALGG
FT                   ESVATGPGATAVGWRAQATAERAQAFGHLATAQGVRSLAVGENADAQSNNSTAIGNESI
FT                   ANGIDALALGDTAVATGPSTSALGGESVATGPGATAVGWRAQATAERAQAFGHLATASG
FT                   VRSLAVGEAANASSDNATAIGNLASANGFDALALGDSAAATGPSTSALGGESVATGPGA
FT                   TAVGWRAQATAERAQAFGHLATASGVRSLAVGEAANASSDNATAIGNLASANGIDALAL
FT                   GDSAAATGPSTSALGGESVATGPGATAVGWRAQATAERAQAFGHLATASGVRSTAVGEA
FT                   AESRATRSVAIGDVAVAAAENSVALGAGSVADQANTVSVGRVGAERRIVNVAAGTAATD
FT                   AVNVSQLNMTVAMLNANDGGNSIQAATDDEVDDEIDDGTGTNSVEFGDNAVASANGSTA
FT                   IGDNAAATSEFATAIGFNAQASGSTAVGGNSQATGANSAAFGVNASATGANSSALGENT
FT                   NADFAGATAIGAGAQANGVDALAIGSDNAGAAFTTASGPSTTAVGGEAMAMGPGATAYG
FT                   WRAVATAERAHAIGHLATASGVRSLAVGEGATASSDNSTAIGNLATANGIDALAIGDSA
FT                   AATGPSTTALGGESVANTPGSTALGWQAQATGAMATAVGHQSTASGDQSFAGGEDSVAS
FT                   GTNSVAIGNLAQATGGDSIAIGGNRDGAMGRATVATGPSTTVVGGQALANGPGATAYGW
FT                   RSEATAERATAIGHLAVASGVRSTSLGEAATATGPGSIAVGNQSSATGANSIAIGNGAT
FT                   ASNDGQVVVASLATSTASQTGGIGFVTADTNGTLGLALGPDFSGFAQQSSVTANRASIQ
FT                   SNTTAIGANSAAIGVNSNAIAALQSLTGTQTQQINSLFGETAANRVAIDRANEGVAMAL
FT                   AMESPALPAGANFGLSGGIGYFEDRAAGTIAMSARVSENATVSAGVGVGFDSGEVGARG
FT                   GFQIAW"
FT   gene            complement(147094..147843)
FT                   /locus_tag="ELI_00560"
FT   CDS_pept        complement(147094..147843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00560"
FT                   /product="hypothetical protein"
FT                   /note="COG5343 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62204"
FT                   /db_xref="GOA:Q2NDN7"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN7"
FT                   /protein_id="ABC62204.1"
FT                   /translation="MADTASLHEDDFLLAGELSLGVLEGEELSTARRLQLSDTAFAAAV
FT                   EWWDERLARMAEADLALVPSGDVLRGIHATLDRIEGEGDTAQITFEQPGRRPAGWSIGL
FT                   AALGTAMAAAALVLFLSTPETITQPPLVEQPAEGPQLVAQLADENSGRRLASVIDPARG
FT                   RLSVNASGLSPEAGQIAELWVIPADGVPRSLGEIPGQGSFTRDLDASEASLIAAGASLA
FT                   VTFEQDEGIRHQEPSPPILLVGQLDEV"
FT   gene            complement(147836..148387)
FT                   /locus_tag="ELI_00565"
FT   CDS_pept        complement(147836..148387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00565"
FT                   /product="Sigma-70 region 2:Sigma-70 region 4"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62205"
FT                   /db_xref="GOA:Q2NDN6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN6"
FT                   /protein_id="ABC62205.1"
FT                   /translation="MTQSRREALKLAMAGMAAGDRASLDTVYEMTSSKLFASILRVVRV
FT                   RERAEDLLQDTYVKAWQRAGRFDPAKGSPITWLCTIARNTALNDIRRDGVVRSEADDTL
FT                   PDVADDAKPQDEWLCDLEDAEALQRCLEGLEKDHRRSIRLAFFEGLSHSELARRIDAPL
FT                   GTVKSWIRRGLAGLKGCLGG"
FT   gene            complement(148572..149960)
FT                   /locus_tag="ELI_00570"
FT   CDS_pept        complement(148572..149960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00570"
FT                   /product="hypothetical protein"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62206"
FT                   /db_xref="GOA:Q2NDN5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDN5"
FT                   /protein_id="ABC62206.1"
FT                   /translation="MSTITSAIPDQKKVGMVSLGCPKALVDSERILTRLRADGYAMSAD
FT                   YAGADVVLVNTCGFLDSAKEESLAAIGEAIAENGRVIVTGCMGEEADAIRAAHPQVLAV
FT                   TGAHQYEAVVGAVHEHAPPSQGPYVDLIPQPSEADIKLTPRHYSYLKISEGCNHSCAFC
FT                   IIPQLRGKLASRRIDAVLREAEKLVAAGTKELLVISQDTSAYGVDTRHEAKSWKGREVR
FT                   AHMTDLARELGQLDTGDGTPPWVRLHYVYPYPHVDAVIPLMAEGLLTPYLDIPFQHASP
FT                   KVLKAMKRPANEAKVLERLKGWRAICPEIAVRSSFVVGFPGETEDDFRYLLEWLEEARL
FT                   DRVGAFRFEPVEGAAANALPDPVPEEVKEERYARIMELTARISAEKLQRKIGRALPVII
FT                   DEVGEPDEDGDIGATGRSQADAPEIDGAVYLRNVPATLAAGDIVQVTVEDADEHDLFGA
FT                   IARV"
FT   gene            150035..150454
FT                   /locus_tag="ELI_00575"
FT   CDS_pept        150035..150454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00575"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62207"
FT                   /db_xref="GOA:Q2NDN4"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN4"
FT                   /protein_id="ABC62207.1"
FT                   /translation="MNLLDVNWLAVVLAALAGFVVGGVWYGPVMGKKWMGAVGLSEAQI
FT                   KQGNMGLIYGGAFAFSLLASWTLAHTFDSYAVNGVELSVLVKVVTALGIAIGFILPAIG
FT                   TNYLFSQKSKTLFFIDAGYWVLFYIAMGLVHAYLP"
FT   gene            150519..150908
FT                   /locus_tag="ELI_00580"
FT   CDS_pept        150519..150908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62208"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN3"
FT                   /protein_id="ABC62208.1"
FT                   /translation="MAKMIDFLLPVAMLMQPMPADDAAVVEDYSDVDVDSLRKIYVKDS
FT                   REAALADPEHPMQDICVRTLMAGSRVKARSVCQPLASWKAYVESLDAMADEWANTGRAL
FT                   RSSEMITGARAGRIYAPGGPSRPGG"
FT   gene            150956..151387
FT                   /locus_tag="ELI_00585"
FT   CDS_pept        150956..151387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62209"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN2"
FT                   /protein_id="ABC62209.1"
FT                   /translation="MAYSMIGAIALLLLQSAAIDAGPDGTETLAEDNDALLAGSESYDD
FT                   GYVEDGYDDVDLASLKRIFVRDSQEATEVEVEHPLQPICMRKMLPGSRVKARTMCQDKT
FT                   SWIAYRTSLDAMTDAWGTSGIALEPGGDPTPGKSFGMGR"
FT   gene            151460..151786
FT                   /locus_tag="ELI_00590"
FT   CDS_pept        151460..151786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62210"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN1"
FT                   /protein_id="ABC62210.1"
FT                   /translation="MFAASLLPFALLAQQATTPSDLPPAPPPERAETDPEKMRKIYVTD
FT                   SQVAARTKVDHPLQPVCVRRLKPGSRVKAQTVCQDVAAWKAYVLAQDANFYEWDTAQRG
FT                   LDVK"
FT   gene            complement(151802..152827)
FT                   /locus_tag="ELI_00595"
FT   CDS_pept        complement(151802..152827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00595"
FT                   /product="putative membrane protein"
FT                   /note="COG1226 Kef-type K+ transport systems, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62211"
FT                   /db_xref="GOA:Q2NDN0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDN0"
FT                   /protein_id="ABC62211.1"
FT                   /translation="MRGPQFKPLRRAVRIPVWGDLGIRIGLAIFLIFVVIMIHWWDREG
FT                   LVDNLDGEVSFTDVIYFTMISVTTTGFGDIAPITDRARMVEAIIVTPIRFAVFFIFVGT
FT                   AYNFIIKRTWEKWRMARIQQQLADHIVVLGFGISGSEAVDELIERGTDPSSIVVVDPSE
FT                   ERLKAAEKLGCNVIAADATRDSTMEAVRISKAKNILVSAGRDDTSILIVLTVRHLAPDV
FT                   PISVVVRADDNELLARQAGANNVINPVRFTGLLLAGSAKGAHIADYLADLASVTGKVQL
FT                   VERQITEEEVGRSLSEACGRGIGLRIYREGNAFGYWEKPCTALEAGDVIVEVVPSPNGE
FT                   D"
FT   gene            complement(152913..153695)
FT                   /locus_tag="ELI_00600"
FT   CDS_pept        complement(152913..153695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00600"
FT                   /product="membrane protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62212"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM9"
FT                   /protein_id="ABC62212.1"
FT                   /translation="MRRAALLLLAAPLLLAANNPRTATEYEVQTGDTLGGIANKTGVPA
FT                   PVIAAANGIPPPYNVLVGEKLVVPRQRKHTVKAGETGFAIALQYGVPFENIAIANGLDE
FT                   DGTVKVGQELIIPAVFQPRRVARRSIPNSPYFRWPHDGRVLYGFSRREDGSGHDGIDID
FT                   VEVGDMVRASSSGTVVFADEEKTRFGRQVLIDHGNGWQTSYGHLARITVQKGDVVKAGE
FT                   RIGIAGDAGKATRPELHFEIRRDGKDVDPASKLPQRRK"
FT   gene            complement(153695..154453)
FT                   /locus_tag="ELI_00605"
FT   CDS_pept        complement(153695..154453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00605"
FT                   /product="stationary-phase survival protein"
FT                   /note="COG0496 Predicted acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62213"
FT                   /db_xref="GOA:Q2NDM8"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDM8"
FT                   /protein_id="ABC62213.1"
FT                   /translation="MRILLTNDDGIHAPGFEVLEDIARELSDEIWVCAPAEEQSGAGHS
FT                   LTLHHPVRLRQLGERRYSVTGTPTDSVMLALRTVLEDKQPDLILSGVNRGANLGDDITY
FT                   SGTASAAMEGALGGIKSIALSQVYKRDAEHELFDAARTYGADVIRKLIDAPFGDRTLIN
FT                   INFPPLPADKVRGIRAVRQGFHDYSRGSVVKGRDPRGLEYYWFGLYAIEHTLDHGTDLE
FT                   AIDEGFVSVTPLQLDLTQHSLLSVIGERFE"
FT   gene            complement(154571..155851)
FT                   /locus_tag="ELI_00610"
FT   CDS_pept        complement(154571..155851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00610"
FT                   /product="SerS, seryl-tRNA synthetase"
FT                   /note="COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62214"
FT                   /db_xref="GOA:Q2NDM7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDM7"
FT                   /protein_id="ABC62214.1"
FT                   /translation="MHDIRQIRDNPEAFDAALARRGHEPVAAEILALDEQCRAVTTKMQ
FT                   EAQSRRNEASKAIGQAMGQGNTEKAEALKAEVADLKQTLPRLEDEDRELKMRLENALAV
FT                   IPNLPLDDVPDGADESDNIEVGTWGTKREFSFEPREHADIGPALGMDFETGARLSGARF
FT                   TFLRGGMARLHRALGQFMLDRQVSEYGYAECAPPVLVRDEAMYGTDKLPKFAEDSFQTT
FT                   DGRWLIPTAEVSLTASVMDQILDDAALPMRLTALTPCFRSEAGAAGKDTRGFIRQHQFE
FT                   KCELVSIVRPENSAAEHERMTEAAESVLQALDLPYRKMLLCTGDMGFGARKTYDLEVWL
FT                   PGQGAYREISSCSNTGDFQARRMNARYRPEGEKKTAFVHTLNGSGLAVGRTLVAVIENY
FT                   QEEDGSVAVPEVLAPYMGGAMKLEPTP"
FT   gene            156036..157352
FT                   /locus_tag="ELI_00615"
FT   CDS_pept        156036..157352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00615"
FT                   /product="Sulfotransferase"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62215"
FT                   /db_xref="GOA:Q2NDM6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM6"
FT                   /protein_id="ABC62215.1"
FT                   /translation="MGTSSTTPPRRAPFIDIADTLIRAGRALGRVRPARLEKRYLLDHA
FT                   SEQTGLEDFGDPWFHEPFDVLLKAVNEEAQLNAAGDFSAMLYFNQVLMHRLLSEWWFKR
FT                   HPEILERSVKRPVVIVGPMRSGTTRLHRLLASDRRFSHMRSFETISPVPRQDFEQVLAG
FT                   EKEDFRPVLAKRVMRVARLANPRTLSIHPTGPYEPEEELGLLVASLYGMKHEAQWHVPS
FT                   YAKWCEAADATPAYRYMADQLRLIGWSQQESSLRPWILKTPQHMLDLPALLNVFPDARL
FT                   IFTHRDPQQVVGSAASLAWNQTIIYSDHADANAIGREWLRKSHLQVERMMAARESIPAD
FT                   RMIDVQYDDVERDWRGTMERVYDFLDLDMEPAVPGMEDYLERAKDLKRHPHKYSLEMFG
FT                   LTAAEVHERMGDYIARFDVPMERPTGQAITTAGALSAQS"
FT   gene            157555..158736
FT                   /locus_tag="ELI_00620"
FT   CDS_pept        157555..158736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00620"
FT                   /product="phage-related integrase"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62216"
FT                   /db_xref="GOA:Q2NDM5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM5"
FT                   /protein_id="ABC62216.1"
FT                   /translation="MEDGLPDLSKIGSRDKLKPRADKEPYWQRLQAGWYVGYRPSKLGS
FT                   HGTWFARAYDEDLRKYRRKALGRFGSLTGNDVFAAARKEAEAFAELVESGGIQVEKLET
FT                   VADACRAYLSEKPGSIAEGVFRRHVFGDPLARIKLSKLRRRHLRDWRKRLEDTPALISR
FT                   SKKGEKRVKVRSAATINRDMVPLRAALWRILPPGAPKTDAAWQEALKPIKGADRRRDLY
FT                   LDRQERRRLLAELDADIEPFVRALCLLPLRPGALAALNVSNFEKRTRTLTIGSDKNGVP
FT                   RQISVPESIASFLSEQSKSKLPSAWLFTRSDGIPWSKDMWKGPIKKAVVASELPAQTSA
FT                   YTLRHSVITDLVRGGLPILTVAQMADTSVAMIERHYGHLVRNDAEEALAQLVL"
FT   gene            complement(158755..158973)
FT                   /locus_tag="ELI_00625"
FT   CDS_pept        complement(158755..158973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62217"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM4"
FT                   /protein_id="ABC62217.1"
FT                   /translation="MDGIQLDMNANRKRISGRLEHLPRGAAIVTDAGDHWVLEGFEPSN
FT                   DDFGFEVTAEGVVVGLDRLRVDWLGAC"
FT   gene            complement(158949..159497)
FT                   /locus_tag="ELI_00630"
FT   CDS_pept        complement(158949..159497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00630"
FT                   /product="lytic transglycosylase"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62218"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM3"
FT                   /protein_id="ABC62218.1"
FT                   /translation="MAISGSACAQEFQVFDHELSKVEVTSDQGPGVHPTAFYLGKPDGE
FT                   PDHIDRSFKEALYEPLIRQAEARYSLPPRLLLALVWQESRFNPMAISPAGAAGLAQLMP
FT                   GTARQLGVSNRHDPVQNIDGGARYLKQMLDRFGAIHLALAAYNAGPGAVSRAGGIPKNR
FT                   ETPGYVKSVIARWMAYSST"
FT   gene            160143..160592
FT                   /locus_tag="ELI_00635"
FT   CDS_pept        160143..160592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62219"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM2"
FT                   /protein_id="ABC62219.1"
FT                   /translation="MIAAVSLDEGPIAIHRTFLSTEASGKAAFEKPKRALGALGEAAVR
FT                   LFDPASEKLGLAEGIESAMSAYALTGIPVWATLGNERFGLVSVPDSVTELHLFVDHDAG
FT                   GELAASRGLAAYAREGRTIHVRKPSSIDTDWNDELTAWLRRKAAQ"
FT   gene            160669..164916
FT                   /locus_tag="ELI_00640"
FT   CDS_pept        160669..164916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00640"
FT                   /product="putative methylase/helicase"
FT                   /note="COG0286 Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62220"
FT                   /db_xref="GOA:Q2NDM1"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM1"
FT                   /protein_id="ABC62220.1"
FT                   /translation="MFQSDLFPAGGQLPSTPLAYAIGTRVAALLASRRHLTRVDISDLF
FT                   AEETGVMDWGSAWTIDVYNNAVEIGALLWLREASRIDLATNVHEAEARFDWLEAALPPR
FT                   HVRSEAQVELQQFSTPPMLAWLMAKAAAVGAHDTLLEPSAGNGALALWGSVQNASLVLN
FT                   EIDPARRDSLGHIFPSATITAQDGELIADLHRGPVPSVVLMNPPFARSQERGKDGETAL
FT                   RHLRGVIRGVANGARIVAIMPDGFAASTFAKAHDEASLFLDVRLQQMFRRTGTGIAVRL
FT                   VVFDKTPTAASPAITGDTADLIALHELITALPPRAQTSANIHRLPVGKPVRLVCKTSTQ
FT                   SAPVRPVAPFAATPAASANAIDLAYLVLADPAPVPEQAGIYLPYRPSRIAFEDAPVHPT
FT                   PLVESVAMGSVAAPQPEVRPRLPTNWQADGLLSEAQCETLVYAAQAFARDLPGRFKVSQ
FT                   EGTALELSEDGHSYRQGFFLGDGTGAGKGRQIAAVIMDRWLAGERRHVWITKNEALLED
FT                   ARRDWEALGGLPLDLQPLSRWKLGQPVTMSEGILFVTYPTLRSGRAEDTRLDQILAWAG
FT                   EGFDGVIAFDEAHAMANALVSSSIRGKVKGSEQGMAGLRLQNHLPRARVLYASATGASD
FT                   IANLGYTSRLGLWGPETAFPTHEAFMTEIRAGGVAAMELVARDLKAQGLYLARALSFAG
FT                   VEYEILEHSLTEAQVRIYDAYAEAWAIIHRNLEAALEATRVIDEDSGDTLNRNAKAAAL
FT                   SIFEGTKQRFFSQLLLSMKLPSLIPAMEAALGEEHSVVVQLVSTAEAMLDRRFADLTVE
FT                   EREALDIDLSPREYVIDYLTKSFPVRLMQVFADEDGNLRSEAMSDGEGNPVFCPRAIAA
FT                   RDALIEQLCALPPIATALDAIIEHFGTDAVAEVTGRTRRLVLGRDGEQRLERRSPSANV
FT                   AEAQSFMEGTKRILIFSDAGGTGRSYHADLGARNQQRRVHFLLEPGWRADNAIQGLGRT
FT                   NRTNQASAPLFRPVTTDVKGERRFISTIARRLDALGALTRGQRQTGGQNLFDPADNLES
FT                   DYARDALSRWFQLLYDGKLEATTFGNFVERTGLRLENPDGGLTDNLPTIQRWLNRILAL
FT                   PIALQNAIFDEYLGLVEARIEAAREAGTLDQGLETVRVDRFTALADELLRTDPVTGAET
FT                   RLVSLEVTRHLRPLRLQRLVRMHEIGSPHAIPMRNARSGKVALSVPARRLIADDGAVIE
FT                   RRRLLRPLKSANWTLEALAESHWEEIFVTAFTSAWRVEEVEAAKSPVTERVHLATGLLL
FT                   PVWKRLPGDHVRVTRLVAEDGQSIIGREVLDIDLAAIAETFGLSGVAGPSAEQIGELVI
FT                   ASGKPLGLASHDSLTVKRSLVGGEQRLELTGFSPDRLDWYKGKGCFTEIIRYRTRLFVP
FT                   ISAASSVLPALAA"
FT   gene            165021..167012
FT                   /locus_tag="ELI_00645"
FT   CDS_pept        165021..167012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00645"
FT                   /product="hypothetical protein"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62221"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDM0"
FT                   /protein_id="ABC62221.1"
FT                   /translation="MIQSIPLKKLVPSPRNVRKSSDVLADLQLRADIAARGLLQNLVVR
FT                   KGKRGKFEVEAGGRRLAALQALADEGTLSENHEVTCLVIEGEESEVREASLAENFQRLA
FT                   MNPADEAQAFASIIEAGATTEDVARRFGLTVRFVEGRLRLASLAPCVFEALAEGTITLD
FT                   MAKAYGAISDVERQAHVYAELQDAWYQITPDTIRRMVLDATVRGSDPRAVLVGRDAYLA
FT                   AGGRIERELFDDDASESWIDVALLEDLAHKAMDEAAEKAALEHGLAWVRPTLGNYVSHD
FT                   LVEGLGRLPCEPAPMTEQEAKELGELEADYDRVAAVLEDEDSDEDEVAKAEQELVVIDR
FT                   AMRALNDRPPVLADELKSEAGAFLVLSRNGEPTLVPQYYTETEVTADEGVVEPIEESGA
FT                   AKPKGSSLSQRLLDELAMQRRDILAIHLANDPALALDFMVFTLADADGHDWRARKASTL
FT                   VGSVASGPVTGFEAKDAPASAALAEFAGSLDESWRAGESDVERFARFRALSDEVRSAWL
FT                   GHVVSRTLIASLACESERSVPMHEALGSLLEIQTAHWWRPTAANYFDRVAKARTLEALD
FT                   AAGGPELVSRYAASKKAELASAAERIFSGNFIGEAEVKERSQAWVPSIMRFNDADVPAD
FT                   LEENASIDNEADETISGDATDEIAEQAA"
FT   gene            167179..168108
FT                   /locus_tag="ELI_00650"
FT   CDS_pept        167179..168108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00650"
FT                   /product="hypothetical protein"
FT                   /note="COG4227 Antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62222"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL9"
FT                   /protein_id="ABC62222.1"
FT                   /translation="MTKSRRAASVSPAQRITAAIIEKLEHGTKPWVKPWRGVPVSRPLR
FT                   SCGTPYRGMNTFWLWMVADGCGYTSPYWMTYRQCQALGGQVRKGEKSTIAIFYKSYTKE
FT                   VENAAGEADTENRRVLKAYAVFNADQCDGLPDFYHPKPLVAALEPEGREDRLDAFFARV
FT                   GADLRHHGAQAYYEPLRDRVTMPPAELFEAYDHYYATLAHELSHWTGHSSRLDRDLKNR
FT                   FGSDAYAAEELIAELSSAILGAELGLPVTHLDHHASYIASWLKILKSDERAILTAAAKA
FT                   EEAASLLLDLGGHQSGESEPNIDLADAA"
FT   gene            168120..168548
FT                   /locus_tag="ELI_00655"
FT   CDS_pept        168120..168548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62223"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL8"
FT                   /protein_id="ABC62223.1"
FT                   /translation="MGRSVSYPTGSVVAFRLLDDGEDEDVDWAYECLVDEIIDTAKAAF
FT                   PSFLRFDGWRGREDRILLRNAYADCGISTWCGLAAIWLAERDDARYWEADVYNPRTARA
FT                   RHWLGQVSGRFLDLFGELRMIGRFSNGEAIFERERPCN"
FT   gene            168588..168965
FT                   /locus_tag="ELI_00660"
FT   CDS_pept        168588..168965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62224"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL7"
FT                   /protein_id="ABC62224.1"
FT                   /translation="MATQPLEPQIDDGKVLTSAVSKIAGFWGFTNAKLGTILGLSEATA
FT                   SRLRSGKAELDPTSKSFEAGQFLLRLFRSLDALLGSDDLSARAWLTTPNLDLEARPIDL
FT                   IDSFRGLITVCDYVDAHRARV"
FT   gene            168937..169656
FT                   /locus_tag="ELI_00665"
FT   CDS_pept        168937..169656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62225"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL6"
FT                   /protein_id="ABC62225.1"
FT                   /translation="MWTPTALASEFRRYRRTVWRVVEAQHRISTNRLASSLAEQQRLEE
FT                   LADAAKPDLPKAARGLHYLLASPFRYGHTVASRFRRPNERPGIFYASEAERTAIAETAY
FT                   WRLKFVSRSPGFVPGNRTSEHLSFSVPVSLTRLTDTTRPPLVADRQRWLDPDDYSACQD
FT                   LAAQVREAGGQGIRAASVRDPDGMNLALLDPACFAKSEPDYGRGWHLRHEAGRLTAIAA
FT                   FPHDEVLTFSPEQFGLA"
FT   gene            169933..170880
FT                   /locus_tag="ELI_00670"
FT   CDS_pept        169933..170880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62226"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL5"
FT                   /protein_id="ABC62226.1"
FT                   /translation="MYDSFASQLADLDLTGFTIAPAPFDATDFPSEDATAQTLGAVWSD
FT                   LFALFADTALEADSEDIAWGLVNLFHRAASRKSAQLDRASDEIRVLLASADGSEIHSSN
FT                   LEEQTARAQAAEASMQAFEQMREIAASLYRDETGSSWKPVSGSRASHAKSLTSAVIDAR
FT                   DFLRARAERRQAAHMPEGTPVIFTGGRSRFETTEDAKAYASNIWATLDKVRANVPDLVL
FT                   VHGGDSKGADRLAASWAERHEVQQLTFSLDRRLGARAGFKRNEQMLSLNPRYVVAFPGN
FT                   GVTERLVIDAKKQRITVVDRRGPVGVKPVHAQAR"
FT   gene            complement(170952..171146)
FT                   /locus_tag="ELI_00675"
FT   CDS_pept        complement(170952..171146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00675"
FT                   /product="hypothetical protein"
FT                   /note="COG3311 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62227"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL4"
FT                   /protein_id="ABC62227.1"
FT                   /translation="MQQSELLSCQDVMRLTGIRSRATIWRRIKKGTFPNPVDIGSGRIR
FT                   WRVAEVENWINDLPIRTYQ"
FT   gene            171457..171915
FT                   /locus_tag="ELI_00680"
FT   CDS_pept        171457..171915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00680"
FT                   /product="hypothetical protein"
FT                   /note="COG0775 Nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62228"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL3"
FT                   /protein_id="ABC62228.1"
FT                   /translation="MTDMTSMIADFASRQEERHEKRKLKLDHLKAVTLAALRTAEIASV
FT                   EITFDGYGDSGSIDDITCLSADASIADCPEVQVAAPDGGESETEPPRTIPLSDALEEIG
FT                   CIALELHHPGWEINEGSAGALEIDVAAGTFILECRTRFIDYDEQVTKI"
FT   gene            171927..172349
FT                   /locus_tag="ELI_00685"
FT   CDS_pept        171927..172349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00685"
FT                   /product="hypothetical protein"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62229"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL2"
FT                   /protein_id="ABC62229.1"
FT                   /translation="MAHCYYHALSSVRKWGGVVEDYLDLHQWFDQSKSILADPRHRALR
FT                   HHAEGIFMLENLFGATLINADGKTVPTRLVGEQHVIEDLGLIPSFADWARLIQPERWML
FT                   KGHPVDTAPLDASPTAVGVDIPPRFPASDETIRVAI"
FT   gene            172666..172935
FT                   /locus_tag="ELI_00690"
FT   CDS_pept        172666..172935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62230"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL1"
FT                   /protein_id="ABC62230.1"
FT                   /translation="MQLDDLLQRYFATTDLSGVAPDTLSAGIEHCRVDLGLEEDRGKRF
FT                   ALWSFLHMFGSAPDLDVAFESEEDREAARNFMDLLAASEGDEAG"
FT   gene            173203..173601
FT                   /locus_tag="ELI_00695"
FT   CDS_pept        173203..173601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00695"
FT                   /product="single-strand binding protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62231"
FT                   /db_xref="GOA:Q2NDL0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDL0"
FT                   /protein_id="ABC62231.1"
FT                   /translation="MTNIAILTGRISRDPDTRETKGGTNVTGITVVTDRPARDKDGKTY
FT                   KDENGYTAKESEFHRVTCFNGLAKTVGQYCSKGQLVSVQGRIHYTQWEDKDGVTRYGTE
FT                   ILADKVDFLSRGNGSGEEGDNTDAPEID"
FT   gene            complement(173666..173932)
FT                   /locus_tag="ELI_00700"
FT   CDS_pept        complement(173666..173932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62232"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK9"
FT                   /protein_id="ABC62232.1"
FT                   /translation="MPSNRSAVAALRKLEADQAALDQRKQQLEEQAALELGRVILGTGL
FT                   EAFSKKGLSRVAAELGKLGEEGALRKLVSSAPSSSRSGQTPSE"
FT   gene            174279..174500
FT                   /locus_tag="ELI_00705"
FT   CDS_pept        174279..174500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62233"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK8"
FT                   /protein_id="ABC62233.1"
FT                   /translation="MTTLGNLESGSNSYFEALATAERRALHSFFDQHVVEDDDLGYFAL
FT                   DEGDYNALPAHLASRVVHTVHGGMLDEF"
FT   gene            174954..175073
FT                   /locus_tag="ELI_00710"
FT   CDS_pept        174954..175073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62234"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK7"
FT                   /protein_id="ABC62234.1"
FT                   /translation="MEWQKGTKKQKHRKSERLSNQVVAKAQQYPAAGSPIVSN"
FT   gene            175211..176203
FT                   /locus_tag="ELI_00715"
FT   CDS_pept        175211..176203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00715"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62235"
FT                   /db_xref="GOA:Q2NDK6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK6"
FT                   /protein_id="ABC62235.1"
FT                   /translation="MVTLGSAGVAAGALGAPAARAAARRLLIKATLADLPTAPEKLKAP
FT                   LFAEFAEEFWLDYSPHWKPSTRDASRAYIDKRLIPRFGALSVDAIERADINRWRDSMAD
FT                   VGGAFNRSIPVLSVMMQYAEKLGYREKNTNPCRGVSRFKRDLPERYLSADEYRRLGKVL
FT                   AEHNGANAFVVPALLLLIYTGARVSEIATLRWRYVELPRLALPDSKTGPKTIYLNPQAI
FT                   AVLDGLQRRGDDQLVFPAMYREVPINLGQHWEKIRRKAALPDVRLHDLRHSFASVAIAK
FT                   GIPLATIGKLLGHALPETTARYAHLADEVISESADRICSSLASSMGMTA"
FT   gene            176200..177369
FT                   /locus_tag="ELI_00720"
FT   CDS_pept        176200..177369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00720"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62236"
FT                   /db_xref="GOA:Q2NDK5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK5"
FT                   /protein_id="ABC62236.1"
FT                   /translation="MTSYDLKRILAEELARIVPGDAGKRRTKFDYVLPGFGERIHPSGR
FT                   KSYVLQRTMGGKQRLITIGDAAILTERIAKDVARRLILRIELGQNPADRKQRGKKTPTY
FT                   AAFLRHYWEVAAPAWKPSTLEIHDIYRRTHLEHAFAGKFIDEISHADAVRWHAMLTRTA
FT                   GPGAANRAMEILKAMFGKAEAWGYLPEHSNPFRGVKRNKGRKIERFLSQAEMARLGEAL
FT                   SQHRADKPNEVAVISLLALTGCRRGEILNLTWGEVQGRKLKLTDTKTGPRVIWLGKEAR
FT                   AVIDRLPRRRGHERVFQFDVLPVSAIDWFWRMLRVEAGIEDLRLHDLRHNYASLAARSA
FT                   ETLPMIGELLGHRDVGTTARYAHFDDRSSLIATRHVGKIIEHNLTPKRD"
FT   gene            complement(177371..177796)
FT                   /locus_tag="ELI_00725"
FT   CDS_pept        complement(177371..177796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00725"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="COG0456 acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62237"
FT                   /db_xref="GOA:Q2NDK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK4"
FT                   /protein_id="ABC62237.1"
FT                   /translation="MVDILVYQSRHFSEVEKLWAKVFPGDPPWNHAENAIPEKLRVQPE
FT                   LFLVAEVKGNIVGTAMAGYDGHRGWLYTIAVEPSHQRRGIGSRLLKAAERKLLQMGCKK
FT                   INLQIRADNDAVSEFYRCHGYATEERISMGKRVFDQT"
FT   gene            complement(177789..180353)
FT                   /locus_tag="ELI_00730"
FT   CDS_pept        complement(177789..180353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00730"
FT                   /product="type II restriction enzyme, methylase subunit"
FT                   /note="COG1002 Type II restriction enzyme, methylase
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62238"
FT                   /db_xref="GOA:Q2NDK3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK3"
FT                   /protein_id="ABC62238.1"
FT                   /translation="MRRYAWSAKLPLSILTDFEELAVYDCRVKPEKTDKASVARTAYYT
FT                   FDDYVEKWDEIAAIFSREAVLKGSFDKYATDNRRKRGTAEVDDAFLEEIEGWRAALARN
FT                   IALRNRQLDVRELNAAVQRIIDRVVFLRIAEDRGIEKYGQLQKLSTEKEIYGSLTALFL
FT                   KADDRYNSGLFHFNKGDGSAETLDTFTLDLTIDDKVLKPILKSLYYPESPYEFSVLPAD
FT                   ILGQVYERFLGKVIRLAGSRAIIEEKPEVKKAGGVYYTPAYIVDYIVKNTLGKLLEGKT
FT                   PAQASGEDKRTKNPAPVRVIDPACGSGSFLIGAYQYLLDWYRDAYVSDDPAKYTSGKEP
FT                   KLLEVGKDDWRLTIAERRRILLTHIFGVDIDTQAVEVTKLSLLLKVLEGETADAMARQM
FT                   DFFRIRALPDLGQNIRCGNSLIGSDFYKTYSYSLFSDDDHIAMNVFDWEIEFPFLADTK
FT                   GFDCVIGNPPYLFSAGKDQALYYQKRYQLSEYQTDFYVYFIEKGTHLLKPDGILAYIVP
FT                   DSWLNSANFSRVRHSLLNEWSTAELSIFEYKVFRDANIENTVFFTRNAKPSKKLDIVRF
FT                   TSPTEFETMSTLDVADINRLGLINPRYDKRAERIISRLDEKFANFGSLVRLNRGLHAYR
FT                   TDGYGSSAFGKGPQTKRDKTERSYHADTRLNKTYLPEVRGRDVFWLNHRYSGQFVSYGD
FT                   WLAEPRDPDFMKKPKAVFRKTLGPILSAAFIEEPAAIDQALYIAISKSDDTEALMTALG
FT                   VLTSPLGAWYLRTKYAIYDKLHPWYTKKQLEEFPMIPSSAKIAGLVSDLTAVNSEEVAA
FT                   KLESDKRRLRLKQTILRDKVWELVASAYGLSDKERSFIAANG"
FT   gene            180354..180539
FT                   /locus_tag="ELI_00735"
FT   CDS_pept        180354..180539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62239"
FT                   /db_xref="GOA:Q2NDK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDK2"
FT                   /protein_id="ABC62239.1"
FT                   /translation="MKGGTDVLLDIDRGFFGFEEEFPSSPDTESIVGGLSVSTDLYGIF
FT                   VHNILVGFGVALLVIY"
FT   gene            complement(180569..181423)
FT                   /locus_tag="ELI_00740"
FT   CDS_pept        complement(180569..181423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00740"
FT                   /product="IS511, transposase OrfB"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62240"
FT                   /db_xref="GOA:Q2NDJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ6"
FT                   /protein_id="ABC62240.1"
FT                   /translation="MSERRACRVIDADRKSVRYRSTRGDDADLREKLRELANQRRRFGY
FT                   RRLHILLRREGIMINRKKTQRLYKEEGLAVRRRRSRRRAVGTRAPAPVLALPNQRWSLD
FT                   FVHDQMASGRRFRVLNVVDDVTRECLAAVPDTSISGRRVVRELTELIAQRGKPGMIVSD
FT                   NGTELTSNAVLAWCGEIGVEWHYIAPGRPMQNGYVESFNGRMRDELLNETLFMSMAHAR
FT                   VEIAAWVDDYNRERPHSSLGYATPAAFAAELDKQWPASLRPTGSTTQPIASIALMRKTT
FT                   ARL"
FT   gene            complement(181474..181740)
FT                   /locus_tag="ELI_00745"
FT   CDS_pept        complement(181474..181740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00745"
FT                   /product="hypothetical protein"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62241"
FT                   /db_xref="GOA:Q2NDJ7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ7"
FT                   /protein_id="ABC62241.1"
FT                   /translation="MKRTRFSEEQIIGVLKEAEAGAKTADLARRHGVSEATIYNWKSKY
FT                   GGLEVSDARRLKELESENAKLKRLLADTMLDKAALKDLLAKKF"
FT   gene            complement(182014..184326)
FT                   /locus_tag="ELI_00750"
FT   CDS_pept        complement(182014..184326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00750"
FT                   /product="hypothetical protein"
FT                   /note="COG0587 DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62242"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ9"
FT                   /protein_id="ABC62242.1"
FT                   /translation="MAQGKNILGQAGGTAAAKNATPLAQAQQIDFALHTLGWKAFQDLA
FT                   VAVAAEVLERPVQTFLPSQDGGRDGAFWGTWPGAPDVPEAKSTIQCKFTGKPSKTLKLS
FT                   DISGELSKIDSLKCRGLAHDYVLLTNAGVSGQAEGEMVSAIEAAGATRARVLGRDWLTE
FT                   EIRSRPRLRMMVPRLYGLGDLSQIIDERAYTQARFILSSMGDDLAAFVTTAAHRQSVEA
FT                   LQKHRFVLLLGDPASGKSTIGASLAVGALDDGAIGTVRISDGPGFEQHWNPNEPSQFFW
FT                   IDDAFGETQYQRSRVDSWNSRLKMMHAAVKSGARVLMTSRTYIWNSAKFDLKLGEFPLL
FT                   SNSQVIIDVQGLTDLERAQILYNHIRLGEQPISLKRKLKPFLPSVATNTNFLPETARRL
FT                   ASPYFTGKLSVSRDGLSDFFERPIEFLRDVLIGLAEPERAAVALIFLHGPTGVPSPIAN
FT                   STELTTVYRLTGVPLADVARAMEALRGSLTLLVEAPDGPRWVFKHPTVADAFAEIVSGS
FT                   PEMIELYVRGAKLEKLLSEVVCGTTQLPGASVHIPRSLYDTLIDRMQERELSDRDLLRF
FT                   AAHRGDDSFLERYFGRLEDPLAIAERINSDMYFSAELDFVAKAHARGLADQGLRAATVE
FT                   RVTELCLNWADATPFKDEMVQGLFEAKELHDLSIRFRHEIVNEYGLEPQEWDERLLTGD
FT                   RARHLQDLKEAIQGFAAFGQNDAELLDECAAAEVAIDDYAATLDDDDEPDTPSAPASAS
FT                   KLSPTEQLSVIFEDVDD"
FT   gene            184436..184768
FT                   /locus_tag="ELI_00755"
FT   CDS_pept        184436..184768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00755"
FT                   /product="hypothetical protein"
FT                   /note="COG3593 Predicted ATP-dependent endonuclease of the
FT                   OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62243"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ8"
FT                   /protein_id="ABC62243.1"
FT                   /translation="MFWLSGNIVELAKVTIENFRCYREPISIDIENLTALVGRNDVGKS
FT                   AIMDALAIFFEVAKLDRDDACKTGDPTNVRITCEFDSLQDVILDTDYETNLVSEFLLNN
FT                   DGRLVT"
FT   gene            184827..185093
FT                   /locus_tag="ELI_00760"
FT   CDS_pept        184827..185093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00760"
FT                   /product="hypothetical protein"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62244"
FT                   /db_xref="GOA:Q2NDJ7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ7"
FT                   /protein_id="ABC62244.1"
FT                   /translation="MKRTRFSEEQIIGVLKEAEAGAKTADLARRHGVSEATIYNWKSKY
FT                   GGLEVSDARRLKELESENAKLKRLLADTMLDKAALKDLLAKKF"
FT   gene            185144..185998
FT                   /locus_tag="ELI_00765"
FT   CDS_pept        185144..185998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00765"
FT                   /product="IS511, transposase OrfB"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62245"
FT                   /db_xref="GOA:Q2NDJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ6"
FT                   /protein_id="ABC62245.1"
FT                   /translation="MSERRACRVIDADRKSVRYRSTRGDDADLREKLRELANQRRRFGY
FT                   RRLHILLRREGIMINRKKTQRLYKEEGLAVRRRRSRRRAVGTRAPAPVLALPNQRWSLD
FT                   FVHDQMASGRRFRVLNVVDDVTRECLAAVPDTSISGRRVVRELTELIAQRGKPGMIVSD
FT                   NGTELTSNAVLAWCGEIGVEWHYIAPGRPMQNGYVESFNGRMRDELLNETLFMSMAHAR
FT                   VEIAAWVDDYNRERPHSSLGYATPAAFAAELDKQWPASLRPTGSTTQPIASIALMRKTT
FT                   ARL"
FT   gene            186641..186970
FT                   /locus_tag="ELI_00770"
FT   CDS_pept        186641..186970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62246"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ5"
FT                   /protein_id="ABC62246.1"
FT                   /translation="MQRHHRFVTYVTPLIAEWIRKQSDERRVSASIVIGDCIFEAWHRA
FT                   TEADLRTPATDPVRQNIFITVALDALLTHHPHADLREKTVAAYQRRLERLGIVAPRPQG
FT                   GDDEA"
FT   gene            186960..189299
FT                   /locus_tag="ELI_00775"
FT   CDS_pept        186960..189299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00775"
FT                   /product="TraD"
FT                   /note="COG3505 Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62247"
FT                   /db_xref="GOA:Q2NDJ4"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ4"
FT                   /protein_id="ABC62247.1"
FT                   /translation="MKHNLVNFTRGSQLLGHFGFMFAAGLKGPLIVTILVAVGLLYWEV
FT                   SGALDDHQIYLLWMHVYSSAYAFMEFDPDKLVNLKLADGSMVAFPISVVTDYPPMREAV
FT                   TLFRSTAVGALWLAALILAPLFLLFWWVAERFGERSKQKKHVRGAELATLSELKREIER
FT                   HNRDARSREYGETMGWKWRLAGSTYLRDAGFYAPAHLARVSWPWRLEQSHAMLVGTTGT
FT                   GKTVVLTELANEIRQRGERAVIFDLTGAFIETFYEPERDIILNPLDARCPAWSVFNDCT
FT                   TRAEFHAAAESLVPHDGGGAEQFWMLAARTLFVETCLKLAEAGRGTNAALAHELMNADL
FT                   SDLHQLLEDTMAGPISTPSAARMAESVRAVFNVNAKALQMLPEEGVPFSVREWVNGAAK
FT                   PGSILFLSARYIDMSVLSQLLTLWLDTSINTLMAGERSRDLRLWFLIDELGALHRLPSL
FT                   EKGLQTARNFGGAIVTGIHAFAKLKDVYGENMAMTLSSLARTKLILGTADRETATWCSD
FT                   VIGHREVREMEEGYSYGYNNARDAVSLTPRRQVVPLLLPDELMRLKNLHGFIKFPEGFP
FT                   AAPVVLQPRNWPRVAEGFIAREIPKMPKRAASASGDAGTMTQPTRASETSDNDGDPRRM
FT                   MDKHDQSNRPAKRPRKDQQKEPGRDRRSTSAKQALPEQTKARSPRDGGQRGALPAPPRP
FT                   AQSELPLASKTDEDRDRERETAPSKRSDVPDPATHQRAQDARGKADQKMQEEQQKSLLG
FT                   GAAKQGKGADRDHDHDHDLGDYDPEM"
FT   gene            189346..192258
FT                   /locus_tag="ELI_00780"
FT   CDS_pept        189346..192258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00780"
FT                   /product="TrwC protein"
FT                   /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
FT                   alpha subunit - helicase superfamily I member"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62248"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ3"
FT                   /protein_id="ABC62248.1"
FT                   /translation="MLSVANVRSPTAAASYFASDNYYASADADRSGQWIGGGAKRLGLE
FT                   GKVEAKAFDALLRGELPDGSSVGNPGQAHRPGTDLSFSVPKSWSLLALVGKDERIIAAY
FT                   REAVVEALQWAEKNAAETRIVEKGKMVTQATGNLAVGLFQHDTNRNQEPNLHFHAVIAN
FT                   VTQGKDGKWRTLKNDRLWQLNTTLNSIAMARFRVAVEKLGYEPGPVLKHGNFEARGISR
FT                   EQIMAFSTRRKEVLEARRGPGLEAGRIAALDTRASKEEIEDRATLGKQWSETAQSIGLD
FT                   LTPLVDRARTNALGQSMEATRIGSLVERGRAWLSRFAAHVRGDPADPLVPPSVLKQDRQ
FT                   TIAAAQAVASAIRHLSQREAAFERTALYKAALDFGLPATIADVEKRTRALVRSGDLISG
FT                   KGEHKGWLASREAVVTEQRILSEVAAGKGNSSPAIEPQKAAASVQAAAATGQGFRLNEG
FT                   QLAAAELILTSKDRTIAIQGIAGAGKSSVLKPVAEVLRDEGHPVIGLAIQNTLVQMLER
FT                   ETGIGSQTLARFLRGWTKLLGDPGNVALRTEAQASLKDHVLVLDEASMVSNEDKEKLVR
FT                   LANLAGVHRLVLIGDRKQLGAVDAGKPFALLQRAGIARAEMATNLRARDPVVREAQASA
FT                   QAGDVRNALRHLKSHTVEAKGDGAQVAAETWLALDKETRARTSIYASGRAIRSAVNAAV
FT                   QQGLLANREIGPGMMKLDVLDRVNATREELRHLPAYRAGQVLEISRKQQALGLSVGEYR
FT                   VLGQDRKGRLVEVEDKRGKRFRFDPARIKAGKGDENLTLLEPRKLEIHEGDRIRWTRND
FT                   HRRGLFNADQARVVAIAGGKITFETSQGDQVELKRDDPMLKRIDLAYALNAHMAQGLTS
FT                   DRGIAVMTSSERNLSNQKTFMVTVTRLRDHLTLVVDNAEKLGAAVARNKGEKASALEVT
FT                   GSVKSTAAKGSGVDQLKPEEANKAEKELTRSKSKTLDFGI"
FT   gene            192900..193385
FT                   /locus_tag="ELI_00785"
FT   CDS_pept        192900..193385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00785"
FT                   /product="hypothetical protein"
FT                   /note="COG3236 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62249"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ2"
FT                   /protein_id="ABC62249.1"
FT                   /translation="MIDEIRFYRASEKPYGAFSNLYRRPIEFEGEVFATSEHAYQAGKA
FT                   RKPEVRKWLLAAPSPALLAMAAHGLYYWDIAPGWSKTKFDRMREVLRAKFTQHSDLQDL
FT                   LLSTGEARLVESATVDNEVNRLWGEVNGSGRNMLGILLMEIREDLRLESAGYLEAAE"
FT   gene            complement(193364..194341)
FT                   /locus_tag="ELI_00790"
FT   CDS_pept        complement(193364..194341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00790"
FT                   /product="hypothetical protein"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62250"
FT                   /db_xref="GOA:Q2NDJ1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ1"
FT                   /protein_id="ABC62250.1"
FT                   /translation="MTKGIQKENMEIATQLQYRFDVAGTGLTVLDRIYTDGDLADEALG
FT                   GSCGNVLLSLAMLHRNVVPVITIGDDDEGRRLVAEFVEAGAIVDHIYRKAGVRSPIIAQ
FT                   DVDTASGVHGFRFVCPDTYESLPQYEPISESEAASALHILTQCSVFYADRLSSGIIHAM
FT                   RAAKLSGAIVFFEPSDVDHDELFREALELTSILKYSVDRLGDRLAELEYDCIRIVTHGA
FT                   DGLEVHHDGSAVWCSAVSAPAILDTCGSGDMVSVGVIDWMLSSGVSAESLDVTYLLEGV
FT                   LAGQRLAAENCAFAGARGLFKQCGPAYAREVLRECPDRYSAASK"
FT   gene            complement(194338..196278)
FT                   /locus_tag="ELI_00795"
FT   CDS_pept        complement(194338..196278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00795"
FT                   /product="hypothetical protein"
FT                   /note="COG0561 Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62251"
FT                   /db_xref="GOA:Q2NDJ0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDJ0"
FT                   /protein_id="ABC62251.1"
FT                   /translation="MNTPIFTEKLDALTATLDLMASYDVGGIATALARGCDRHALAIGS
FT                   GGSAIAAEYLLRCRDTLGLGPTTVATPMQGVLDHHRLDATDAWIFSAGGDNPDACAIAQ
FT                   ALTDREAATINLITRNPHGAAAAIVTRSGGTVHALPVADAKDGYLATHSVFAMTTALLL
FT                   ASHFVSREPDTVNEALGRVASLLLASRDAGNRDLLVKRWTPIRATDTIIITADSSLRPV
FT                   ASLLDTSLWEASLCQVQTTDFRNFAHGRHAWLHHRPDSTIVLALTAMNSRIAWSAIETV
FT                   LPKNVRRNVLDYNAGGRLDNLLGIVDGLSHIEAIGEVLGVDPGKPGLGDFGRAIYDDRS
FT                   LEVTAMELRPRIRHKLAAIAKADRPMADEPGLVAIGHHHLETLAAATVGGAVFDYDGTI
FT                   VTTEGRFSPPSQEILDELIRLHRAGVCLGIATGRGGSAGEDLRKVLPPDVLSSLLVGYY
FT                   NGGHLRTADIDIKGDPPRQNPAIAATAAWLDERDDLFASKEFKSGPVQIGIDMENLLRP
FT                   FRFPLDMAECPLVSSGEVRISGSGHSFDVVPSTSCKSAIVDAVRRKINPDAAVLCFGDS
FT                   GSRFGNDYTLLAHPHGISVGEVCGAADGCWSLFGRALTGPDALLKILRALVKCPTGEIR
FT                   LDTAALALDTP"
FT   gene            complement(196275..197375)
FT                   /locus_tag="ELI_00800"
FT   CDS_pept        complement(196275..197375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62252"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI9"
FT                   /protein_id="ABC62252.1"
FT                   /translation="MRDHWTNCITNFDDDVGVFVADYFADESRKVLLVAAAGFDPRSRR
FT                   VSKLLADTLGDRLSAYYIREERPGASEELITRAEANEAALREIVPDSMVFTIPVFADDG
FT                   APVGGARLVTMMAENPVAEGVTDVILDLSALSIGVGFPAAKLLLLDCEEGKTRTFHLMI
FT                   VSNPELDDRITSVPSDRISPVKGYAPEVGLSTLDVAQVWIPQLARGRASTLTQIDAASE
FT                   RWYKICPVLPFPSRNPRRADDLLTEYQNELANEWEIDPRDIVYASERNPLDCYRTLSML
FT                   KERFDRTMEGTYEPRMVLSPIGSKVLAAGAMMAAIEHEMAVQYVETESYNFANAEPSPD
FT                   DPADMMVHLVLSGPLYEGYLAREAGE"
FT   gene            complement(197368..199287)
FT                   /locus_tag="ELI_00805"
FT   CDS_pept        complement(197368..199287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00805"
FT                   /product="hypothetical protein"
FT                   /note="COG1219 ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62253"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI8"
FT                   /protein_id="ABC62253.1"
FT                   /translation="MANPFLRRATEYVRDDASFLSIVSPTPLTTFLAKSQHKDDVFEVP
FT                   VRIIGSPGSGKTMLATLAEFKMVEAILKDLSNPTNRTLAAALAKAGFLESEVPRVAAVR
FT                   VPMESEYREFWELPYEPAVRTKLAFWLVQARAMLGLIRNLTANRTRGLDGIRFVPRADY
FT                   EAHLEQIGGLTAEGVRDRALAVQRAIYSIGAGLRPPKLADLPEDATAPYAPFDAIQRVS
FT                   IDWRGKEIDVSPLVMLDDVHALHHDQLEAMFETLSHREMRFGRWMMMRLDALSPGAVLR
FT                   SPGAQPSHGRTTGRDFVDIRMQVNEEGKKGAARSQFRTMAKDMAKRYLPLVETLRNRGA
FT                   TDIERLLPSEPPTVSAGQLRTFAEKVDREQSKLGVSSVRRAEIDQLVADFLGRSASYDN
FT                   GPEVALAMVRILMHRYAVRIARAAPSLFEEFDPDPKTPLKADADVAHGARLHLHHELGR
FT                   PFHFGIDDICDASNENAEVFLQYAGELVANIETRAIRNEELPLPSRVQQKVLSGKARKI
FT                   MEGWAFPQATRVRSLVDTIAKDCLAESQLPNAPLGAGANAVAILEEEMQTLPLDDELGA
FT                   VLKHAIANGAITIEREYGQGGKLWALIELTGTVSLVHGLTYNRGGFLPKRVGYLREAAG
FT                   LTDA"
FT   gene            complement(199293..200474)
FT                   /locus_tag="ELI_00810"
FT   CDS_pept        complement(199293..200474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62254"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI7"
FT                   /protein_id="ABC62254.1"
FT                   /translation="MRTAVYCSLDMINALALNLIATVMNWDNERATAEYAWLRLMSSMK
FT                   YDGYSDFRAGVRFLESLVSWLRQFEQQDREAAYAFVQERMVYISTAEMQRIIENFIPET
FT                   VTPYLRKAVAAELGIKPYEVWRTQAGAKAFLEHQRRCLFVGLSDGSRIDVLRRANSGRL
FT                   SQEQVVPMLNVDNEKWKGLGKDLRGELGDDARFQDVYLIDDFTASGTTFIRFPDGEPKG
FT                   KLAKFEQNAQEARKALKDDFPLADGYTLHIHHYVSTAQACQALEGRVAEAGEKLTDPSF
FT                   GEAHITEGMRLPAVLPIGTSGTEDAMVAVAPSDEPYFGLCGTYYDHNLFERLEKHCKEA
FT                   GQVDMRYGYANCALPLVLEHNTPNNSIPILWAETQGKLGHPMRPLFRRRDRHG"
FT   gene            complement(200714..201349)
FT                   /locus_tag="ELI_00815"
FT   CDS_pept        complement(200714..201349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00815"
FT                   /product="prophage MuMc02-like, peptidase, family S24"
FT                   /note="COG2932 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62255"
FT                   /db_xref="GOA:Q2NDI6"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI6"
FT                   /protein_id="ABC62255.1"
FT                   /translation="MEHVREELDRLILKGGYGYASISRLLGRNPAYVQQFIKRGSPRKL
FT                   DDEDRKTLACFFGVDEQLLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGF
FT                   DERWLRHLTSAKSASLSIVGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDA
FT                   LVVKRIAIKPGGRQITIASDNPAYPTWHDMDRSEVHVVGRVIWFGRAL"
FT   gene            complement(201642..201836)
FT                   /locus_tag="ELI_00820"
FT   CDS_pept        complement(201642..201836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62256"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI5"
FT                   /protein_id="ABC62256.1"
FT                   /translation="MTLTRDQELWGMALWVEKQHGKNGAAFIDDKIGQLSRAKDNQGVA
FT                   LWQDVARRLEQLTLRRRPS"
FT   gene            complement(201833..201973)
FT                   /locus_tag="ELI_00825"
FT   CDS_pept        complement(201833..201973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62257"
FT                   /db_xref="GOA:Q2NDI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI4"
FT                   /protein_id="ABC62257.1"
FT                   /translation="MVLMRDWRSDEERARDDANAWKLELEAVLIGAGLLLIYATTFGSL
FT                   F"
FT   gene            complement(201964..202284)
FT                   /locus_tag="ELI_00830"
FT   CDS_pept        complement(201964..202284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00830"
FT                   /product="nuclease"
FT                   /note="COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62258"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI3"
FT                   /protein_id="ABC62258.1"
FT                   /translation="MVRRTCVVDGDTIWLEGVKIRIADIDTPEISQPRCDNEYALGIKA
FT                   RDRLVALLNEGEFTLWPIGDRDEDQYGRKLRVVIRQGRSIGDQLVAEGLARTWTGRKEP
FT                   WC"
FT   gene            202626..202835
FT                   /locus_tag="ELI_00835"
FT   CDS_pept        202626..202835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62259"
FT                   /db_xref="GOA:Q2NDI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI2"
FT                   /protein_id="ABC62259.1"
FT                   /translation="MSDPDNTPTGGKQDWEGFREVDRAIAENRLTSYTWKKTWADPWGK
FT                   VGLILFSVLFLAFVIYVIIYDGMI"
FT   gene            complement(202837..205539)
FT                   /locus_tag="ELI_00840"
FT   CDS_pept        complement(202837..205539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00840"
FT                   /product="TraG"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62260"
FT                   /db_xref="GOA:Q2NDI1"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI1"
FT                   /protein_id="ABC62260.1"
FT                   /translation="MVEIFTTGGGEYIVNVLNAVAAWTGAGGYKSLIQVALVMGFALAV
FT                   IVVAFNQDWRAWLNWFLGATLIYMCLMVPRMDVQVTDRVNPSLAPATVANVPLGLALMA
FT                   SFTSQAGDYLTRSAETVFGLPDDLNYSKNGMIYGARLLEATRSLRIADPEFAANFDEHV
FT                   RQCVFYDLLLGRYSMKEFSESNDIWATIAPGSAARAQKFLTREADDRVSASIVTCREAY
FT                   TALSNQWAGMIDDMTLVAGRQLYPKQTEALAKAKLIADLPVAYQYLTGVSKDASSIFRQ
FT                   VLTINAMNQAMHGFAGASGASSVDVFAQTRADIQTERTYSSIAHNAMKWVPILNVVLTV
FT                   VFYALFPVLFPLFLMPRTGPIALRGYVTGFFYLAAWGPLFVILHMILMLKGAGDVAAAG
FT                   GASGLTLATFSGMTDVNNDIGILAGYLVASIPFLAGGVARGAMAISGQATSYLNPSQNA
FT                   AEEAAREASTGNLSLGNTSLENSNVFSRQFAQASLAPNIAYGAAQSRGFADNGTQTTSF
FT                   PQAEFATVPTSSYPFTPTLGQDFSSRLATMASQSRGQSETFSNLAQQSTSSAVTRFSEL
FT                   RDAYTRSRSNESVSGVSTSDSIGSAFSEVDNASKTLQQQFGLSRRAADDITVSWFLNGD
FT                   AGLGVKGERGSVKGTLGLKGGRNQTWTDSDIGIASEDRSRIMGALRQISDSRSWSSTRE
FT                   GFLRETSSSSEALVSSSSAGITTSITEAQSYTREARRAEEIASRLENQASWYESANVAG
FT                   TLNLSQAYREWGMAEIDANRDYYGPVRFDDIDFQMSARGQQLQVRFVESYADQLNADIA
FT                   DDLVLPPFAPVARPAVESADGVRGSVRLGGVQGSLGEPSSEREEIARDVDRVQQQGERR
FT                   VGTVKGYLDGKTRDAKGASAEAADDVKEW"
FT   gene            complement(205547..206983)
FT                   /locus_tag="ELI_00845"
FT   CDS_pept        complement(205547..206983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00845"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62261"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDI0"
FT                   /protein_id="ABC62261.1"
FT                   /translation="MITSIRNAALTLAAASMIASPLAANVGDSMDRFMDDMGAAANVTG
FT                   PTAFEGQSAGYYSLGNVWTRFPQKTTSIANLQLPRARAGCGGIDIFAGSFSFINASEMV
FT                   ALLKAVANNAVGFAFSLAIDTVCPECNKIMQEFSQKAQLMNNLSINSCEMAQGLVGGLW
FT                   PKGDLADKAICEAIGNSEGIFTDYAAAKHGCGTRGQRASTNEGAGADYADVNPGVARNY
FT                   TWHVLKKSAFFNPGGTFDRELAEYAMTLIGTVIYVPPKDDEAGKFVPFAGDASSTLVSA
FT                   LLDGTQGQTVRVFRCDETDLCLNPTFEQMSLANAKAIRPRVALLIGNMVDAIRADTAIG
FT                   NAEKELLQVASVPLYKILTVQAAYGRGMPTDDRDTLAEIASIDLLYAILDRIVSEAGRS
FT                   MASFIAADEAKLAIWRGQVAEVRTGLVQRQATGQAKVSAIMQIIEKTAMIENALAASMS
FT                   PSMSAALDWSRGLQSRSIVP"
FT   gene            complement(206973..207785)
FT                   /locus_tag="ELI_00850"
FT   CDS_pept        complement(206973..207785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00850"
FT                   /product="hypothetical protein"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62262"
FT                   /db_xref="InterPro:IPR014111"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH9"
FT                   /protein_id="ABC62262.1"
FT                   /translation="MTHLYLLTALALGFAALPAAPALAQERQETASTTAADALYCEERR
FT                   LGYWFYCVKPVPAEEPQAPEIEPVAATQELDAITAELRELKARAIVYPTEANVAAYIRL
FT                   QRAQLDRASLFSDVWQRAIWQDPELDYTLERPVGALAKKQWQDARSAERDSVMARLSQR
FT                   YGLFYFYSSTCAPCEVMSPIVKGVAERWRITVRAISTDGGPSRHFPDYKVETNQRARLG
FT                   LEGKATPALVLWDSVTKRPIPIGYGVLSADELQDRIYLLTSKEAGHDY"
FT   gene            complement(207782..209506)
FT                   /locus_tag="ELI_00855"
FT   CDS_pept        complement(207782..209506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00855"
FT                   /product="TraN"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62263"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH8"
FT                   /protein_id="ABC62263.1"
FT                   /translation="MKHPIKLAVTAFTALLLTASAAAQQQDAKADGKAFAESLRGEAQQ
FT                   AAQQQPNTATLPNYDRNAVRGIETLAQDPDRIEGNAAAVASGHQGYRAMRDSVANRARF
FT                   DPGEIEDVIARSLAINESPLDYTSGMAIAGGQGSCVPLPPGSGSAGTYTATCNTGTRID
FT                   QSAGQCAVPLATTVSQLPQYHYLCNRFGDFNGSGEPECAGFDGYSCRVTGRRDTCLQWS
FT                   SSGGRPWCSEPGDPITELTCDEQVPGQTPYMVTTATTVTTTPDESQCSGFADNGDCTLD
FT                   TEICTDADPQTRIVNGVSVTRPCWEWQRSYTCTSRETATDCSDIESQGTCRFLREECLT
FT                   DEVPCETWERIYECPLPATDSTTQYVCDGDVYCIDGSCETIERTANDEFKDAAVALHAM
FT                   DEARGQFDPNTLTLFRGTRNTCSSKVFGVLNCCKGKGFPLIPGISLLVALGCDREEVLL
FT                   HQRDAQGLCAYVGTYCSDKFLGVCLTKKKVYCCFESKLSRILQEQGRKQLPKPWDKPKE
FT                   EQCEGFTLDEFARLDLSRMDFSEVYAEFTDAARLPDELETSILIQQKIDDYYARGGQ"
FT   gene            complement(209503..210258)
FT                   /locus_tag="ELI_00860"
FT   CDS_pept        complement(209503..210258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62264"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH7"
FT                   /protein_id="ABC62264.1"
FT                   /translation="MRNAFHLLVLISLATAAAFAAASAQDSPPDLDLAEIRARASEHAQ
FT                   DAEALATSVRTRADTLAEDARTTQQAALDNRAAYVKEAQASAGVGPLDLDGMIRSAADA
FT                   EVAAMGEVPRFIAFASLSMPEPSLKALVRDVTRAGGVTVLRGFPQGDSAAFKKRLAAIW
FT                   RDGSEAGALGIDPRLFRTFDIAVAPSFVMVASDFSPCDGFDCTDTLPPHDRIAGNVSVE
FT                   DALETFADGGGPGAQLARLHLARLRDQRP"
FT   gene            complement(210255..211268)
FT                   /locus_tag="ELI_00865"
FT   CDS_pept        complement(210255..211268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62265"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH6"
FT                   /protein_id="ABC62265.1"
FT                   /translation="MSSFRAFLVLFTAALSLAFSSPASADAGPGKCTGQFVNPITDICW
FT                   SCLFPISIGGLEIWPSNRPDPDNPDLPVCLCGLRSGIAMGFWEPVRLADVSMKPWCFVN
FT                   LGGMKLDPGFDIGFRSISGPSAVGGASQYYSSWHVHWYAYPLIYWMEIVADFLCLEPGS
FT                   IDILYISEIDPLWQDSELTAIINPEAVLFANPLALAACAADCAASTANLPLDEMFWCAG
FT                   CQGSMYPMNGNVSASIGHVQASRLVLSRFAYKLHRELVSWGTMGSKGLCGKYLMPVMRK
FT                   QQYRFQATNPNPATKGRYACPPVGASTTFQSPGQVIPAIGEDMGYLVWRKRNCCAL"
FT   gene            complement(211265..211897)
FT                   /locus_tag="ELI_00870"
FT   CDS_pept        complement(211265..211897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00870"
FT                   /product="TraW"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62266"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH5"
FT                   /protein_id="ABC62266.1"
FT                   /translation="MRPLLPLGALLLAALPASLQARDYGQRGAVFPVIERDLLEQIHTR
FT                   LAQMEKSGETAKLNQELKRRTIARVNRPDPVAGLIRAHESRSWPFDPTITLAADIREAK
FT                   GELIHAAGTRVNPLDSVALRVPLLFLDGDDPAQIAWALRQDPNAKLILVKGAPLELMKA
FT                   RQRRFYFDQGGNLTEKFGIRAVPARVRQNGRVLEVSEIALPPRKAKP"
FT   gene            complement(211897..212403)
FT                   /locus_tag="ELI_00875"
FT   CDS_pept        complement(211897..212403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00875"
FT                   /product="putative F pilus assembly protein traF"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62267"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH4"
FT                   /protein_id="ABC62267.1"
FT                   /translation="MSLPRSLRRPLLLSGLVLLPLAWAPLDAFSKDHAFLINASPSLPN
FT                   WAFWLDKKAAIQRGSLIFFEPPRSELVERHFGEGPQMFGKRVLGMPGDVVRHEGDAVFI
FT                   NGRKVASLLKVTRLGVPLTRGPEGVIPEGCYYTGTSHPRGLDSRYGEIGFVCRGQILGS
FT                   GRTIL"
FT   gene            complement(212400..212780)
FT                   /locus_tag="ELI_00880"
FT   CDS_pept        complement(212400..212780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62268"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH3"
FT                   /protein_id="ABC62268.1"
FT                   /translation="MDRLNLPLRQLGPKLLAVAVLVAALLWGAWLTQQVTSSPKQRIVT
FT                   VRLAETIGTFVEEAARADADPAVVQAASLAYLKAAEAAVADMGRDGRVVLVAEAVLAGA
FT                   AEDATPELERRIADELAGEKQP"
FT   gene            complement(212773..213192)
FT                   /locus_tag="ELI_00885"
FT   CDS_pept        complement(212773..213192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62269"
FT                   /db_xref="GOA:Q2NDH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH2"
FT                   /protein_id="ABC62269.1"
FT                   /translation="MMVLETTTLVDRVPLPTAKRAREKHRAVNWLALFQGTCLVLLEAA
FT                   GFAVSTLLLVLGLPLFVFLLIAGWDLTALFAQLGNLADHYRTAEPIARHLFAQDLQIAF
FT                   LSSAGGLALLRLPSFLRRLDRRLCRQNNEGYPRHG"
FT   gene            complement(213189..215738)
FT                   /locus_tag="ELI_00890"
FT   CDS_pept        complement(213189..215738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00890"
FT                   /product="putative inner-membrane protein traC"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH1"
FT                   /protein_id="ABC62270.1"
FT                   /translation="MNRSLASARDALLSGLFGDARQADHARPSFALDMLSDWLPYRVYD
FT                   EGPGLYRNAHSKGFVLEVTPLIGADERTGEILGQFFSESLPQGACLQVLNFASPRIGAI
FT                   VGPWFGPRYEQGGIYEAIAKARTNRLYDLVWHSGSAHAPFHARHVRLVLSLGVPVPGSV
FT                   TDAELTECRDGMAGMLNSLGLASNRLEPAGLLALIDELTSPTTARELDLTHWNREDTLD
FT                   VQAIRRDIELEVEDDRLILRTERFRETGRSRDGIPQMGTCYPDRFDVRHYGVRSTPERW
FT                   APWECARLIGDMFTDKLRFPCPAATMLCLHYPDQEAASARAGYKFMRTTSLSETRSARF
FT                   LPRLSEQSAEWKHVQAELQAGKKLVKLFYGLTTISPLGDGDAHERTVKAIYKAAGWDLA
FT                   DERFLQLQGLVAAFPLSLADGLVHDLARLKRFRTMLSTTAANIAPLQGEYLGGAIPHLL
FT                   LLGRRGQPFWWSPFENTAGNHNIAICGKSGSGKSVLLQELCTALRGAGAKVVVIDDGRS
FT                   FEHSVKLQGGRFVEFTLASGFSLNPFSMVDDARAHEDEDYRLDCFAMIKAIVGQMARPS
FT                   AAPLDTERGLIDRAVTQVWEALGSGGAIDDVAHTLHQSENEAGKDLATAIAPFCRGGSY
FT                   AGFFSGKASFALEDDFTVFEMSDLASREELRSVVLSAIMFMTGQAMTRSSRSTKKLLLI
FT                   DEAWAMLKGGSMGEFVETYARTARKYGGALATATQSLNDYYKSDGARAALENSDWMLVL
FT                   QQKPETIADFRKEARLDMDDRTETLIRSLKRSGSEYSEIYLKGPEVEAVGRLVLDPLSA
FT                   TIFSSDPDTYAAIRRHVESGMPLERAVALVAGVEGGA"
FT   gene            complement(215735..216349)
FT                   /locus_tag="ELI_00895"
FT   CDS_pept        complement(215735..216349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDH0"
FT                   /protein_id="ABC62271.1"
FT                   /translation="MSGRHFRAISAASLAASIAGCATLGGNVKGDFDCRAPEGSCAPTT
FT                   LIDSAAIGEAGTGMASRAATSQPPSLAGPRQADARSLRIVIAAYRDAAGRDHEARVVHV
FT                   ALPDHPAESWHAPRSRGEVLRALGRAGNDAQTPPPPTDPQNAPVFNPLPLQLPDVLVIP
FT                   SQAPEAQPGVPAPVTGAPGRLPSPGWVPHPLSPGEPEGESQ"
FT   gene            complement(216346..217215)
FT                   /locus_tag="ELI_00900"
FT   CDS_pept        complement(216346..217215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00900"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62272"
FT                   /db_xref="GOA:Q2NDG9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG9"
FT                   /protein_id="ABC62272.1"
FT                   /translation="MNFSHHRPGLKARAAHISLAAASAAALLTSGVAVLTAMPAQAAIA
FT                   RDVVQALKLRLPKTPIDALDCTSLAPWCEVVSGETLFYTDEAARYLFVGRLYDLEERRD
FT                   VTATRLLELNPDLLAAGAARAAGRAEASHSEAAPAPAKTKVDLSQLPHEGAIRWGNPKG
FT                   PRLVVFSDFQCGYCKKLTGALEQAGVLVEERPISIFGAASRRLSESVLCASDPVAALHA
FT                   AYTGKHVPRPASCKAIRALDANEAFAKANGFAGTPVIVRASDGAVMHGYRDAATLNRFA
FT                   NQRAGAGQ"
FT   gene            complement(217212..218519)
FT                   /locus_tag="ELI_00905"
FT   CDS_pept        complement(217212..218519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00905"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62273"
FT                   /db_xref="GOA:Q2NDG8"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG8"
FT                   /protein_id="ABC62273.1"
FT                   /translation="MADTDTRAAPAEQPRDESRSEARRDLNKTVAQRQKLLLAGIGGVA
FT                   LIAGSMFIFGGDDAEDGEGAGSTTIETGALVNRNLSQREFVATYGNRLDAQGRAIKDLQ
FT                   ESQLPKASIEQELETLRGENARMLSDGQAAIDAISAENAALRSELETQRAYPPVAPATP
FT                   LDPRALGAAPGAAPAALDPSAGPMAEPKASLLSFSGEKPGTAGKKVDANAPPLLLEASR
FT                   DYLPPNSYAPATVIVGVDASTGVTSQSDPLPVVLRITGPARSVLRGNRLLTTDLTGCLV
FT                   NGAARGDLSAEKVYVKLVRMTCAQPGGRFAVSEVKGFIAFAGKSGVRGRVVSREGSLVS
FT                   QALLAGIVGGFGRGFSANANGIFAGQVGSDGKREALSPTDILAGGFGQGAGEAADTVSK
FT                   YLIERAEQYQPVVEMPTGIEVEIVFLDGVHVRSTDQ"
FT   gene            complement(218519..219274)
FT                   /locus_tag="ELI_00910"
FT   CDS_pept        complement(218519..219274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62274"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG7"
FT                   /protein_id="ABC62274.1"
FT                   /translation="MSFLARPLPAALTAAALAAASCAFATAAHADQFVEAADGAAIDCV
FT                   LARGALTRVALVNDGFANVSKMASGYPYNDFEVTHEPVRGDIYVSVPLQYASAKVSFFA
FT                   TSSAGHVYKFACKVEGGEASQLFVTNPALARPDAAEWEGQAPTRDEAAIRLIEAMASDA
FT                   VLPGFRARAELSRPRRTDSLEVQQVAEYDGAELTGQAFTLRNLGPTAIALSSEREAPAG
FT                   ALAFAFGRDTLAPGETTQAFLVFAKGGLE"
FT   gene            complement(219271..219840)
FT                   /locus_tag="ELI_00915"
FT   CDS_pept        complement(219271..219840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00915"
FT                   /product="putative conjugative transfer protein TraE"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62275"
FT                   /db_xref="GOA:Q2NDG6"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG6"
FT                   /protein_id="ABC62275.1"
FT                   /translation="MKHEFAYEEAQRHLRQRNRFAALASVLGLTSLLAVGAAATREESV
FT                   ILVPVTSERLTLGSDATDAHYLELVTRDTALMLLNRAPESLDYWMEQVLKVADPAAHGS
FT                   FKAELVKIVDEQRGSDISQAFVISRMEVDPQALTAVVTGTLKTFVGAQVIASQQRSFEF
FT                   SWNRRGLSLGLTGFRQLPNENEEEGQ"
FT   gene            complement(219853..220140)
FT                   /locus_tag="ELI_00920"
FT   CDS_pept        complement(219853..220140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00920"
FT                   /product="TraL"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62276"
FT                   /db_xref="GOA:Q2NDG5"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG5"
FT                   /protein_id="ABC62276.1"
FT                   /translation="MADRYLVPRRLDDPELIGFWTIDEFAGLLVPFAWGILAQHIIIGT
FT                   ALSGLTWFALRKAKASGAGSKLVHAAYWYLPGSFLGLKATPPSHCRLLAG"
FT   gene            complement(220167..220493)
FT                   /locus_tag="ELI_00925"
FT   CDS_pept        complement(220167..220493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62277"
FT                   /db_xref="GOA:Q2NDG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG4"
FT                   /protein_id="ABC62277.1"
FT                   /translation="MTKAITLPRQSAKGIRARDYILPAAIALACAGAAYAGADTTFDPA
FT                   LQKFTDFLEGSGGKIITVLSLAGGLIALASGRFALGQVAVPVGVGIGVGTGVPIVTSVV
FT                   TAVI"
FT   gene            220855..221346
FT                   /locus_tag="ELI_00930"
FT   CDS_pept        220855..221346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62278"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG3"
FT                   /protein_id="ABC62278.1"
FT                   /translation="MTNMALFAEQQVRADLARLLLAAVEASGRHRCDIARDAQIHKDAM
FT                   RRVLAGERSASLGEALRILAASGVAPHAHLLLFLVSSGDHAIAWLQSDLAQFFEDFSGE
FT                   LPSALERVLGNQVHEVKPRWAKGTAQRVARLLSDHIDELERKDALLGDVFTVADGGHRG
FT                   "
FT   gene            221327..221560
FT                   /locus_tag="ELI_00935"
FT   CDS_pept        221327..221560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00935"
FT                   /product="hypothetical protein"
FT                   /note="COG3311 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62279"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG2"
FT                   /protein_id="ABC62279.1"
FT                   /translation="MEAIVGEEIDKGSTEPRQVTRLIHLPEVQHRVGLGRSTIYRWMAE
FT                   GKFPGPVELGGYSVAWEERAIDVWISQRLDSA"
FT   gene            221918..222772
FT                   /locus_tag="ELI_00940"
FT   CDS_pept        221918..222772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00940"
FT                   /product="transcriptional regulator, lysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62280"
FT                   /db_xref="GOA:Q2NDG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG1"
FT                   /protein_id="ABC62280.1"
FT                   /translation="MAEAGGVRAGAATLSLSPSATSRRIAALEAFLDIDLFNRSNGGLQ
FT                   LTAAGMTYRNAAEAAIEALGRVQTMGTPKRDATLTVAASHSLALRWLIPRSGDFALTTG
FT                   VRLDVRPTRDPNILRSGEAQLAIWASFQDPDLLSENVLEVLGCPVSAPSLIEEQGGELG
FT                   EADIARLPLLAPRLPENLWPRWLALAGLDHEEIDVRLFDTNVLAYEAAAAGLGVALAIP
FT                   FMCEEHLARGSLVPCGQSRLIGEHYRLYRRRSRAGPSAPETHFIHWARREARKAGDRFA
FT                   AIG"
FT   gene            complement(222781..223209)
FT                   /locus_tag="ELI_00945"
FT   CDS_pept        complement(222781..223209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00945"
FT                   /product="thioesterase family protein"
FT                   /note="COG2050 Uncharacterized protein, possibly involved
FT                   in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62281"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDG0"
FT                   /protein_id="ABC62281.1"
FT                   /translation="MTLPDTPEAMRAHIEREGVAASPFTSFLGLEVVRCWQGTCELALT
FT                   VRPDLTQSHGTLHSGVLSSLADIVCGFAAVSQCGAVVTANVTTHMLGPARVGDRVYANA
FT                   TVKRAGKRQVVVTADFHASNGAEERLIVTASATLVRIG"
FT   gene            complement(223206..224207)
FT                   /locus_tag="ELI_00950"
FT   CDS_pept        complement(223206..224207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62282"
FT                   /db_xref="InterPro:IPR021276"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF9"
FT                   /protein_id="ABC62282.1"
FT                   /translation="MAWRYELEREDLRSDRIEWNPIFPFKPGAVLQLALTANVVTYALT
FT                   GGQFGYWKLFPTEPPRIVPPAWGEVRLANGTIAYGLVPMASHAILRLEPAKGGWRETSD
FT                   ERAAVDRGYNRYLPAAGSLREREDALLFRPLVVLGLVLDRWLREENWFGASQIAVTSAS
FT                   SKSALGYALRHGDGPPLLGLTSARNRDFVERTMVYDSVAAHDELPQLAAGTLILDFTGD
FT                   PSLIRGLSERNGDALRVVRIGATHAGAASLNDDTVFFAPERIGREIALNGLEVFERDRA
FT                   AAIAEFASRSTDWFIREHVDGPDAIVEAFRDLLTGRVSPERLLIARPEGAFE"
FT   gene            224349..226664
FT                   /locus_tag="ELI_00955"
FT   CDS_pept        224349..226664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00955"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62283"
FT                   /db_xref="GOA:Q2NDF8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF8"
FT                   /protein_id="ABC62283.1"
FT                   /translation="MNLALLALTITAGAIVTSPLQAQDLPSEAEGPVVKDPANTIVVTG
FT                   TRSAGRSALEAAVPVDVVSEEELNATGYADLNRALNFLEPSVNFPRAATTATAANTRPI
FT                   TLRGLSPDQTLVLVNGKRRHTNAVLNVNNSIGRGSAGVDLDTIPQNAIQRIEILRDGAA
FT                   AQYGSDAIGGVVNIILKDDAQGASFELLGGITEEGDGLNGLASTSGGLPIGRGGHLTLS
FT                   ALVRAQEATNRAFVDQRFDRVTYRIGDPEASLFGGSVNFGLPLGDAELYGFGTVAQKIS
FT                   NNGAGFRVPGTSLLYPDGFLPVIEPYIWDGSGTLGISADLGGFALDLSQTYGRNEADFR
FT                   VFDTVNVSLGLDSPTSFDSGGVTYEQYVTDFGVSRSLGLLAGGNITAGAQYRRETYAIR
FT                   EGEPAASTGVGADGFAGFAPRRPVNEVRDAFAFYLDAELRPIEALLIGGAVRYDEYDDS
FT                   GGETTWRVSARADLTEGLALRGAIGTAFRAPSLQQQNFSAVQGALSAGQLVSVATLPVS
FT                   DPIARALGAGDLRPERSRNYSAGIVLEPTPRLAFTLDAFHIQIDDRIALSEQLRGAAVN
FT                   AILAGAGIVGFSQVRFFTNAVDTRTTGVEATARWSASLSPETRASMDVGFALYDTELES
FT                   LRANPVLPTLPLLGEKSILFLTEAQPRDKLTVQAVVEHRSVSARAALTRFGTYTSQPLV
FT                   ETQTFDGGTSFDLSLSYALSSAIMLTAGVQNLFDDRPEEIADQARFIAATGGSFPTGEE
FT                   TPLGVNGRSYFVQLRGNF"
FT   gene            226664..228169
FT                   /locus_tag="ELI_00960"
FT   CDS_pept        226664..228169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00960"
FT                   /product="alkaline phosphatase D"
FT                   /note="COG3540 Phosphodiesterase/alkaline phosphatase D"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62284"
FT                   /db_xref="GOA:Q2NDF7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF7"
FT                   /protein_id="ABC62284.1"
FT                   /translation="MVSRRALLGRTALALAASRFLSPVTAIAVQPQPYADGDPFMLGVA
FT                   SGDPRPDGFVLWTRPLGLSGTATVGVEIADDDGFRRIVRSGSVTASPARGHAVHVEPVD
FT                   LDPARTYFYRFHLDGATSPIGRTATIDPQATRMRLALAACQHWEHGWFSAYRDMVAQEI
FT                   NVLLHVGDYIYEKSFGTGPDVRSFGAPDPFTLDEYRVRHALYRTDPDLQAATAAFPIIA
FT                   TWDDHEVENDYASLQGSVTEDPAAFVARRAAAYQAWFEHMPISPRRLTPHGAADIVRRF
FT                   EWGALASLSVLDCRQFRTSQPCGRGGQVIADCAEVFDPVATMLGLEQEAWLRDRLANER
FT                   TRWSLIGQATMVSRLPLPGGGDARWSDIWDGYAASRDRLIAALRQPAVRNAVLLGGDVH
FT                   SFWANDIPSDPERMEGPVVASEIVTSCLASRSGPEELFTGIQGRNPQVRFHDNDNAGYT
FT                   LLDIDAERIDGRFRAVRDLTDPNSASFDLRRFAIEDRAPGVRI"
FT   gene            complement(228702..229559)
FT                   /locus_tag="ELI_00965"
FT   CDS_pept        complement(228702..229559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00965"
FT                   /product="alpha-methylacyl-CoA racemase"
FT                   /note="COG1804 Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62285"
FT                   /db_xref="GOA:Q2NDF6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF6"
FT                   /protein_id="ABC62285.1"
FT                   /translation="MERLGLGPDVCLDRNPALVFGRMTGWGQDGPLAQTAGHDINYIAL
FT                   SGALWYAGEPGALPMAPPGLVGDIGGGALYLAVGLLAAILSARESGKGQVVDAAIVDGS
FT                   AHMMNLLLSLKATGHFVNERGRSILDGPHWYSTYRCADDRYISLGSLEPKFYTLLCQKL
FT                   GIADQPDFANGYDPACWPDLRHRFEELFRRRTRDEWMTLLEGTDACFAPVLDPDEAASH
FT                   PHMAARQIYKKIDGIIQAMPSPRFSNTPPPEPTVKSAGPNQKRTILQQWRTTRRRHVSR
FT                   SKLS"
FT   gene            229590..229946
FT                   /locus_tag="ELI_00970"
FT   CDS_pept        229590..229946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF5"
FT                   /protein_id="ABC62286.1"
FT                   /translation="MAVLNKIEDVLDRCGLLQIEGYKSLTAIENRLTAKVDRIPIRDNT
FT                   IDNYNVGSKICQQHSAKWRWTDTGNLDDPDTSERTASRHLQFLSNGSNTTEIIADLLSG
FT                   IKFIQAPKYSQMEC"
FT   gene            230138..231682
FT                   /locus_tag="ELI_00975"
FT   CDS_pept        230138..231682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00975"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62287"
FT                   /db_xref="GOA:Q2NDF4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF4"
FT                   /protein_id="ABC62287.1"
FT                   /translation="MELRTQLRRAAGYFACNEALVHGERRFSFAEAWSRGVRLANALTN
FT                   AGLRPGDKIATLEKNSIEAADIFLAAAIGNFVRVPLYARNRRESHAHMMRNTDCRLALV
FT                   DNALLPEVAGLETELPDLKRLIVRDGTYEEWLARASDQDPDPTISPDDYCVIRHTGGTT
FT                   GAPKGVAYTHRTWMTCCAGFLEVGPRPDPGATVLHVGPLSHASGFMFSPYWAVGSRNIM
FT                   VEAFDPASFLEILEREEVGYAFVAPTMLNAVVHHGNPRGHVFPRLRCLLSASAPVSEAT
FT                   LRKARSIFGDDVLHTAYGQTEILPVTALGPKEWFGETEGSTPLQSVGRAMSFVDLEIRD
FT                   ADGRALGPDEPGEIVARFENGQMQGFWNDPEETALRLVDGWVKTGDIGRIDANGFLYLL
FT                   DRANDLIVSGGYNIYPAEIENVIADHPQVIAAAVFGIPHEKWGETPLALVVVAPGTELP
FT                   EQEIIDLVSERLGSFKKPGKVVFTTEPLPLSNVGKVLRSKLREPYWAGRASRVSGA"
FT   gene            231706..232506
FT                   /locus_tag="ELI_00980"
FT   CDS_pept        231706..232506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00980"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62288"
FT                   /db_xref="GOA:Q2NDF3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF3"
FT                   /protein_id="ABC62288.1"
FT                   /translation="MADLVSLDAITVERRGAAFWVHLNRPDALNSLTLEMARDLELAIE
FT                   TAEADPAVRAFVITGTGRAFCAGADLAALNAYGGSIMEPLEHFLAELGRVLRRIELSRL
FT                   PVLAAVNGLALAGGLELVLCCDIVVSAEDARFGDAHANYGLLPGGGGSIRLPRKIGPAR
FT                   ATYLMMTGEFVSAREMERAGLVSRVVPAEALVDSTQAVVEMLAAKSPLGLVHIKELAAI
FT                   AGDCILEDGLRQELEIIGAYAASHDLREGLAAFAEKREPEFKGK"
FT   gene            232503..233741
FT                   /locus_tag="ELI_00985"
FT   CDS_pept        232503..233741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00985"
FT                   /product="Thiolase"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62289"
FT                   /db_xref="GOA:Q2NDF2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF2"
FT                   /protein_id="ABC62289.1"
FT                   /translation="MSDIYIAGVGMTQFGRQLDRSLKDLSADACARAFADAGCGREDIE
FT                   AVFFGNCVQGHMEGQDMIRGELVARAVGMQGVPVVNVENACATASTAVAMATAYVRSGM
FT                   ADIVLALGAEKMCSPDKALMFSAFDGAWDVHETECSRETLLAMGQGVEVPEGSVSNQPY
FT                   SVFMDIYAAMSRAHMRTYGSTQAQIAAVSAKNHVHSTHNPLAQYRKPYTVEAVLAAPPI
FT                   VFPLTLPMCSPISDGAAAAVICNSAGLRKLAVSDDRAIRVLASVLQTSAERDPYDYDRH
FT                   VTRLAAMRAYAMAGLGPLDVDVAEVHDATAMGEIIEIEALGLVPPGEGGIAAERGDTVI
FT                   GGRIPVNPSGGLECKGHPIGATGLGQIYELVSQLRGDAGARQIEGARVAVAQNGGGVLG
FT                   VEEAVVAVTILGR"
FT   gene            233784..234899
FT                   /locus_tag="ELI_00990"
FT   CDS_pept        233784..234899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00990"
FT                   /product="acyl-CoA dehydrogenase, short-chain specific"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62290"
FT                   /db_xref="GOA:Q2NDF1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF1"
FT                   /protein_id="ABC62290.1"
FT                   /translation="MAVESIRRFLDEKLEPEIRAHGECFIERPLMQKWTSELAAFGHIS
FT                   APHREEWGGLDMGWLTHLLIFEEIAYSSLDVAIPGFINAVGAELIRRSASPEIQQRYLP
FT                   GLVAGELFVSMGISEPDVGSDVAAVRTRAIRDGDYWVINGEKTWITSGAYSDLLICTCR
FT                   TGEKEISHILVDRAESPYEVRDIEKMALNGQSTAQIFLTDCRVPASNMLGQPGDGLRNT
FT                   LKVFEIARCHMAMWSIGIARRALDEAIAYSKERSQHGRKLAGHQLIADKLATMATRIDA
FT                   ARLLAHRAISLVDADVRAEAECAMAKWYATEMAIGVTRDALQIHGGNGVTREFIVERLV
FT                   REAIICPIPDGTTEIQKLIVSRALTGVAAFR"
FT   gene            234916..235830
FT                   /locus_tag="ELI_00995"
FT   CDS_pept        234916..235830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_00995"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62291"
FT                   /db_xref="GOA:Q2NDF0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDF0"
FT                   /protein_id="ABC62291.1"
FT                   /translation="MHEELRYDDKVVIVTGAGGGLGREHALMFGKRGARLVVNDLGGDR
FT                   MGDGRSSSAADRVVEEIRSAGGEAVANYDSVEDGARIVETALDAFGTIDVVINNAGILR
FT                   DVSFHKMTDQDWTLIQNIHLNGSRAVTQAAWPTLRNKAYGRVIMTSSAAGIYGNFGQAN
FT                   YAAAKLGILGLANALAEEGRSRNINVNTIAPIAASRMTETVFPKALLDRLRPEAVSALV
FT                   GWLAHESCYETKGLFEIGAGYVAKLRWERTCGYHLGRNGIFAPEEIAQHWNSIVDFTDA
FT                   EHPTVMNDSLDAVQRIMADDRRD"
FT   gene            236121..238175
FT                   /locus_tag="ELI_01000"
FT   CDS_pept        236121..238175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01000"
FT                   /product="Outer membrane protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62292"
FT                   /db_xref="GOA:Q2NDE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE9"
FT                   /protein_id="ABC62292.1"
FT                   /translation="MSDVIIVTATKKGYGENLQNVPVAVTAFGEAQLDAKFVQNLQSLS
FT                   YDVPNVQLEGVGTAPGYANFTIRGLGINSTVPSIDPTVGVFTDGIYLGINAGVVLDNFD
FT                   LEGIEVLRGPQGLLFGRNVTAGAVVMRTTRPDFNFRASAKASVETGLKKTVSAMVTGPI
FT                   AEDVLAAKLAVYYSKDEGWFRNQFDQSSFGKSRDIIIRPALSVKGGDNFRMDLRYEHGD
FT                   IDGDGAPVQSHAIFPRDTFGISIDFPGYYNATWNQAIAETNIDVGLGDGVITNIMGYRQ
FT                   FRSRAASDIDGTPQHFFNGYFNINQEQISDELRYSGKIGAVEVTTGLYYFAQDLAYAEQ
FT                   RDLLGGARIVSGGGTQDQTTWGAFASADWHFSNTLTLNIGGRYSWERKAVRIAPLGANG
FT                   CDVNTLRCATNFIDDESWKSFTPKLGLQWQPDNQTQIYGFYTRGFRSGGYNLRNTDPGV
FT                   PPGPFDQETQDSFEIGAKKQFGRSRLNIASFYNQMKNLQREINLPGPLGVSQVIRNTAD
FT                   ATITGFEAEGQFFIMPNLVLSGQVGYVHGKYRNIQFDISGDGVINDVDRDLKLPRLSPW
FT                   TYGAGLTYDQTLGSAGTATARIDFTHRDSARFTDNNAGFLSPADMLDASLTYKTADQIW
FT                   RFSVYGRNLLNEVTYGGDTPLPAAFGGPGASLSPLNKGRTIGGEVALSF"
FT   gene            complement(238339..239163)
FT                   /locus_tag="ELI_01005"
FT   CDS_pept        complement(238339..239163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01005"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62293"
FT                   /db_xref="GOA:Q2NDE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE8"
FT                   /protein_id="ABC62293.1"
FT                   /translation="MTKSVADLEQQLGIALFNRTSRGILVTPEGRDFIDRAARLLADAD
FT                   DLFRERNRGADPYAGLLRIGLFPGSMDWLINDAAIGLLKRHEGVRLEIVSGNSERAVQL
FT                   LSRGDIDVAFGLEAALAGWPQFKCERIAAVDIMPFVRKDHPILSETAIDKQMLARCDFV
FT                   VPSSSEPYTPIIRQIYEVNDQRPEDRIHMTDYFPLVRRIVAATDSVGLVASAFTSARWF
FT                   RDEFVTLPHTGLLEPLVLAYAARARWPVKPAARDLIARVRQNWSSESNAQKQ"
FT   gene            complement(239376..240356)
FT                   /locus_tag="ELI_01010"
FT   CDS_pept        complement(239376..240356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01010"
FT                   /product="ISCc3, transposase OrfB"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62294"
FT                   /db_xref="GOA:Q2NDE7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE7"
FT                   /protein_id="ABC62294.1"
FT                   /translation="MRYPASEKLGIIRIVEQSHLPATRTLDQLGVARRTFHRWYDRFLE
FT                   GGPEALADRPSAPSRVWNRIAPEVQDEIVEMALEQTDLSPRELAVRFTDEKRYFVSEAT
FT                   VYLLLKAHDLITSPAYTVIKAAEVFHTKTTRPNEMWQTDFTYFKIIGWGWMYLSTVLDD
FT                   YSRYIIAWRLCSTMCASDVTETLDMALKASGCDHANVLHRPRLLSDNGPNYIAGELADY
FT                   LDGKQMDHVRGAPFHPQTQGKIERWYQTLKNRVLLENYCLPGDLEQQIEAFVEHYNHQR
FT                   YHESLDNVTPADAYFGRAPEIIKRRERIKRQTLEYRRLQHRKLAA"
FT   gene            complement(240353..240700)
FT                   /locus_tag="ELI_01015"
FT   CDS_pept        complement(240353..240700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01015"
FT                   /product="ISCc3, transposase OrfA"
FT                   /note="COG2963 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62295"
FT                   /db_xref="GOA:Q2NDE6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE6"
FT                   /protein_id="ABC62295.1"
FT                   /translation="MPAEQVVKDIRRKTRRHFSADDKIRIVLEGLRGDASIAELCRRES
FT                   IAQCLYYTWSKEFMEAGKRRLAGDTARSATTDEVKDLRREARDLKECVADLTLENRLLK
FT                   KSMIADGGDEE"
FT   gene            complement(240901..241140)
FT                   /locus_tag="ELI_01020"
FT   CDS_pept        complement(240901..241140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01020"
FT                   /product="hypothetical protein"
FT                   /note="COG3311 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62296"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE5"
FT                   /protein_id="ABC62296.1"
FT                   /translation="MSDPKRESAELSGTVNREARFQERLVRLPEVMARVGMRRSAIYQR
FT                   MRDGSFPRSRSLGSKCTVWIESEIDDWIKSVEAT"
FT   gene            complement(241426..241497)
FT                   /locus_tag="ELI_t15151"
FT   tRNA            complement(241426..241497)
FT                   /locus_tag="ELI_t15151"
FT                   /product="tRNA-Val"
FT   gene            complement(241588..243468)
FT                   /locus_tag="ELI_01025"
FT   CDS_pept        complement(241588..243468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01025"
FT                   /product="periplasmic serine protease"
FT                   /note="COG0616 Periplasmic serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62297"
FT                   /db_xref="GOA:Q2NDE4"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE4"
FT                   /protein_id="ABC62297.1"
FT                   /translation="MAFAKGVWKLLVGIKDGLSLLFLLLFFMALYAVLTARPSPAQVRE
FT                   GALLLELDGVVVEEKSVIDPLELFLSGTAPIGEYDAQDLVHAIDAATGDDRIKAIVLDL
FT                   TGFLGGGHVHLQDIGEALQRARDAEKPVLTYGIGYGDDAMMLAAHASEVWLDPLGGAII
FT                   AGPGGNRLYFGQFLEDLNINARIYKVGTYKSAVEPFDRSDMSPEARENAQALYGALWEE
FT                   WQAKVKKARPAIDLDTVTGSPAEWVAASQGDLAQAALAAGLVDTLGSRVEFGERVAEIA
FT                   GEDDWEERPGAFAHTAYDAWLSDNARDTSGSAIGVVTVAGEIVDGEAGPGTAGGDRIAE
FT                   LLDAALSDDLAGLIVRVDSPGGSVLASEAIRDAVLRHKAKGIPIAVSMANVAASGGYWV
FT                   STPADRIFAEPETITGSIGIFAVIPTFENLAAEYGVNADGVATTSLSGQPDLIAGFTPE
FT                   VDAILQSSIEDGYRDFLTRVSEARKLPMERVDAIGQGRVWDGGTARQIGLVDQYGGLEE
FT                   ALDWVAAQAELEEGDWHVRFLGNEQQPFDNLLRTMLLTDSESAPAGDIFGMVATRQQAL
FT                   LGQVRTDLERLLGTRGMQAYCLACPVTPRARAEAAADDGWFAQMAAFFAR"
FT   gene            243577..244620
FT                   /locus_tag="ELI_01030"
FT   CDS_pept        243577..244620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01030"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="COG0540 Aspartate carbamoyltransferase, catalytic
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62298"
FT                   /db_xref="GOA:Q2NDE3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDE3"
FT                   /protein_id="ABC62298.1"
FT                   /translation="MTSDGTPTQSGRYPAGGHAFPHGSLTGIAQLERHEILYLLDEAEQ
FT                   WVDFNRQSEKHCDLLAGLTIINAFFENSTRTLLSFEIAGKRLGADVVNMHAAQSSVKKG
FT                   ETLIDTAITLNAMRADAIVIRHGSSGAVDLIASKVDCPVLNAGDGQHEHPTQALLDALA
FT                   LRHALEARGEGSEDFTGLTITICGDILHSRVARSNILCLQAMGASVRVCAPPALMPVGI
FT                   ERMGAEPFHDFDAALKGCDVAMMLRLQTERMSGQFIPSAREYHHLYGLTQHRLQRCAPD
FT                   ALVMHPGPMNRGVEIDSDVADMLDRSIITRQVEMGVAVRMACLDILTRKGRGLPGWQGD
FT                   LGKGQWA"
FT   gene            244611..245852
FT                   /locus_tag="ELI_01035"
FT   CDS_pept        244611..245852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01035"
FT                   /product="dihydroorotase"
FT                   /note="COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62299"
FT                   /db_xref="GOA:Q2NDE2"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE2"
FT                   /protein_id="ABC62299.1"
FT                   /translation="MGMKQQRPLLITNGKVVTPDGVREQPIVCIDGRIAAVDASEAQGD
FT                   VDTLDARGRIVAPGIVDLGVFAIDKPAFHFGGITRAALMPDQSPPLDLPSRVNYIAKSG
FT                   KPDLWVHPLAAATQELSGEDLAEFALMREAGARGIATGRRWIADSGVMLRVLRYAAMLD
FT                   LVVVSHAEDGGIAGEAVATAGEMATRLGLPSAPVEAEALAVARDIALAEMSGARLHFRQ
FT                   VTTRAALDLVRAAKARGVAVTAGVTPAHFMLSDLATGDFRTFARLSPPLREDSDRLAVV
FT                   EAIGDGTIDVISSGHDPRGPEDKRLPFSDAEPGMAGAETLLAMTLSLVRDNVLSLERAF
FT                   ELLSANPARLLGVEAGTLEAGREADILLVDTDKPWVVSTARMTASAGNTPFDGQPVQGR
FT                   AIAVVKGGVQVIAN"
FT   gene            245925..246272
FT                   /locus_tag="ELI_01040"
FT   CDS_pept        245925..246272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE1"
FT                   /protein_id="ABC62300.1"
FT                   /translation="MDEDDDMIGKRAERRKTVGIQGRYRTGSGVPRDVWVTDLSKTGCR
FT                   FYDKFGTMQPGKALTLRLGPVGPIPATVRWWNNHVNGIEFEQPLHDSVYQHICDNLSET
FT                   PSSDLLGWDNE"
FT   gene            complement(246344..247741)
FT                   /locus_tag="ELI_01045"
FT   CDS_pept        complement(246344..247741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01045"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62301"
FT                   /db_xref="GOA:Q2NDE0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDE0"
FT                   /protein_id="ABC62301.1"
FT                   /translation="MARINRTAALALTSALGLVTLAGCSAQGAPRADVSASKAQTALQK
FT                   GDSDQAVASAEAAVLAEPRNAAYRAVLGAAYLDAGRFASAATSFDDAMKLGDTSARTAL
FT                   GYALASIGKGDNARAIAVLDDWRDDIPAADLGLALALAGEADRGVHVLGTALRGGESTP
FT                   KLRQNLAYAYALQGNWRAARVMAAEDVSPTELDARISKWAHMAKPEDYQQRVAGLLDVP
FT                   VRADAGQPVQLALGNNPSAEQLAAEAAAMDPSVRVAAAAPAAGELPPVEGFVASRQAPR
FT                   ELPPLDAVPVGARPVEPAPQVAVAAPAVRAPESFEDAFKAPAPTGATVAQVAANAVKFV
FT                   SDPVVQSAPARRGAAQPTNRVAARPVSADGSHLIQLGSFRSESGARRAWGVYAKRHPEL
FT                   SDYQMVITQAKVRGKTYFRVSAGGFQVASANSMCGKVKARGQGCIAWADGRPLPGAVDR
FT                   SYRLARR"
FT   gene            complement(247768..248325)
FT                   /locus_tag="ELI_01050"
FT   CDS_pept        complement(247768..248325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62302"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD9"
FT                   /protein_id="ABC62302.1"
FT                   /translation="MNEASFASLNPSLLARKGGAKPAMRPQLAPLNPNGSDVAANLEDL
FT                   GWNDMGDESEADGRQSNVLPLTPEPANEQSQAEARQADRASDKALHTAEQPVIRKQQQD
FT                   LAERVAEPAPPKRPTRTRRSALDRGKRAAFTLRLDAERHLKLRLASTVRGASAQAIVTE
FT                   ALDKLLDDMPELSSIAAQVQRR"
FT   gene            complement(248344..249051)
FT                   /locus_tag="ELI_01055"
FT   CDS_pept        complement(248344..249051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01055"
FT                   /product="ParA-like protein"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62303"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD8"
FT                   /protein_id="ABC62303.1"
FT                   /translation="MALASQKGGSGKTTLSGHLAVQAQRAGAGPVVLIDIDPQGSLADW
FT                   WNEREAEYPAFAQTTVARLANDLQILRQQGFKLAVIDTPPAITMAIQSVISVAELIVVP
FT                   TRPSPHDLRAVGATVDLCERAGKPLVFVVNAATPKAKITSEAAVALSQHGTVAPITLHH
FT                   RTDFAASMIDGRTVMEVDPESRSAAEVTALWGYIADRLEKNFRRTVFAAPGSVSQVAGA
FT                   HRPAGGFGRRVAQ"
FT   gene            249310..250515
FT                   /locus_tag="ELI_01060"
FT   CDS_pept        249310..250515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01060"
FT                   /product="hypothetical protein"
FT                   /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62304"
FT                   /db_xref="GOA:Q2NDD7"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD7"
FT                   /protein_id="ABC62304.1"
FT                   /translation="MTARIQALFASMALGLTALAGAALADVKSGVDAWSAGDYARAIKE
FT                   WRGPATKGDPDAQFNMAQAYRLGRGVEQNLKQAEVFYAKAAAQGHLKAADNLGLLLFQG
FT                   GRREEAMPYVKAAAERGDPRAQYLIGIAHFNGDLVEKDWVRAYALLTLANAAGLPQAGP
FT                   AIRQMDDFIPLEQRQQAQPLAAQIKRDADVRRSSQLAAADLGGSPPPQIAAAVPARPAP
FT                   RASDATRLPPAAARIPQPIAPTPVAPSVAAAQAAIAEATRVTGTQSPADAGATFAAREA
FT                   PPRAAPARTATPRPAVDQPVRVAAAPTARTAPPPAPVAAPQTRAADGPWKVQLGAFSVR
FT                   SNADNLWARLSGRNELDGTAKLLVPAGRLTKLQAGGFASRSAAQDACNALKRSGQSCLV
FT                   TR"
FT   gene            250573..251868
FT                   /locus_tag="ELI_01065"
FT   CDS_pept        250573..251868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01065"
FT                   /product="membrane protein, putative"
FT                   /note="COG2311 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62305"
FT                   /db_xref="GOA:Q2NDD6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD6"
FT                   /protein_id="ABC62305.1"
FT                   /translation="MATTTEPASDRPATPDGVAPVSAKDGQRLASLDFIRGIAVLGILA
FT                   ANIVAFGQPFAAYMYPAAFTVPHSAAEDWMWVGQFVLIDNKMRGLFTILFGAGMMLFME
FT                   KAWARGASRWLQARRLAWLGLFGLIHYFLIWRGDILFSYAACGLLALLLVRVSAKWQLR
FT                   LGLMGYVTGALLWGGMMSMMVLAADTDLGAPGQPMAEFAAELESGKQEALADGALQTEL
FT                   ISEGRYGDFVAHMFGEHAGDLAFFIFLWMFETLPLMLIGMALYQFGFFSGGLDPGKMKR
FT                   WGWIGLIVGGAISLWIALWVREGGFTYYGTQAAMVGFSYLPRLAMILGLAALLALGGPK
FT                   ATGWLGERLSFAGRAAFTNYLGTSIVMLLVFHGWALGLFGELGRTELYGVMVLAWVLML
FT                   AWSKPWLEKFRYGPLEWFWRCLTYGKIFPLRR"
FT   gene            251938..252126
FT                   /locus_tag="ELI_01070"
FT   CDS_pept        251938..252126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01070"
FT                   /product="hypothetical protein"
FT                   /note="COG2906 Bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62306"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD5"
FT                   /protein_id="ABC62306.1"
FT                   /translation="MYVCICNAIREAELRAVAHRTSGDAEEAYAALGKVPNCGNCLCEA
FT                   DEILFEERELSCKRVAA"
FT   gene            252255..252758
FT                   /locus_tag="ELI_01075"
FT   CDS_pept        252255..252758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01075"
FT                   /product="bacterioferritin"
FT                   /note="COG2193 Bacterioferritin (cytochrome b1)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62307"
FT                   /db_xref="GOA:Q2NDD4"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD4"
FT                   /protein_id="ABC62307.1"
FT                   /translation="MKGDAKVIEYLNKALTNELTAINQYWLHYRVLADWGVTKLAEYER
FT                   KESIEEMHHADRLAERILFLNALPNFQAIHKLKVGETVEEILKADLALEEEAIPLLRDA
FT                   AEHANSVRDYTSEQLFEDILANEEEHVDFLETQFDMIEKMGLQNYVQLQSHPAGEHETQ
FT                   AGRP"
FT   gene            complement(252774..253268)
FT                   /locus_tag="ELI_01080"
FT   CDS_pept        complement(252774..253268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01080"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62308"
FT                   /db_xref="GOA:Q2NDD3"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD3"
FT                   /protein_id="ABC62308.1"
FT                   /translation="MLWDMLAATGGNIASDLLERTSSTLRVQEIVRLSLAPAFLLAAIG
FT                   AVMNVMMARLIWVANRIERLEERMEENRGSSVRRELGRLKRRRKLAQRAMIFSTAAALT
FT                   ICVVIALLFVSAFITPQIGTVTAIAWIATMGFLIAGLILFATETIVAASGQRGDGPDEG
FT                   S"
FT   gene            complement(253268..254725)
FT                   /locus_tag="ELI_01085"
FT   CDS_pept        complement(253268..254725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01085"
FT                   /product="predicted GTPase"
FT                   /note="COG1160 Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62309"
FT                   /db_xref="GOA:Q2NDD2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD2"
FT                   /protein_id="ABC62309.1"
FT                   /translation="MPHHLKPTVIIIGRPNVGKSTLFNRLVGKKLALVDDQPGVTRDRR
FT                   MGDAELAGMEFTVVDTAGWEDDDKDSLPGRMRAQTEVSLEGADAALFVIDARAGITPLD
FT                   EEIARWLRTVEVPVVLVANKAEGKAGDAGLLESYALGLGDPAPVSAEHGEGIADLFEGL
FT                   WPHIGHFEKDAERAAAEAAEVGEGDEDDEDAPLGPLKLAIVGRPNAGKSTLINRLLGED
FT                   RLLTGPEAGITRDSISVDWQWTDPKSGEPRDIRLIDTAGMRKRARVTEKLEKLSVADAF
FT                   RAVDFAEVVVLLLDATQGLEHQDLKIASKVLEEGRALMIAINKWDIAEDASYLFNGIRA
FT                   ALDEGLSQVRGLPLFAVSAKTGKGLDEMLRAAFEIRESWSKRVPTAALNRWFDDALDAN
FT                   PPPAPGGRRIKLRYITQAGTRPPRFVVFGTRLEALPKSYERYLVNGIRAKLGFEAVPVR
FT                   VVLKSPKNPYNANRGGGGNYSTGSDRG"
FT   gene            254844..255614
FT                   /locus_tag="ELI_01090"
FT   CDS_pept        254844..255614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01090"
FT                   /product="hypothetical protein"
FT                   /note="COG3942 Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62310"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD1"
FT                   /protein_id="ABC62310.1"
FT                   /translation="MKLPLSLCSLVAAASAIGLAAEAPAQARAAEFAPRGGQELPPYLQ
FT                   CVPYAREVSGVSIYGDAHTWWEQAAGRYERGNVPRVGAVMAFRPTGKMRLGHVAAVSKI
FT                   IDSRTVLLDHANWSPINGRRGQIERNVRAVDVSRDNDWSKVRVWYHPLQGLGKTAWPVH
FT                   GFIYSKAVINREPFERDIAPQPPVRVAIAKKPSRGFMSAFADVGRHKAKQPAHTAAHVH
FT                   RPQRAAKPIAERSTAVQQPADPFAAIVSKYDPAR"
FT   gene            complement(255633..255935)
FT                   /locus_tag="ELI_01095"
FT   CDS_pept        complement(255633..255935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62311"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDD0"
FT                   /protein_id="ABC62311.1"
FT                   /translation="MSENETNDAAAAADTPPDHLSVNPRSPAFNAEALQRGVGIRFKGR
FT                   QRTDIEEYSVSEGWVRVQAGKTVDRKGQPLTLKLKGKVEAWYEDLGDNPPVAKKG"
FT   gene            complement(255986..256171)
FT                   /locus_tag="ELI_01100"
FT   CDS_pept        complement(255986..256171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01100"
FT                   /product="hypothetical protein"
FT                   /note="COG0810 Periplasmic protein TonB, links inner and
FT                   outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC9"
FT                   /protein_id="ABC62312.1"
FT                   /translation="MATTPDPAPDRIEPSAPPETPVTPNPDQPDPRPDEIEPPVPDTDH
FT                   PGVHPDETPPDRQRSL"
FT   gene            complement(256175..256363)
FT                   /locus_tag="ELI_01105"
FT   CDS_pept        complement(256175..256363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC8"
FT                   /protein_id="ABC62313.1"
FT                   /translation="MEDFSKTQTPGAHLATHDPKEGDLTPKEGSAADMNAAKPLVSWRN
FT                   EETLGRPNRSSSRSGQE"
FT   gene            256521..256602
FT                   /locus_tag="ELI_t15073"
FT   tRNA            256521..256602
FT                   /locus_tag="ELI_t15073"
FT                   /product="tRNA-Leu"
FT   gene            256666..258267
FT                   /locus_tag="ELI_01110"
FT   CDS_pept        256666..258267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01110"
FT                   /product="peptidyl-prolyl cis-trans isomerase trigger
FT                   factor"
FT                   /note="COG0544 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62314"
FT                   /db_xref="GOA:Q2NDC7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDC7"
FT                   /protein_id="ABC62314.1"
FT                   /translation="MQTKETTNEGLKRAYKLTLTAKEIDAKIDAEVKKVAPQVRMPGFR
FT                   PGKVPANLVRKMHGEQMHAQVINDSIRDSVDALIKEKELRPAMQPKIDLNEDYEQGKDA
FT                   VVSVSLEILPKVEAPSIDDLKLERLTVPVSDEQVMETIERIAGQNKSYKDAAKTRKAAD
FT                   GDQLIIDFTGSVDGVEFEGGKAEDAPLVLGSGTFIPGFEEQLKGVKTGDEKTITVTFPK
FT                   DYQAENLAGKEAQFDVKVKQVKVETDTTIDDEFAANLGLENLDKLKELIRGQLEQETNG
FT                   LTRTAMKRSLLDQLAAGHDFPVPEGMVDAEFEQIWNQLQQEAAQEEDPDKALKEIEAEK
FT                   DDYRAIAERRVRLGLLLSEIGQANGVEISQQEMSMLTMQAAQQYREEDRERFMQFIQQD
FT                   PMAAAQLRAPLYEDKVVDFLFDKAEVTDREVTREELEAAIEAEAEEEKKPAAKKKAPAK
FT                   KAEPKKAAAKKAPAKKAPAKKAAAKDGDEKPAAKKAPAKKAPAKKASTKKPAEKKAPAK
FT                   KPAAKKAPAKKPAAKK"
FT   gene            complement(258322..259686)
FT                   /locus_tag="ELI_01115"
FT   CDS_pept        complement(258322..259686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01115"
FT                   /product="Na+/H+ antiporter, CPA1 family protein"
FT                   /note="COG0025 NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62315"
FT                   /db_xref="GOA:Q2NDC6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC6"
FT                   /protein_id="ABC62315.1"
FT                   /translation="MLDLDPRIIILALFGLGLILSVGLERWLSDRYLSLPIIYVGLGYA
FT                   AFALPLGLPSIDPTADAFDAITLEYVTEFIVIASLAGAGIAIDRPVTWQNWRQIWPLLA
FT                   IAMPITIVGVAMLGWWGLGLAPASAILLGACLAPTDPVLARSVQVGPPGENQRHDVRFS
FT                   LTVEAGLNDGLAFPFTYLAIAAVGMTALGGWTLEWFALDVGWRIFAGIAVGYAVGRAGA
FT                   WYVFERDIDNIAETEAEEDDDAPLKYSTSEGLIVLGTLLTAYGLAEIVEGYGFLAVFVG
FT                   AVTARQRENASRYHKISHHFIDQIEKIVLVGVLFAFGGMLASGVLSALTWPGVLIGLAL
FT                   IFVIRPIGGLISEAFCDLPLPGRVAIAFLGIRGMGSIYYLAYGQNNADFAQIDVLWAVV
FT                   SFTILASIVIHGVSSAGLMRWIEIRKAHVHRGQEHTMDCLTPDQKRIAVEGRVDQ"
FT   gene            complement(259705..261231)
FT                   /locus_tag="ELI_01120"
FT   CDS_pept        complement(259705..261231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01120"
FT                   /product="amidase family protein"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62316"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC5"
FT                   /protein_id="ABC62316.1"
FT                   /translation="MKIFAPLIALTLTAPVLAQEAAGLPPLPGTSAAQQAAEQQLARIA
FT                   TLDDAGPELNAVIVVNPAAPAQARAAEAAGLPLGGMTVLVKDNIETRDMPTTAGSLLLA
FT                   DNATGRDAPLVARIRAAGGVILGKTNLSEWANFRGDDSTSGWSGVGGLTRNPHATDRNA
FT                   CGSSSGSGAAIAAGFAWGAIGTETNGSITCPASINGIVGFKPTVGFVSRTHVVPIAATQ
FT                   DTAGPMTIDTYRAAMLMNAMTGSDPLDPVTAEADARKVDFTEGMLDAGLAGVRIGVMRE
FT                   QIGNRADVAALFEQALTDMERAGAVLVDIEFNPDRAMFRDSFAVLLYEFREGIDAYLQA
FT                   LPRNRASDALLPRSLQELVEGNEAAGEAELRWFGQQLFEQALEATDTAAYETARENAVR
FT                   IAGEETIDRLLADFDVEFLVAPTRGPAWVSDLVVGDNFNSSIGFGSPAAIAGYPHLTVP
FT                   MGQVEGLPVGLSIIGAKWEDHAVLKAGSAYERIRMAELPVPTFRPWTPER"
FT   gene            complement(261272..263329)
FT                   /locus_tag="ELI_01125"
FT   CDS_pept        complement(261272..263329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01125"
FT                   /product="hypothetical protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62317"
FT                   /db_xref="GOA:Q2NDC4"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC4"
FT                   /protein_id="ABC62317.1"
FT                   /translation="MSTIALCAFLTTPLAAQEDDASAPAPAAADAQGQVFEPAYFEQFA
FT                   PRNALDMVSRIPGFTIDDGNRGQRGLGQANQNVIVNGERFSSKSDSLRDQLQRIPAADV
FT                   VRIEILDGTTLDIPGLSGQVANIVTSSTGTSGQFTWRSGFRAYNTEAQLYGGEVSLTGS
FT                   SGALDYTVALSNDNNRFGADGPTLITDADGALIEEQFSKFSGKFDNPKLATNFTYDFGG
FT                   ETVANLNLSYREDYFSALEPETGTDPTGLVRTRDARRSEDGPEYEIGGDIEFPFGPGKL
FT                   KLIGLERFERDNFTSSVVDAFSDGRQSTGFRFDQVNEAGERIGRFEYGWNMWSADWQLS
FT                   GEAAFNRLDRASRLFELDAGGNFVELAFPAGTGGVTEDRYEGILSFSRQLTSKLSMQAS
FT                   GGMEYSKIEQTGSAANSRSFQRPKGSVSLAWKPENDFDMTLEVRRSVGQLSFGDFLASV
FT                   SLNNDNINGGNNELQPDQSWNVELEVNKGLGAWGSAKLQLRQAWFEDFVDFFPLPLGGE
FT                   ARGNIGNAKRFHAELNTTLKGEPIGFDGARLEIRAIKRWMDITDPFTGENRPFSFDLNA
FT                   LLDVDFRHDIPNSDWAWGSGIFTADNAPYSRRREVGRDYEGPTFMNVFVEHKDVFGLTV
FT                   NASYGNVLGARNKFERTVFAGDRPGAPILFREVRDRRIGPIFRFSVSGSF"
FT   gene            complement(263540..265651)
FT                   /locus_tag="ELI_01130"
FT   CDS_pept        complement(263540..265651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62318"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC3"
FT                   /protein_id="ABC62318.1"
FT                   /translation="MKPRTFRSLLLGAALAALAPAAALAQADETTAEADEPPAGSVART
FT                   GQGQVYGPEYFAQFAPRTALDMIEQVPGFQISGGGGGDGGRGLGQANENVIVNGERLSS
FT                   KSDSARSQLQRIPASDVLRIEIVDGTSLDLPGLSGQVANVVVDLQGIAGSFQWKFRART
FT                   TAVDPEWYGGEISIAGKTGALAFTVALQNDNNRFGAEGPTVIVDGDGALLQEEDTVFVG
FT                   AFDKPTLTANLGYDFGNDVSATLNLTYARSYFRRNEDEALTGPLIDPNLRAIRTGEDGY
FT                   EYEISGDVSFPLGAGRVKLIGVERFDSEDFSQQVVATFDDFTILPTGSRFTRNDGVGER
FT                   IGRAEYNFPLWGADWQIAGEAAFNRLDRVSGLFELDAAGNFVELDFPAGTGGVTEDRYE
FT                   VSASVSKPITDRLSFQATGAYEFSTLKQTGSAANTRSFARPKGSASLAWNNGEGLDLTL
FT                   TLERRVGQLSFGDFLARVFLDDDNANAGNNELVPSQTWEVTVEVNKSLGAWGSTTFLYE
FT                   QRWIEDIIDIVPLPGGGESRGNIPSARRTEMEWTTTLKMEPIGWTGAQFDIRLEYEEGE
FT                   VRDPLTGELRDFSNGRDREIEVDFRHDIPGSQIAYGGGIEYNRDRPYFRTAEIGREQDG
FT                   PTFANVFIEHKDLFGLTARATLGNILGGRQLFQRTVFDGFRDTAPVLFIEDRDRRIGPI
FT                   FRLDVSGNF"
FT   gene            265852..266556
FT                   /locus_tag="ELI_01135"
FT   CDS_pept        265852..266556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01135"
FT                   /product="ATP-dependent Clp protease"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62319"
FT                   /db_xref="GOA:Q2NDC2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC2"
FT                   /protein_id="ABC62319.1"
FT                   /translation="MIDVREQLGETHGTQGQFTRDPLTGALVPVVVEQTSRGERSFDIF
FT                   SRLLRERIVFVTGQVEDGMASLITAQLLFLESENPSKPISMYINSPGGVVTAGMAIHDT
FT                   MQYIKPKVSTVCMGQAASMGSFLLAAGEPGMRVALPNARIMVHQPSGGARGMASDIEIQ
FT                   AREILRIRKRMNDLYVKYTGQKLADIEKAMDRDTFLEAEEAMKFGLVDKVFETRPENEG
FT                   GDKEEGSGGAPE"
FT   gene            266760..268031
FT                   /locus_tag="ELI_01140"
FT   CDS_pept        266760..268031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01140"
FT                   /product="ATP-dependent Clp protease ATPase subunit"
FT                   /note="COG1219 ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62320"
FT                   /db_xref="GOA:Q2NDC1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDC1"
FT                   /protein_id="ABC62320.1"
FT                   /translation="MTKLSGTDSKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCN
FT                   DIIREETKAGLTGRKEGDVPAPSEICATLNDYVIGQDRAKRVLSVAVHNHYKRLKHSGK
FT                   ADGVELAKSNILLVGPTGSGKTLLAQTLARTFDVPFTMADATTLTEAGYVGEDVENIIL
FT                   KLLQASDYNVDKAQHGIVYIDEIDKITRKAENPSITRDVSGEGVQQALLKLMEGTTASV
FT                   PPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDKIIADRLQKRSIGFGAHVADPDKRKV
FT                   GELLEKSEPEDLLKFGLIPEFVGRLPVIATLHDLDVDALVTILQEPKNAIVKQYSKLFE
FT                   LEDVELTFTDEALQAIAERAILRKTGARGLRSIVEGILLDTMFDLPDLDDISEVVIDAD
FT                   VVEGKKEPIRVVSNDDDGKKEEAA"
FT   gene            268188..268388
FT                   /locus_tag="ELI_01145"
FT   CDS_pept        268188..268388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62321"
FT                   /db_xref="GOA:Q2NDC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDC0"
FT                   /protein_id="ABC62321.1"
FT                   /translation="MAWFLPVLFSFSMFGAAVLFWIVPPEMQNGDPMMGILIAAASLLG
FT                   GQGFVLWLLSRWAREQDTGER"
FT   gene            complement(268675..269238)
FT                   /locus_tag="ELI_01150"
FT   CDS_pept        complement(268675..269238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01150"
FT                   /product="hypothetical protein"
FT                   /note="COG2335 Secreted and surface protein containing
FT                   fasciclin-like repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62322"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB9"
FT                   /protein_id="ABC62322.1"
FT                   /translation="MSFTKKALAAASAFALLGGGAVALTQPVVAHDHKSAEKSAPTIVG
FT                   VAQSTGVHTTLVAAVQAAGLVETLSGNGPFTVFAPTDDAFGKLPHGTVDTLLLPENKAT
FT                   LTNVLTYHAVAGSVTAADLVGQIEQARGAITVDTLAGEKLTVSRFGDTLAITDATGRTT
FT                   VVATADVKASNGIVHVVDGVFLPG"
FT   gene            complement(269350..270051)
FT                   /locus_tag="ELI_01155"
FT   CDS_pept        complement(269350..270051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01155"
FT                   /product="hypothetical protein"
FT                   /note="COG5343 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62323"
FT                   /db_xref="GOA:Q2NDB8"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB8"
FT                   /protein_id="ABC62323.1"
FT                   /translation="MTDTDTLAAEYALGLLEGEDLLRARGMQANDPVFAEAVEKWETHL
FT                   GPLLDDVPSAEPRPDLWHAIEARLNADTDTGDTVISLERQVVRWKWLAGLSSVAAAVLL
FT                   ALTFLPVGTQPGPPPVETTTLASSIPVGESGLRLEVTYLGGERELLVSAAGLSADGVHD
FT                   HELWVVPAEGSAQSLGVVAPGEIRRTSLDEGLAAQLVDGADLVLTREPLGGAPADGEVG
FT                   PIVARGEFTAL"
FT   gene            complement(270048..270617)
FT                   /locus_tag="ELI_01160"
FT   CDS_pept        complement(270048..270617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01160"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62324"
FT                   /db_xref="GOA:Q2NDB7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB7"
FT                   /protein_id="ABC62324.1"
FT                   /translation="MSDDRATAAREKLRAAMVRLSEGDRAALEEIYSATHAKLFGICLR
FT                   ILKDRKEAEDALQDVYLTLWRRADRFEPKAASPISWLATFARNRAIDRLRTGKVRAGAV
FT                   PVDEAMELADEAPRADRLLEDAERSARIHHCLDELEEPTRSSIRSAFLEGRTYAELAEE
FT                   SDTPLGTMKSRIRRGLAKLKTCLDYQ"
FT   gene            complement(270614..271570)
FT                   /locus_tag="ELI_01165"
FT   CDS_pept        complement(270614..271570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01165"
FT                   /product="putative cation efflux system protein"
FT                   /note="COG1230 Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62325"
FT                   /db_xref="GOA:Q2NDB6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB6"
FT                   /protein_id="ABC62325.1"
FT                   /translation="MGATHPQHGHAPSQGHEHGLSHGHNHGHGHHHHAPKDFGRAFAIG
FT                   VVLNTAFVIVEATYGFLSGSMALVADAGHNLSDVMALLLAWAAAVAAKKPPSGRFTYGY
FT                   KSSTILAAIANAALLFVAIGAILFETMHRLLDPQPVEGWTMIVVAGIGVVINTATALLF
FT                   VKGQHDINIRGAFLHMAADALVSVGVVIAGAAILLTGMLWIDPATSLVIVAVIAWGTWG
FT                   LAKDSIKMGLNAVPDSICEKEVESFLIGQPGVSLVHDLHIWPMSTTETALTAHLVMPDG
FT                   SNGDEFLTALSARLRERFKIDHATIQIERSADCGGGC"
FT   gene            complement(271575..272243)
FT                   /locus_tag="ELI_01170"
FT   CDS_pept        complement(271575..272243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01170"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62326"
FT                   /db_xref="GOA:Q2NDB5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB5"
FT                   /protein_id="ABC62326.1"
FT                   /translation="MLWFAKFLTKIVLGFVALSLLLVVLFKFVPVPITATMVMDENAIT
FT                   KDWEPLNNIDRDLVRAVIAAEDGKFCLHGGFDTEAIAKAAENNARGGRIRGGSTISQQT
FT                   AKNVFLWQGGGYVRKGLEAWFTVLIEYIWGKRRIMEVYLNIAEMGIGTYGAEAGAQRYF
FT                   QKSAASLSEIEAARMAVALPLPKQRAVTNPGGWLRRHGNTIAARIGVVRRDGLDSCVYD
FT                   "
FT   gene            complement(272331..273236)
FT                   /locus_tag="ELI_01175"
FT   CDS_pept        complement(272331..273236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01175"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62327"
FT                   /db_xref="GOA:Q2NDB4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB4"
FT                   /protein_id="ABC62327.1"
FT                   /translation="MSKSKAVAIPALGGEQSLNRYLSEIKKYPVLTAEQEYMLAKRYQE
FT                   HEDPEAAAQLVSSHLRLVAKIAMGYRGYGLPVSDLISEGNVGLMQGVKKFEPDRGFRLA
FT                   TYAMWWIKASMQEFILRSWSLVKMGTTAAQKKLFFNLRRMKKQLEAYEDTDLSPEDVTK
FT                   IATDLGVPEQEVINMNRRMMMGGDGSLNTPMRNGEDGSGEWQDWLTDDRPLQDETVANA
FT                   EEAQVRHEMLVEAMDALNEREQHILTERRLTENPQTLEELSQVYDVSRERIRQIEVRAF
FT                   EKLQKAMQRIAGERLLPGAA"
FT   gene            complement(273359..274327)
FT                   /locus_tag="ELI_01180"
FT   CDS_pept        complement(273359..274327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01180"
FT                   /product="pseudouridine synthase D large subunit"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62328"
FT                   /db_xref="GOA:Q2NDB3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB3"
FT                   /protein_id="ABC62328.1"
FT                   /translation="MTAEWIEHLAGREVITGILTGVGRLDKALAEASGLSRERVKALMQ
FT                   GGAVLVDGDPATNPSAKGSEGTPYTITLPPTVDPEAQPQDIKLDVVFEDEHLLVVNKPA
FT                   GMVVHPAAGNPDGTLVNALLHHCRGQLSGINGVARPGIVHRIDKDTSGLLVVAKTDNAH
FT                   EGLAAQFAEHTINRRYLALCAGHPNPAEGTIEGRIGRSERDRKKMAPLPEDSSRGKHAV
FT                   THYKTLRRLRDCALIECRLETGRTHQVRVHCQSIGHPLLGDPTYGRDPKGLRPILKELG
FT                   FARQALHAAMLGFEHPVTGQWVEFTADLPADMQELIDETAR"
FT   gene            274428..274820
FT                   /locus_tag="ELI_01185"
FT   CDS_pept        274428..274820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01185"
FT                   /product="predicted metal-dependent protease"
FT                   /note="COG1310 Predicted metal-dependent protease of the
FT                   PAD1/JAB1 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62329"
FT                   /db_xref="GOA:Q2NDB2"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB2"
FT                   /protein_id="ABC62329.1"
FT                   /translation="MLTIEASVMDALLAETSLAHPLECCGILLGEHNHITAIQPAANVH
FT                   PQPQTHFEIDPQTLVDAHRAGRNGGPQVLGYYHSHPTTVPEPSATDAAMAAQDGSIWAI
FT                   IGQGEIIFWRDRNDGFAQLSYSILDG"
FT   gene            274960..275604
FT                   /locus_tag="ELI_01190"
FT   CDS_pept        274960..275604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01190"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62330"
FT                   /db_xref="InterPro:IPR018762"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB1"
FT                   /protein_id="ABC62330.1"
FT                   /translation="MNDNDAVTLASQLCSRLCHDLLSPVGALSNGLELLAEEEDPEMRQ
FT                   RCLELLEASARTSANKLKFFRLAFGAAGGFGDRVGVDEPKAVIDALAQDAKRVEVNWAL
FT                   AVDALPKPAVKVMLNFAQMGLDALVRGGTLDIGAERRDGASEIVVRATGAKVAFDDSIG
FT                   RALEGSLPEDGLSGRTAAAHMLALIAEQSGGNLQYQKSEDALVLGAMLPEG"
FT   gene            275601..276305
FT                   /locus_tag="ELI_01195"
FT   CDS_pept        275601..276305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01195"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="COG3023 Negative regulator of beta-lactamase
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62331"
FT                   /db_xref="GOA:Q2NDB0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDB0"
FT                   /protein_id="ABC62331.1"
FT                   /translation="MSELVHHERPSPNFNDRKLPISMVVLHYTEMKPVETALDRLCDPE
FT                   GGVSAHYLISEEGEVTRLVPEDKRAWHAGVSYWRGHKDVNSASIGIELDHPGHVLGYRE
FT                   FSDAQIDALIPLLHRIVQNHDIPRANVVGHSDVAPARKVDPGELFPWDRLAEYNLCLPK
FT                   PEKLDLGNPFDNAGAFYLALERFGYDVTDGLKAVEAFQRRWRPEKIDGEIDGQICAILF
FT                   QLLLDRDRGVSR"
FT   gene            276841..278328
FT                   /locus_tag="ELI_01200"
FT   CDS_pept        276841..278328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01200"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62332"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA9"
FT                   /protein_id="ABC62332.1"
FT                   /translation="MKMFETLLAVVASATSVQTDDDLAARAISACGFAEFDVTPIDAGS
FT                   ASDFEDFATQVEAALGEKIMIVGGDLSGADMRRLSGSLPGSCFYQTKLSGTDWSGTDLI
FT                   GTKFVGTDLSGARFEGTNLTDARLVGVDAGGANFADAKLGNARWVGQNFGSKLAGASFV
FT                   GAYLNYFTFDCGITMDMQCGGSSGVDFSGANLSNADLASYPIWGLDTFTGADFNRAFIS
FT                   PRAVKYLDDVEVRRSITLGHRSDEAGDRRAQVRLTTAEFTELKASIETQTDEPSFDCAK
FT                   ASIKAEVLICAEYQSGLRHMDRDLSSLYRHAVKRGATSQREQRAWLRQRNRCDSAECVA
FT                   QAYQARMDALFGAVGVELVLTPNAALEFEEDLLPVADTMRSSALYQKMVPVIRSFSMQS
FT                   VTLTAMEDGRILARGEAVGGNAHTCSLHGDALVYDPDTGWYAGELDDGALVPILRVWDN
FT                   RLFFRYSGNMGDTPDEAADFITCGARAGFGEMRAVGK"
FT   gene            complement(278400..281780)
FT                   /locus_tag="ELI_01205"
FT   CDS_pept        complement(278400..281780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01205"
FT                   /product="serine protease"
FT                   /note="COG3591 V8-like Glu-specific endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62333"
FT                   /db_xref="GOA:Q2NDA8"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR024697"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA8"
FT                   /protein_id="ABC62333.1"
FT                   /translation="MKTRKYLVGVATIGLATALASSPALANDDNDASDEVSLEAQGNFA
FT                   GFRTMQSADIIVSTEIAIGTPGPAIERQVNGALVPAYPELIVRDDIGTAGAVDTANTLP
FT                   SVVQIFRQSNISGGVFFNCTGTMINPRTVLTAAHCLNARGSEDYGLPSTGADSTMLVAT
FT                   GVDTSSRLFNYLDFGSGYNEGGVAQSTDVIIHPSANLENGALPFPWADVAFIALDTPIT
FT                   DVPAMPLLLTPLDELTHMIVTGYGTTGTGETGAQGIGFLRRVGENMLGAVATSADLIDT
FT                   IFPGFAPSESSLGFETQALYWIDFDDPRRTSPGEDSCTFDGFGINCPNIDTVLAIDWFD
FT                   GDALPQEAGTAPGDSGSPLIADQIAPFPLITGVLSGGFDFFGTGNRYGDISFYNPLYPF
FT                   FEFITENTPYKYVSAKSGNGVWSDPARWTQDLDPGFFIEDSDGNIVNGVPGGDEPGVYE
FT                   QGPRLGLILGEDISGNSNDATAVLPPEGTPNFGANIPESSVLLGPGSTGFVPNNTDGTP
FT                   GTAFENPALYFDVLLVNPGTTTVDMDVEIDRLTIDGKNTGFALPEAYEFTSIIGVEQYR
FT                   GNAEIDGQLNAGNVLLFGGTMGGDGTVATNAFFNVSGVVSPGGDNAIGTFTIDGDYVQT
FT                   SQGTLLVDVKRRGKKPLEFDQLVVTGDASLAGDLFVKPTGKITAKFGAEWTVLTANSVL
FT                   GNFDEVTLLTRSPVLFAGTRVDGGDVIVAIGANPIAQIVGAQSDLSSLASVLDTLRFGG
FT                   RYADFESVFSVVDMAGFDIFGQTLAGLTPTSGFQQTFSATNFAQRFTGQVAQRTLRLRG
FT                   ADSGAAGFSAAGSASFAQAGTAPGTKGKLGFFASVSGSYLTMAQGDRNTGTNAVREAAF
FT                   TEAGELTLGADYKVADGLVIGVAMSSVRDSANAFGALSPMDNESTSGAIYAAKTFGRGF
FT                   ADAYFGFSDQRYGTARGSVGNATGSFNSAIGNAEGSQNFAGIRMGYAMEPMENVRLGPV
FT                   ASVDYVRSNLGGYREYGAGQFGLNVDDRSFTSIGAKIGAMASLGMKVGQTGVIKAFGSV
FT                   AYARELGDSQDVVTASFVGAADLPFSIARQLDTQWVAVNAGAEMALTNRLSTQLSVTSD
FT                   IGRGELTNNQANMTLNWRF"
FT   gene            282012..282800
FT                   /locus_tag="ELI_01210"
FT   CDS_pept        282012..282800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62334"
FT                   /db_xref="GOA:Q2NDA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA7"
FT                   /protein_id="ABC62334.1"
FT                   /translation="MTGENPRQRSLLQRLAILVAVAWQIGATFLPQLGLGEPIGDRSDS
FT                   VRTLITPSGWAFAIWGPLFFGSAVFALWQILPKQVDNALVAWIGWWAALALAAQGAWAT
FT                   YTQFANLTAISAIIIATSLFGLLAILRIMTHFSRDFTLAERIIVGVTFSALASWLTAAT
FT                   IVNISATLVYHGLAGGFEYPAIAALMVVVGGTIAAAAVVRSKGNPWFAAVFCWAVLAIY
FT                   FRGGQEADSIALACIIAGLLVIGAAIVGLRDAESRRRWFG"
FT   gene            complement(282804..284114)
FT                   /locus_tag="ELI_01215"
FT   CDS_pept        complement(282804..284114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01215"
FT                   /product="hypothetical protein"
FT                   /note="COG1004 Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62335"
FT                   /db_xref="GOA:Q2NDA6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA6"
FT                   /protein_id="ABC62335.1"
FT                   /translation="MKIAMVGSGYVGLVSGACFADFGHDVVCIDKDQSKIDRLHDGIMP
FT                   IYEPGLDALVDANVKAGRLSFTTDLGEGIEGAKAIFIAVGTPSRRGDGHADLTFVHEVA
FT                   REVGKNLANDAVIVTKSTVPVGTGDEVERIIADAGTKHRFAVVSNPEFLREGAAIGDFK
FT                   RPDRIVIGTEDDFGREIMTEVYRPLYLNESPILFTSRRSSELIKYAANAFLATKITFIN
FT                   EMADLCEKVGGNVQDVARGIGMDGRIGPKFLNAGPGYGGSCFPKDTLALLKTAEDYDSP
FT                   VRIIEAVVKTNESRKRAMGRKVIDALGGMDAARGKKVALLGLTFKPNTDDMRDSPAIAI
FT                   AQTLTDAGVNVVAYDPEGMEIAKPLMPEVAMAENSYEAIEGADAVVIVTEWDAFRALDL
FT                   DRVKELAAAPVLVDLRNIYAPSDVRAKGFDYVSIGRV"
FT   gene            complement(284111..284914)
FT                   /locus_tag="ELI_01220"
FT   CDS_pept        complement(284111..284914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01220"
FT                   /product="putative serine/threonine protein phosphatase"
FT                   /note="COG0639 Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62336"
FT                   /db_xref="GOA:Q2NDA5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA5"
FT                   /protein_id="ABC62336.1"
FT                   /translation="MLKSIKKLIRSKSDAPSAFVPEGTRYYAIGDIHGRNDLFEALIKA
FT                   IDKECDKVPELDTQVVLLGDLVDRGPESAKVIENARAWKKRRPVRILAGNHEEMFLQSF
FT                   ENTKVLRHFLRHGGRDTILSYGISPKKYNAATLDELQELLHDLVPKSHRKFIKNFEEMV
FT                   IAGDYVFVHAGIKPKVALEEQARDDLLWIRDRFLAYDQPHPRVVVHGHTIFEDVDEKSN
FT                   RIGIDTGAFRFGRLTALVLEENRRRMIQAVDDNGTIRIEKRDSLV"
FT   gene            285179..286096
FT                   /locus_tag="ELI_01225"
FT   CDS_pept        285179..286096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62337"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA4"
FT                   /protein_id="ABC62337.1"
FT                   /translation="MLTSSRGLAATFLAGTAFVATPVFATETNETVAGSEARPVAQTIE
FT                   IEAIDALIGDGQADAPADAFSVEADALERVIAPVDKPSKAGGDSGVEFSANVALTTEYR
FT                   FRGVDLSGGELAIQGGFDVTLPAGFYVGTWASSLDETTVGYGSTELDVYGGWSGDVTDG
FT                   VALDVGVIGYLYPDAGPGDFDYVEFYGSVAFTFGPAETTLGVAYAPDQDSLGSTDNLYL
FT                   YTDVGIGIPNTPITINGHLGYTDGFLTFTNDGKAWDWSIGAEVAIPDTPLSVSAAYVGA
FT                   EGDIPAGFYDFVDDAFVVTVSASF"
FT   gene            complement(286149..286934)
FT                   /locus_tag="ELI_01230"
FT   CDS_pept        complement(286149..286934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01230"
FT                   /product="putative periplasmic protein"
FT                   /note="COG2859 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62338"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA3"
FT                   /protein_id="ABC62338.1"
FT                   /translation="MSEETRPETMSGDKPFVGEYDGKGGSFLDALTKRWLSTAAVVSIG
FT                   LIAGGYLLGDGLLRAKEADRSVTVRGLAERDVTADLATWTISYASSSTDLAGAQAKVRR
FT                   DTENIRAFFKDLGFPEDALQPTGANVSSYTENGVTKYTVRQRLALRSDDIALAQKAVSR
FT                   QFDLVSTGVFLEEGSGMSYSFTKLNEIKPEMVAEATRDARAAAEQFAEDSGTEVGAIRE
FT                   ATQGYFTIEARDGEAGGWGVADSPFKKVRVVTTINFSIG"
FT   gene            287009..287446
FT                   /locus_tag="ELI_01235"
FT   CDS_pept        287009..287446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01235"
FT                   /product="lactoylglutathione lyase, putative"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62339"
FT                   /db_xref="GOA:Q2NDA2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA2"
FT                   /protein_id="ABC62339.1"
FT                   /translation="MVKYLHSMIRVADPDAAVDFFKLIGLEEVRRFDVEAGRFTLIFLA
FT                   APGQEGVAEVELTYNWPPEDGSEPEDYDGGRNFGHLAYRVDNIYETCQRLMDAGVTINR
FT                   PPRDGHMAFVKSPDGISVELLQEGNLPPQEPWASMENTGSW"
FT   gene            complement(287462..288679)
FT                   /locus_tag="ELI_01240"
FT   CDS_pept        complement(287462..288679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01240"
FT                   /product="Na+/H+ antiporter"
FT                   /note="COG3004 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62340"
FT                   /db_xref="GOA:Q2NDA1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NDA1"
FT                   /protein_id="ABC62340.1"
FT                   /translation="MVDPIRSPLSRAFAPVRALFVSDASAGILLILVAAAAMIVANSPL
FT                   AGAYEEMFYGDLAWTPIAKLDDLHLWINDGLMAIFFFVVGLEVKRELICGQLSSPEQRT
FT                   LPVLAAIAGMAVPAIVYVGVVGTDSALVRGWAIPAATDIAFAMGVLGLLGSRVPASLRL
FT                   FLLTVAIVDDIGAVLVIAAFYTANLKVMWLVIALGIFGVMVGMNKFGVDRIWPYILVAL
FT                   VLWVAVLFSGVHATIAGVMAALTIPMRRKDGHSLLEKLEHGLAPWSAYLVVPIFGFANA
FT                   GVNLSGMGLDAVLAPLPLAIAAGLVVGKQLGIFGIIVAAVKLGIAKAPANANWIEIWGV
FT                   SILTGIGFTMSLFISGLAFTDSRLLIDEAKIGILGGSLISAILGYTILRLTTTHPEERP
FT                   PQTVTP"
FT   gene            288771..289727
FT                   /locus_tag="ELI_01245"
FT   CDS_pept        288771..289727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01245"
FT                   /product="probable inner membrane transmembrane protein"
FT                   /note="COG1215 Glycosyltransferases, probably involved in
FT                   cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62341"
FT                   /db_xref="GOA:Q2NDA0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NDA0"
FT                   /protein_id="ABC62341.1"
FT                   /translation="MNLAGLTAGECLVLVQYELLLFAGLFFLLGALDELIVDAVWLWLR
FT                   LTGRGETIEVRRRERSLPLEGKSAVFIPAWQEANVIGTTVEHMLSAWPQRALRLYVGCY
FT                   RNDPATLAAIVEAAPGDPRLRVVIHDCDGPTTKADCLNRLYRAVEEDEARSGERCRMVL
FT                   LHDAEDMVDPAALELCGRAIASADFIQLPVLPEPQKRSRWIGSHYCEEFAEAHGKAMVV
FT                   RDALMSWSKKRRGRELVVLTYTPNFVVRKTCTVQEKIEFMMKVLLTSGFIGKLVASGSR
FT                   QRLRLFVPFGQDRLHLGCSRFSPCDVAEVRTARFVEW"
FT   gene            290000..290506
FT                   /locus_tag="ELI_01250"
FT   CDS_pept        290000..290506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62342"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND99"
FT                   /protein_id="ABC62342.1"
FT                   /translation="MEEVTTKKKRARVGQRVRMEVVSPVEVNGVVVIPAGSPAEGEITS
FT                   VRNKGMWGKSGHLEAQALFTRVNGRQIRLSGTVDDKGVTGTGGVVASIALVPLAGFFVT
FT                   GTSAVLPKGGEFGAFIDEDVPLAIAASKPAPMVVGAAAEPMSVGNASATAPVTEQTAVS
FT                   DPASK"
FT   gene            290653..290964
FT                   /locus_tag="ELI_01255"
FT   CDS_pept        290653..290964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62343"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND98"
FT                   /protein_id="ABC62343.1"
FT                   /translation="MGIINAIIAEIIKDEKEGATVTNVVKATRIDASDALYIIRSLLKD
FT                   RIIKKVDGDRLVSTNPNVYRRALQINLDNGGSAFDWPERVADGSRADAKPREGVGKDE"
FT   gene            291055..291288
FT                   /locus_tag="ELI_01260"
FT   CDS_pept        291055..291288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01260"
FT                   /product="hypothetical protein"
FT                   /note="COG2987 Urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62344"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND97"
FT                   /protein_id="ABC62344.1"
FT                   /translation="MRVVRRIAIGDRMALQVGAGVWGGAQEGASRLDVGPTVAADLTVA
FT                   KVPLRLSLDYHKRVAGNAQPGNGVALTLSSGF"
FT   gene            291340..292254
FT                   /locus_tag="ELI_01265"
FT   CDS_pept        291340..292254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01265"
FT                   /product="membrane protein"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62345"
FT                   /db_xref="GOA:Q2ND96"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND96"
FT                   /protein_id="ABC62345.1"
FT                   /translation="MDVYLPIANLSVDGLLIIALGALTGVLSGLFGVGGGFLTTPLLIF
FT                   YGIPPTVAAASAATQVTGASVSGVLAHQRQGGVDYRMGLVLVAGGVFGAMIGALLFRLL
FT                   QALGQIDVVINVLYVLMLGTIGGLMMREALDAILARDKSAAKQAAKRRHHPLVAALPYR
FT                   WRFYGSGLYISPLAPLILGFLVGILTMLMGVGGGFMLVPAMLYILGMSGRVVVGTSLFN
FT                   ILFVTMATTMTHALTTKAVDLVLAGLLLIGSVMGAQFGTKVALKARPDILRLVLATIVI
FT                   LVALRMLFGLGVQPDEIYSVDAL"
FT   gene            292251..293000
FT                   /locus_tag="ELI_01270"
FT   CDS_pept        292251..293000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62346"
FT                   /db_xref="GOA:Q2ND95"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND95"
FT                   /protein_id="ABC62346.1"
FT                   /translation="MKRTLILMLALFGLTGQSDPVLVPEVSQHRIELRQGFVGTELLLF
FT                   GAILDPSQRQNDFDIVVVLKGPAEPIRLREKEQIGGIWMNADSMDFRSAPAFFAVASSR
FT                   PIDEIVDDRTAAIFEFGTDFIQLSPSGAINPDEQARFRNGLVDLRERQQLYKQDFGGVE
FT                   VREGVLYQARISLPSNVQTGTYTAETFAVSRGRVIASAIAEVEVEKVGFERFVEVFAQY
FT                   QSFLYGLTAIMLSVGMGWLAGRLFAMI"
FT   gene            293091..294776
FT                   /locus_tag="ELI_01275"
FT   CDS_pept        293091..294776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01275"
FT                   /product="hypothetical protein"
FT                   /note="COG0433 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62347"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND94"
FT                   /protein_id="ABC62347.1"
FT                   /translation="MTDMGNQDIRAAAPAGEAQGARSAARAADNAAKPIGVVLEIAGSG
FT                   SQIALDLQRLNECMKDEDPSIALAGQVGSQIKIKVGDSWLLASVRNQRQDRRQNGGIIA
FT                   NIDFLGEGQEEKLTGRIHSFKRGVTRYPVPGAYIYPASTADLKMVYASDGRSNIQIGTV
FT                   YPTKDIRAGIYVDAMLGKHFALLGSTGTGKSTSAALILHRICEAAPAGHIVMVDPHGEY
FT                   SAAFKNTGMILDVSNLQMPYWLMNFQEHCEVLLTSNGDDRQVDEDILAKCLLRARSKNR
FT                   LAESLGKITVDSPIPYLLSDLSTAIADEMGKLDKATSSAPYMRIKNKLEELKSDPRYQF
FT                   MFSGMLVGDTMADFIAKIFRMPSDGKPIAIIDVSGVPSDITSTVVAVLSRLVFDYAIWA
FT                   REERTRPILLVCEEAHRYVPSEKNADGSSVGDILSRIAKEGRKYGISLGLITQRPSDLA
FT                   EGVLSQCGTIISMRLNNERDQAFVKAAMPEGARGFLDSIPALRNRECIVCGEGVAIPIR
FT                   VSFDNLEESKRPASEDPSFVELWNQSGGEEDSVQRVVHRWRAQG"
FT   gene            complement(295038..295775)
FT                   /locus_tag="ELI_01280"
FT   CDS_pept        complement(295038..295775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01280"
FT                   /product="coenzyme PQQ synthesis protein, conjectural"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62348"
FT                   /db_xref="GOA:Q2ND93"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND93"
FT                   /protein_id="ABC62348.1"
FT                   /translation="MAQLTLATDDTGGPEIFASVQGEGLSAGAPVAFVRLSRCNLACVW
FT                   CDTAYTWHFEGDTRPHRSGETFERKANQVSLDPADVAERIAALGQKRLVITGGEPLMQG
FT                   GPLAELLELLPDMTVEIETNGTTKAPPRLDIRIDQYNVSPKLAHSGNPAELALITERLD
FT                   SYALDDRAFFKFVIAEPSDVEEVLTLQRAHAIPAKRIFLMPEGTDSETLREREQWLVPL
FT                   CLEHGFRMSDRLHIHLFGDTRGT"
FT   gene            complement(296129..296941)
FT                   /locus_tag="ELI_01285"
FT   CDS_pept        complement(296129..296941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01285"
FT                   /product="hypothetical protein"
FT                   /note="COG3228 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62349"
FT                   /db_xref="GOA:Q2ND92"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND92"
FT                   /protein_id="ABC62349.1"
FT                   /translation="MSPWLALSIPLLIVAALLYRRQSRLRKRRELLATPLTPQQRAVVE
FT                   RLVPLVKRLPRELQAKLEGKINLFLDQVTFRGLNDLEVREEMQLSIAAQACLLVVNSPV
FT                   WYDTIRNVLVYPSAFLTNRDTQDGHFVHEGRHATLGESWARGPVVLSWDDALQGGLDAT
FT                   DGHNVVIHEFAHQLDALSGHTNGIPILRRGQTYARWEKAMLDAYNDHVARLERGERTLI
FT                   DPYGGTNHQEFFAEAIVTFFEKPTGLKREEPALYAQLVELFALDPAEW"
FT   gene            complement(296980..297564)
FT                   /locus_tag="ELI_01290"
FT   CDS_pept        complement(296980..297564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01290"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="COG0525 Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62350"
FT                   /db_xref="GOA:Q2ND91"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND91"
FT                   /protein_id="ABC62350.1"
FT                   /translation="MPFITEELWHAQGTTSGRERPYELILAQWPNPRAEVSKEATDAID
FT                   WVIDLTTNVRSAKNELGIPPGEKLAAFVPSPSDLAASTIERSSAAIERLARLTPVTVGE
FT                   APSGPAMQVTALSDVFVIPLEGIIDIEAEKTRLSKALEASQKEVKSLDGRLSNPHFVER
FT                   AKPEAVEKAKADHAHHSAEVERLQTALARLG"
FT   gene            complement(297492..299828)
FT                   /locus_tag="ELI_01295"
FT   CDS_pept        complement(297492..299828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01295"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="COG0525 Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62351"
FT                   /db_xref="GOA:Q2ND90"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND90"
FT                   /protein_id="ABC62351.1"
FT                   /translation="MSTALPTTFDPAAIEARWYRHWEENGCFRPERPDAEPFTIVNPPP
FT                   NVTGSLHIGHALDNTLQDIVIRYERLRGKDSLWVVGTDHAGIATQMVVERQLEDKQDKR
FT                   TNYTRDEFNDIVWKWKAESGGTITRQLRRLGCSMDWSREQFTMDEHFTKAVLKVFVDLH
FT                   NDGLIYRDKRLVNWDPKLKTAISDLEVEQQTIPGHFWHFKYPLADGVTLDSGQDYIEVA
FT                   TTRPETMLADMAVAVHPSDERYASVVGKHVVLPLTGRRIPIVADEHADPELGSGAVKIT
FT                   PGHDFNDFEVGKRAGIAAGEMLNMLDGDANVCQTADGLVPEEFIGLHRFKRGNIAGEDT
FT                   GARELVVKRLKEQGYLIPHIAKTKKGEEVEMDAEPRQIATPFGDRGGVVIEPWLTDQWY
FT                   VNAEELAKKPIEAVKSGEIEIVPKAWEKTFFNWMENIQPWCVSRQLWWGHRIPAWYGDN
FT                   GECYVAMSEEEAQAQAGDGVTLTQDSDVLDTWFSSALWPFATLGWPDETALLEKHYPND
FT                   LLISGFDILFFWDARMMMAGYYNTGLKPWPKLYLHGLVRAADGAKMSKSKGNVVDPLGL
FT                   IDQYGADALRFFMAAMESQGRDIKMDQSRVEGYRNFATKLWNATRFCQSNGIGASTTIK
FT                   APPARLAANQWIIGEVQQVCEEIEQAMADLRFDAAANAIYQFTWSRFCDWYLELIKPMF
FT                   AEKPSPLEGRGLGEGNEDSASQPPPPRPPSPEGEGSGRPPPKRAKSPAGRSTKSSSCYT
FT                   PSCPSSPRSCGMPKEQQAGVSGPTN"
FT   gene            299921..301033
FT                   /locus_tag="ELI_01300"
FT   CDS_pept        299921..301033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01300"
FT                   /product="ABC-type transport system permease component"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62352"
FT                   /db_xref="GOA:Q2ND89"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND89"
FT                   /protein_id="ABC62352.1"
FT                   /translation="MSEGASFSLQEQDDGTTVLRLAGPYLVSTIGPIDQDLRALEGGFS
FT                   AVDLGDVSQIDTVGAWMACTVAGAHDAEIRNASDRASRLIDAVQGSINKAETTPERDPL
FT                   FRRVAMMTGERVVEFGHNLLDLLSFAGAIVAGFGRLLLHPGRFPHKALFRQLELVGINA
FT                   LPIIGLMSFLIGIVIAQQGAVQLEQFGAETLTVNLVGRITMRELGVLMTAIMVAGRSGS
FT                   AFAAQIGTMKLTEEVDAMRTIGISPVEALVLPRILAAVLMMPLLGFYSACVAIVGGAVV
FT                   SEFALGIPFWNFLERIQDVVPTYDLWVGLIKAPVFGLIVALAGCYQGMQVRGNSEEVGS
FT                   RTTKAVVQAIFMVIVLDAFFAVFFTEIGWG"
FT   gene            301034..301882
FT                   /locus_tag="ELI_01305"
FT   CDS_pept        301034..301882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01305"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62353"
FT                   /db_xref="GOA:Q2ND88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND88"
FT                   /protein_id="ABC62353.1"
FT                   /translation="MSDAAYHHDTPISVRGLKNQFGSTVVHEDLDLDVRKGEILGVVGG
FT                   SGTGKSVLMRSIIGLQRPTEGEVEVFGNSITEADPDTEIGVRSRWGVLFQGGALFSTLT
FT                   VAENVQVPLKKFYPDIEPEVMNEIARYKVVMSGLPEDAASKFPSELSGGMKKRAGLARA
FT                   LALDPELLFLDEPTAGLDPIGAAAFDDLTRELKETLGLTVFLITHDLDTLYEICDRVAV
FT                   IADKKVIAVGTIPELLETEHPWIQEYFNGPRGRAAKASQDRANRAKTGDMDNSARSGSK
FT                   G"
FT   gene            301886..302836
FT                   /locus_tag="ELI_01310"
FT   CDS_pept        301886..302836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01310"
FT                   /product="ABC-type transport system periplasmic component"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62354"
FT                   /db_xref="GOA:Q2ND87"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND87"
FT                   /protein_id="ABC62354.1"
FT                   /translation="METRANHIWVGAVSLALLAALAAFIIWIARFNEGNQNEYDIFFQQ
FT                   SVSGLATGSQVSFAGVPVGQVSQIALWERDPEFVRVRIRVQEEVPILIGTTATIQGSFT
FT                   GVSTILLDGARAGAPPIACDEASACPEGVPVIPTKPGGLGELLANAPLLLERLATLTER
FT                   LTLTLSDDNQAALTGILANTNAMTEDLARATPRIEATLAELEITLREAGETLDAFESVT
FT                   QSTDQLINQEGQALAVELRGTLKSAAGALDSLGKTLEEAQPAARQLNNQTLPAANATLQ
FT                   DLRETSRALRAVTERLENEGAAGLVGSPKLPDYEP"
FT   gene            302845..303438
FT                   /locus_tag="ELI_01315"
FT   CDS_pept        302845..303438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01315"
FT                   /product="hypothetical protein"
FT                   /note="COG3218 ABC-type uncharacterized transport system,
FT                   auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62355"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND86"
FT                   /protein_id="ABC62355.1"
FT                   /translation="MMRFASRTALGLAAALSLAGCLSFGSEPPESLLTLTPERTASAGQ
FT                   PTQGTGQTALTVVEPTAPQRLSVNRVPVQVDDANVAYLKDAMWVEKPTRLFRRLLSETI
FT                   RASGNRVVIDGFDPTIATGDQLRGSLVDFGYDARTSSVIVTFDAVREGSGDVITTQRFT
FT                   SVVPGVAAEAGPVGDALNEAANDVAQQVADWVGG"
FT   gene            303637..303906
FT                   /locus_tag="ELI_01320"
FT   CDS_pept        303637..303906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01320"
FT                   /product="hypothetical protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62356"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND85"
FT                   /protein_id="ABC62356.1"
FT                   /translation="MKEWHMTHYGKIKSYDSSSGTGSITAEKGGDVLRFKKADLQQEGQ
FT                   MPKVDQRFSYETSEVDGGKKQAVNLQHQQGDGQSQKDQASAQQG"
FT   gene            303985..304206
FT                   /locus_tag="ELI_01325"
FT   CDS_pept        303985..304206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62357"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND84"
FT                   /protein_id="ABC62357.1"
FT                   /translation="MNRFLFDHQLAAMKVDRSGSADERMRAADLLGGRAKRIADWRKAN
FT                   GLSELGWPREERLPVAEICRGEQDVRNS"
FT   gene            complement(304436..305134)
FT                   /locus_tag="ELI_01330"
FT   CDS_pept        complement(304436..305134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01330"
FT                   /product="chaperone"
FT                   /note="COG5387 Chaperone required for the assembly of the
FT                   mitochondrial F1-ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62358"
FT                   /db_xref="GOA:Q2ND83"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND83"
FT                   /protein_id="ABC62358.1"
FT                   /translation="MKKFWKEVSVEQVDGGYQVALDGRGIRTQGKRPQIVQTAALAELL
FT                   ADEWRAQGKDIDPASFPHRDMADYAIDRIATAADDIPAKLIGFMETDTLCYRADPDEPL
FT                   YKRQLDMWEPLVTAFEMREDIRVERASGIIHKPQPPESLAKLRARIDALDPFTLAALFA
FT                   TTSLSASLIIGLGTLEADADSETLWDAANCEEDWQVELWGDDFEAADRRARRKRDFLRA
FT                   VEFARASATP"
FT   gene            complement(305131..305346)
FT                   /locus_tag="ELI_01335"
FT   CDS_pept        complement(305131..305346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62359"
FT                   /db_xref="GOA:Q2ND82"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND82"
FT                   /protein_id="ABC62359.1"
FT                   /translation="MDDQEKLARQRFMLLQIIRLGGAAMAMIGAVIISGRWIDSPELGY
FT                   VLLVLGALEFFIVPNLVAKSWHAPDP"
FT   gene            complement(305339..305995)
FT                   /locus_tag="ELI_01340"
FT   CDS_pept        complement(305339..305995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01340"
FT                   /product="hydrolase, haloacid dehalogenase-like family
FT                   protein"
FT                   /note="COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62360"
FT                   /db_xref="GOA:Q2ND81"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND81"
FT                   /protein_id="ABC62360.1"
FT                   /translation="MTARLAVFDCDGTLVDGQGAVCDAMEAAFAAASLPAPDRRDVRQI
FT                   VGLSLPQAIRMLAREASDDQVAQAVDAYKASFFEARQQGRVHEPLFDGIVPLLDRLGTG
FT                   GWALAVATGKSNRGLHTVLTQHGLIERFASLQGADHHPSKPHPAMLHVAMEEAFAEPAA
FT                   TVMIGDTTYDIEMGRAAGTRAIGVAWGYHPREALLDAGAEAVAETPEQLGDMLDG"
FT   gene            complement(305992..307191)
FT                   /locus_tag="ELI_01345"
FT   CDS_pept        complement(305992..307191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01345"
FT                   /product="pseudouridylate synthase"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62361"
FT                   /db_xref="GOA:Q2ND80"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND80"
FT                   /protein_id="ABC62361.1"
FT                   /translation="MTRRQDPDGVRQFTVEADDEGVRLDRWFKRNLPQVGFGTISRWAR
FT                   TGQLRVDGKRARPEDRLAAGQVLRIPPGGEDPERNPRARKPLSPEQVRMAQDMVIKETK
FT                   SAIVLNKPPGLATQGGTKTTKHVDGLLDAFVDGEDDPRPRLVHRLDKDTSGVLLIARTP
FT                   GSAAAYSKRFAGRSAKKVYWALVVGVPDLHEGEIDAPLAKQPGTGGEKMHVDEENGQPA
FT                   KTRYRVVERAGNRACWVELEPMTGRTHQLRVHMAAMGHPIVGDGKYGGQDAFLTGSVSR
FT                   KMHLHARRLIIAQPAENGKSGGKLDVTADLPEHFAASMEQLGFDISLSKARPLREDITE
FT                   KTPAEKKQAARQHAKQYRKSQRSPRRARGGDTTRKLGKKSGGAKVKRGRKPGGPGGKKK
FT                   "
FT   gene            complement(307188..307598)
FT                   /locus_tag="ELI_01350"
FT   CDS_pept        complement(307188..307598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01350"
FT                   /product="hypothetical protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62362"
FT                   /db_xref="GOA:Q2ND79"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND79"
FT                   /protein_id="ABC62362.1"
FT                   /translation="MSTLPPLYATLNVALGGAIGAVLRYQMGRWMTGWLGAPAMSVFPW
FT                   ATLAINALGSLLMGVLAGVLFKLSPGVQDQWRLLIGTGILGGFTTFSAFSLEVWVMVER
FT                   GQPAFAALYVVLSVSLAISALVFGLMLTRLFA"
FT   gene            307811..308017
FT                   /locus_tag="ELI_01355"
FT   CDS_pept        307811..308017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01355"
FT                   /product="ribosomal protein S21"
FT                   /note="COG0828 Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62363"
FT                   /db_xref="GOA:Q2ND78"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND78"
FT                   /protein_id="ABC62363.1"
FT                   /translation="MQIMVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAR
FT                   EKAAAVRRARKMERKRMERDGIK"
FT   gene            308148..308741
FT                   /locus_tag="ELI_01360"
FT   CDS_pept        308148..308741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01360"
FT                   /product="possible peptidyl-prolyl isomerase"
FT                   /note="COG0545 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases 1"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62364"
FT                   /db_xref="GOA:Q2ND77"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND77"
FT                   /protein_id="ABC62364.1"
FT                   /translation="MTEVTRVPLQPIAKGSLTKLWLGVIVAVLIGAGVAWAAVPKGVSV
FT                   ETITAGSGGSPSIGDVAFVKYKGTLADGTVFDESGPSPFPPGIFPEGTPFLLEEGQVVD
FT                   GFLIGLQQMEKGGTYELYIPSEFAYGDEPRPGSPIPPGADLTFEVELVDFMSREDAERR
FT                   VMAMQQAMEAQQGGEGGVAPPPPPQQVPGPPPQN"
FT   gene            308772..309074
FT                   /locus_tag="ELI_01365"
FT   CDS_pept        308772..309074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01365"
FT                   /product="glutamyl-tRNA(gln) amidotransferase subunit C"
FT                   /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62365"
FT                   /db_xref="GOA:Q2ND76"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND76"
FT                   /protein_id="ABC62365.1"
FT                   /translation="MSVDKETVAKIASLARIKMTDAELEKMAPELSNILDWVEQLGEVD
FT                   TSDVEPMTAVIPNTLRLREDEVNADPLTGGGVRDKVLANAPAAEHGFFGVPKVIE"
FT   gene            309071..309187
FT                   /locus_tag="ELI_01370"
FT   CDS_pept        309071..309187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62366"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND75"
FT                   /protein_id="ABC62366.1"
FT                   /translation="MKTAGFHSIIPDSGAAATDRGSRNKGKLDSRLRGNDEV"
FT   gene            309184..310671
FT                   /locus_tag="ELI_01375"
FT   CDS_pept        309184..310671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01375"
FT                   /product="glutamyl-tRNA(gln) amidotransferase subunit A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62367"
FT                   /db_xref="GOA:Q2ND74"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND74"
FT                   /protein_id="ABC62367.1"
FT                   /translation="MSSELTELGVADIRDGVADGSFTAREVAEAFNAQVAAAKDLGAFI
FT                   VETPEKALEAAAAVDAARANGETLGSMAGVPIGMKDLFCTDGVQTTAASHILEGFVPQY
FT                   ESTVSANLWRAGAGMLGKLNMDQFAMGSSNETSYFGPVKSPWRKAGSNTALTPGGSSGG
FT                   SSSAVAARLCPAATGTDTGGSIRQPAAITGTTGIKPTYGRCSRWGVVAFASSLDQAGPI
FT                   ARSVRDCAIMLEAMAGFDPKDATSLDMPVPQWEAGLSADLSGKKIGIPREYRMDGTPQD
FT                   ILDSWERGKKWLKDAGAEIVDISLPHTKYALPAYYIIAPAEASSNLARYDGVRYGLRDL
FT                   PDGAGLQDMYAATREEGFGDEVKRRILIGTYVLSAGFYDAYYNQAQKIRTLVARDFEQA
FT                   WAECDLILAPTTPNAAFGLGEMQADPLAMYLNDVFAVPASLAGLPAISVPGGLNSDGLP
FT                   LGLQLVGKPFDEQGVLNAGLAIEQRNGFTARPETWWA"
FT   gene            310659..311756
FT                   /locus_tag="ELI_01380"
FT   CDS_pept        310659..311756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01380"
FT                   /product="hypothetical protein"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62368"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND73"
FT                   /protein_id="ABC62368.1"
FT                   /translation="MVGVTSSSVGPSFGIVYTVKNEARLLPDALKWHRTLGAQRFYVFL
FT                   DGTTDSMRDWLDKQRDVMVRESVPPDEVRDAPGFSKKLAKGWGSFIDARKNLNAWVAAR
FT                   LALKDGIAWLAMIDPDELLLPDPSGGVDPIAMQSLLAGQEPDVAQVLLPNCDVLPDGAA
FT                   RAYPFAHRHFQARFPALEAAWRTSRKALSVVSNPLKVARYDQWYWDKALGRDLPRRLFH
FT                   PETGEAIPAGYFLSYSSHKSILRTRLARGWLPTIHHWKKGDGEGETVKAKRAKMLHFDF
FT                   TDAESYLHKFGQRRGNREERPVHFAARRAIGDIALDCNEADARRFFDECLTVSDPARIA
FT                   HLVKRGVALDLPQVERFFVGEGGAA"
FT   gene            311753..312583
FT                   /locus_tag="ELI_01385"
FT   CDS_pept        311753..312583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01385"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62369"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND72"
FT                   /protein_id="ABC62369.1"
FT                   /translation="MKLFRPYLWGGRIIKLARRLGMDVMPTLTRDHRIAGARLAWREEE
FT                   PGLLRGAVVEGAHDGVPIRLFVANDLDVIQQVHRKGEFYEPEELAIIKSAWDQRLGGGT
FT                   FLDVGANVGNHALFAALVLGADRVIASEPQEVAARIFETNAALNHVANRIELHRVGLSD
FT                   SAGQARLQSTSNNLGAARLEQGEGGIDLVTGDALVGEQAIGFIKIDTEGFELPVLRGLT
FT                   ATIARDHPPLFVEVETENLAAFEQFCAEHGYAVTERFQRYETSVNCLAIHQENS"
FT   gene            312594..314090
FT                   /locus_tag="ELI_01390"
FT   CDS_pept        312594..314090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01390"
FT                   /product="glutamyl-tRNA(gln) amidotransferase subunit B"
FT                   /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62370"
FT                   /db_xref="GOA:Q2ND71"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND71"
FT                   /protein_id="ABC62370.1"
FT                   /translation="MSTYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGASTEFGAEPNA
FT                   QVSLVDAAMPGMLPVPNRECIRQAVRTGMAIEAQINTWSRFDRKNYFYADLPQGYQISQ
FT                   LYHPLVGEGQLLIEADEKAGISEDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRCGV
FT                   ALMEIVSRPDMRSPAEAGAYVRKLRAILRYVGSCDGNMEEGSMRADVNVSVRRPGEEFG
FT                   TRTETKNVNSVRFVMQVIEYEANRQVDLIESGGAVEQETRLFDPGTGTTRTMRSKEDAH
FT                   DYRYFPDPDLLPLELEDSFLDECRASLPELPDAKRQRYENELGLTPYNARELTAEVETF
FT                   ARFETLLAATAKAIGEDEKKVATQVANWALSVAPGVIKSLGDEAHVENATAERQAAILK
FT                   MQDAGEISGGQAKEIFEIVLKEGGDPATIADEKGLKQVSDTGAIEAAIDEILANNEDKV
FT                   EQYKCGKDKLFGFFVGQTMKAMQGKANPAVVNQILKDKLG"
FT   gene            314097..314555
FT                   /locus_tag="ELI_01395"
FT   CDS_pept        314097..314555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01395"
FT                   /product="putative RNA methylase"
FT                   /note="COG0219 Predicted rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62371"
FT                   /db_xref="GOA:Q2ND70"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND70"
FT                   /protein_id="ABC62371.1"
FT                   /translation="MTAIVLVHPEIPGNTGAVGRTCVALDMELVLIHPLGFAIDDKRVK
FT                   RSGLDYWPHIRLVECASWDAFLAERAPRADQLFLFEEYAPRSFYEPDYPKDAYLVFGRE
FT                   TKGLPQGIVAAHRAQMVSLPMRSDKVRSLNLANTVAAAAYQAMRGQLS"
FT   gene            314591..314827
FT                   /locus_tag="ELI_01400"
FT   CDS_pept        314591..314827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62372"
FT                   /db_xref="GOA:Q2ND69"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND69"
FT                   /protein_id="ABC62372.1"
FT                   /translation="MRWAFMIFIGLYALALFLLAVGTFGWFGQEQDPLSGVFLVPLGLP
FT                   WNWLGDKAGLAGPALAILAPVINAGILYWLWRR"
FT   gene            complement(314834..315367)
FT                   /locus_tag="ELI_01405"
FT   CDS_pept        complement(314834..315367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62373"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND68"
FT                   /protein_id="ABC62373.1"
FT                   /translation="MCRRLGESAATSNYLDDSAILIGCPTEAAAKALSGEIVATIEGVR
FT                   LVSISTGDANAGMGETGPVTGTTDDALVAGTDYNATASIQCGFANAAPTRSCAAGVKRN
FT                   WSERPGEHLVEVTKPDGRKRAIFFRGTEPFGADSAQSDGSAGWDFETSRDGDKVTISYG
FT                   PETYVIVDALITGG"
FT   gene            complement(315544..316338)
FT                   /locus_tag="ELI_01410"
FT   CDS_pept        complement(315544..316338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND67"
FT                   /protein_id="ABC62374.1"
FT                   /translation="MKRIAKYAVAGAAMSAVVATPVLAEKASQLVDINGMFGRDAESAL
FT                   RDRGFAHISTHKNTMGYVYSYWWNESDDDCVQVEVYNGRVETIQDATDQDCGHHEGSNA
FT                   AAAVGVVAGAAILGALLGHKSHHHDDGKHHDDYATEQQYDRGYQDGLHNASYHNYDRSD
FT                   SYANGYEAGVEEREANLRHHKRRGGYSPTAQFNDLSGARASSGMDALEQRGFRQVDNFT
FT                   SGNTRYSIQWRGQSQQCLQVTIADGRFYDIRDIGQHPNCRGR"
FT   gene            complement(316641..316946)
FT                   /locus_tag="ELI_01415"
FT   CDS_pept        complement(316641..316946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62375"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND66"
FT                   /protein_id="ABC62375.1"
FT                   /translation="MSVAGTYNTVVKSPMGDQSGTFTVVPGDDGDTFTGSMAGGMGSMD
FT                   VENGKIDGNKLTWDMNMTVPMPMKLECEATVEGDQLTGNVNAGAFGAMPLTGERQG"
FT   gene            complement(317005..319857)
FT                   /locus_tag="ELI_01420"
FT   CDS_pept        complement(317005..319857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01420"
FT                   /product="predicted Zn-dependent peptidase"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62376"
FT                   /db_xref="GOA:Q2ND65"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND65"
FT                   /protein_id="ABC62376.1"
FT                   /translation="MLRFASTSLAAIAIATSVPALADNHAAKPEAAATSAEAIAPLPDL
FT                   IDEVAIPYTQFELDNGLTVIVHEDRKAPIVGVAMWYNVGSKDEPEGKTGFAHLFEHLMF
FT                   NGSENAPGDYFQYLQEMGATDYNGTTSFDRTNYFQTVPSGALERALWLESDRMGYLLGA
FT                   VTQEKLDNQRGVVQNEKRQGDNQPGGLVFYEIVETLFPKPHPYGHTPIGSMADLDAASM
FT                   EDVRAWFRDKYGPNNATLVLAGDISADEARPLVEKYFGAIERGPVNTPAAAAIPELDED
FT                   VRTVMKDQVAATNISRYWTAPGLDSRDLVALTVGAEILGGLSSSRLDNALVRDEQIAVG
FT                   VSAGNFSFQRVGVLNVGATVKPGEDAAKVEARMDEIIAELIAEGPTEDEVRRAATQQVA
FT                   STIRGLEQVGGFGGKAVTLASGEVFVDDPEFYAKQLEILATLTPAEVQAAMQRWMTRPA
FT                   MTLVLEPGEREDDYEEAASVGDSEDADADPADNTLTVSVERPKPEIETLAELDFPTVQE
FT                   TTLSNGMKVYYAQRDAVPVTRVAISFDAGSAADPVAKRGLEGLAMSLYDEGTTTRSSRE
FT                   IAEERERLGAVISTGGGSDRSTFTLTALTANLAPSLDLMTDIVRNPAFDEGELRRVKAQ
FT                   TITGIQQQMRTPQGIANMTLTPLLYGEDSPYGDSGSGTVESVSAITRDDLVMFKNRWIQ
FT                   PDNAELFVVSDMALEDIKPALDEAFGQWAANRMARGLKDFSTIAEAPEQTRIVLVNRPN
FT                   SPQSFIYGGMITNARAQDAGIVDLLNANNALGGNFLARLNMNLRETKGWSYGVRGGVSQ
FT                   REGAVGYLVSAPVQADRTGDSLAELRREIGEFLTDRGVSEDELVRIVNNEIRELPGQFE
FT                   TSGAVLNAMQTNALYDRPMDYYETLSERYTNQTTESLDAAAREALDLDRFTWVVVGDAE
FT                   KVRPQLETLGLPIEQIELEQ"
FT   gene            complement(319908..322139)
FT                   /locus_tag="ELI_01425"
FT   CDS_pept        complement(319908..322139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01425"
FT                   /product="penicillin amidase family protein"
FT                   /note="COG2366 Protein related to penicillin acylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62377"
FT                   /db_xref="GOA:Q2ND64"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND64"
FT                   /protein_id="ABC62377.1"
FT                   /translation="MLRIGGGVLALVLVVLVGLMTWEPFFARETAAPSTHRTYRAEILR
FT                   SDYGVPHIYGETDADVAYGVAIAQSEDDFFTLQDVVAMSKGRYGAIAGPDGAQVDYVYY
FT                   LLDARGTAERQYGSLPADTRAIFDAYATGLNQYAEENPDELKLAGLFPVNGEDVAAGFA
FT                   LRQPFFFGLAGVIGQLSDNKPPRREFGPDIPGFPREGSGGDEIEVERKPAQTARAMPLP
FT                   WGEMAALSGSNAFAVAPEKSGEGTILISNSHQPLEGGVAWYEMVVESGEGWHFTGANFP
FT                   GSPFPFLGHNRTLGWTNTVNRPDMVDIYELVLNEDGTQYRLDGEWRDLEAREVTLPVKL
FT                   GPLVLPIRETVYRSVHGPVIVNDNGAFAMRYGGIDNIDQLDAYYRLNKASTLEEWQAIL
FT                   SRMDVPSTNFIYGDAEGNIAMVYNAAIPDRPEGHDWRGILPGDRSDLIWDGPVDYAAIP
FT                   KYVNPASGWLMNANNTPFRAAGPDSDLSPDSVSPYLGVELKQTNRSRRAWKLMSEAGRL
FT                   DNDTLRRIKYDTAYEREGYVADLWDALEQFEPGDADLGEARRILLEWDFTADNVGPGDA
FT                   LALLMIRDFMSAEYQNKAEAPDVATHLRKAVDHLQEHFGRLDPPMSELLRLRQDPGLHA
FT                   VDLPLDGGSDTLRASTTWQVDPDGRLRLVHGDSFIQWVEWRPGERVRSRSVQPFGAAIT
FT                   RPDSPHFTDQATLFVQKKLKPVHFWREDALANARSRKIVTNQKAVTSRN"
FT   gene            322281..323720
FT                   /locus_tag="ELI_01430"
FT   CDS_pept        322281..323720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01430"
FT                   /product="predicted ATPase"
FT                   /note="COG0433 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62378"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR014588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND63"
FT                   /protein_id="ABC62378.1"
FT                   /translation="MQAEITIGHEAGKKPVLFDVEELLATRLLVQGNSGSGKSHLLRRL
FT                   LEESAEMVQQVVIDPEGDFPSLAEKFGHVVIDGSAYSPPEIEALARRIREHRASVVLDL
FT                   DGLEVEQQIRCAAQFLNALFEAPREHWFPALVVVDEAQMFAPSVAGEIGEDTRRMTLSA
FT                   MTNLMCRGRKRGLAGIVATQRLAKLAKNVAAEASNFLMGRTFLDIDMQRAADLLGMERR
FT                   QAERIRDLERGHFLALGPAISRRPVAVKIGPVQTGHQARAEGLVPLPNAPSGGMEALLT
FT                   GDLTADVQGTSPPPPPPPAPKPAELVPDTPAVATTGEPAAGDSVDRDAELAALLEALAR
FT                   EDGATFQSASRLYQTFLTRARAEGFLGVPIDMAAFRRQFAIASARLERLDEPTRARVLQ
FT                   LGAHVDDDILAPYLAIAAAASQGLSAPEDEELARVYGTSSPGRIRRLLDHLEKLGLIVV
FT                   REEFGGGRSLLVPGLESQPAE"
FT   gene            323867..326446
FT                   /locus_tag="ELI_01435"
FT   CDS_pept        323867..326446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01435"
FT                   /product="ATP-dependent Clp protease"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62379"
FT                   /db_xref="GOA:Q2ND62"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND62"
FT                   /protein_id="ABC62379.1"
FT                   /translation="MNLEKFTDRAKGFLQAAQTVAIRMSHQRITPAHLLKAMIEDPEGM
FT                   ASGLIARAGGNPRTVEDEVDAALGKIPAVSGGGAQQTPGLDNDTVRILDQAETIADKSG
FT                   DSYVTIERLLVALALATTTSAGQALKAANVDAKTLEAEISELRGGRTADSANAEEAYDA
FT                   MKKYARDLTEAAREGKLDPVIGRDEEIRRTIQILARRTKNNPALIGDPGTGKTAIAEGL
FT                   ALRIANGDVPDSLKGRTLMSLDMGSLIAGAKYRGEFEERLKAVLDEVKGADGQIILFID
FT                   EMHTLIGAGASEGSMDASNLLKPALSRGELHCIGATTLDEYQKYVEKDPALQRRFQSVY
FT                   IDEPSVEDTISILRGIAEKYELHHGVNITDGALVAAARLSDRYIQNRFLPDKAIDLMDE
FT                   AASRIRMEVESKPEEIENLDRRIIQLKIEEQALEKETDSASKDRLETLRKELSELEQKS
FT                   SELTTRWQNERDKIQGETRIKEELDQARIELEQAERSGDLAKAGELSYGRIPELEKKLE
FT                   EARATTENALLKEEVTEDDIASVVSRWTGIPIDKMLEGERDKLLKMEELLSKRVIGQEE
FT                   PIIAVSKAVRRARAGLQDPGRPLGSFLFLGPTGVGKTELTKALAGFLFDDDDAMVRIDM
FT                   SEFMEKHSVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVVLFDEVEKAHTDVFNVLLQV
FT                   LDDGRLTDGQGRVVDFSNTLIILTSNLGSQYLANMEDGQKVSDVEPQVMDVVRGHFRPE
FT                   FLNRLDEIILFHRLSMEHMAPIVDIQVGRVQKLLADRKIVLDLTDAAKRWLGRVGYDPV
FT                   YGARPLKRAVQRYVQDPLAELLLEGKVPDGSTVKIDEGDGELEMEVA"
FT   gene            326816..330274
FT                   /locus_tag="ELI_01440"
FT   CDS_pept        326816..330274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01440"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62380"
FT                   /db_xref="GOA:Q2ND61"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND61"
FT                   /protein_id="ABC62380.1"
FT                   /translation="MNKNRINSVKGLTLSASIVALAVSGPAFAQTVGTPEPLEGDECAL
FT                   SADGTLPEGCEDEQTPDITSNPEDVVPPEGQIVVTGSRLKRDTFTSISPLQVLQTEQSR
FT                   DAGLFDPSQILQRSESAAGTQIDATFQGFVLDNGPGSQTLNLRGLGADRTLLLVNGRRL
FT                   APAGVEGAPTVPSINLLPGSLIERYDLLLDGASSIYGSDAVAGVGNIILRKDFDGLELF
FT                   ARGEINPEGAGEDYTLSAAWGVNGDRGFFGIGAEYDYRDAVRLRDRDFFSGCDTHREID
FT                   ESGNLLTLGVADNAVVQNRTPGVSVSESECKIGGISGRIFQPFARFGSVYFPANGNIAN
FT                   FPRDPRTGRPFNFGESTNFFGTDLDSNGDGIRDVDFQNVNTNGANLDQTFLSEQKLFNV
FT                   MAYGEYTFPSEVNLTPFFEVNYSRAEIFSDNTGFPQLFPSVPDLNPFNPCNFITNPDGV
FT                   DCRAVDNALQAQAGRPFRPLSTGFPLPTSPIVSVVGDRNNVDIVQEQFRAVVGIRGDAP
FT                   IFGPSWTFETSLVYSRSEGSSVRRGIREDRLALAIGLDPTADYDGDGVIDNNGNGIADD
FT                   YDSNLDVFGFFGDPQFIGVCNGAGLANPDAAAPDLNAAGCVPVNLFAPSILGAPIGDFA
FT                   TQAERDYVFGVREFDTTYKQIVWNGFVTGDLFELPGGTAGLVLGGEFRRDEINSQPNLT
FT                   ASDGLLFGFFADRGAIGSKEIQEGFAELDLPLIAGQPGIQELNVNLSGRVTNEEFYGTN
FT                   FTYSAKIGYRPIEPLLLRASYGTSFRAPNLRENFLLGQSGFLTLFDPCAVPDDAFVGGA
FT                   YNAATDPRDPVILQNCRREGRDPTVAGVGTNGFNTLQTASVEIVRQGSLDIDPETSTSL
FT                   TAGFAFEETFGPIDFSLGFNYYRIKLKDSVVEPSSQFILNDCYTRDDGQRSPFCDDIII
FT                   DASPTGRFLVEQTTPNFLNLDQEKVEGMDFNLFIGSEVSLFGTLVDLGLTVQANHLMER
FT                   STLFIDDTGEETFDDDAGEFSLPKWTGRSTLTADIDNFRVTYQIRYTGPVEQDILGIDE
FT                   FDDAFGSRGTGFFGDTCTGAGGANFAGDGVFCRDVGFADEQFLHTVSFRYRTGTWTFRA
FT                   GIDNLFDTAPPLVDGNEVLAIANTAIGNGYDYDGREFFFSVEKSF"
FT   gene            330395..332392
FT                   /locus_tag="ELI_01445"
FT   CDS_pept        330395..332392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01445"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62381"
FT                   /db_xref="GOA:Q2ND60"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND60"
FT                   /protein_id="ABC62381.1"
FT                   /translation="MKLLKTACFAVAGAAMAAGLAPAAMAAKDNQPSVPIEVWALRNVV
FT                   NTVQVSPDGRHLLVLKTESREGEHILEIYKTDDMSKPFRRLNADPMEFISASWVSSNHI
FT                   FGTAWQVKRSKVNGPEEDVREYATYSYNLEKNKFQQVDGEFSIVNILPGEPMEVLVATG
FT                   RDDSALTGVDPFSAFKPRSYYRYNLETGKRNLVMRGTVKYPRPTFDLEGNPRYVESYDP
FT                   ATKTLKTYYRLPGDGTWTEFGQSYDLDSHENLYRVLGGFMGLAGFKEDDPTIGYIIDNR
FT                   GEDKAALWEFDFKTGQFGEKLFSTPDADVMGIATSSMPDSTKLVAAVYPGAKFERAWFD
FT                   TEELALYEQFYKLIPNAHQISVSSRSLDGNTMVVQNTGPKDPGSFWFVKDGKITKLGSR
FT                   NPLLQPEQLADVEFIKYPARDGHMIPAYLTKPKGEGPFPLIVLPHGGPHVTEVVTYDEW
FT                   GQLLANAGYMVLQPQYRMSVGWGQKHFDDAYGQHGLLMQDDKDDGAKYLIEQGLVDPDR
FT                   VAMFGWSYGGYAALVALTREDNLYQCAIAGAAVADPEKVYKKRRNPNDAKALDDWSQRR
FT                   GMIGINPIKEVNKPSIPLLMVHGDVDARVLYFNFTDYKKAMEDAGKTNAQYLTLKGADH
FT                   FSRTLMYEHQEAFYTKMIDYLANDCGPGGL"
FT   gene            complement(332514..333038)
FT                   /locus_tag="ELI_01450"
FT   CDS_pept        complement(332514..333038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62382"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND59"
FT                   /protein_id="ABC62382.1"
FT                   /translation="MVPRLPLIAVSAALFAASPSVAQDAEVANDTDTIEQLKSCRAIAD
FT                   PMQRLTCYDREVGQVITATEQGTLQVVDQQDVEDTKRRLFGFSLPNLKLFGGDEGELTE
FT                   LETTITRVRREGREGWIFTTEEGSTWRIAETKLGWRPPRPGQTVVFKRAAMGSFFIRVN
FT                   GQIGVKGRRIE"
FT   gene            333256..336183
FT                   /locus_tag="ELI_01455"
FT   CDS_pept        333256..336183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01455"
FT                   /product="hypothetical protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62383"
FT                   /db_xref="GOA:Q2ND58"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND58"
FT                   /protein_id="ABC62383.1"
FT                   /translation="MSNRFNKAALLTGTIMAGAMVATPVYAQDGDDEAALQSGADANRD
FT                   DGLIVVTGSRIAQRNVETAAPIAVVQDEEFKLSGTVNVENVVNTLPQVVPGFTSNSNNP
FT                   GTGTATLNLRGLGSTRTMVLVNGRRWMFYDTAQIVDLNTIPSFLLDSVDVVTGGASAVY
FT                   GSDALAGVVNFRLKDVEGIEVGGQYSLTQEGDGARYNIYGAIGTSFDDGRGSATVFAEY
FT                   FNRKPIFQGDRDFSFFALGGETSRVPQQQFGSSTLPNGVIRYFGNGTRTGTDFAANRAV
FT                   VFDDVAGDFRTRTGDLYNYAPVNYLQIPQERYLIGGYADYEFADGHEAYMEVSFVNNRV
FT                   AQELAATPVTGTFNVDLGVIQPFLTPSDFAQLQQLDRTETGTGASAPNNNQLALFLQRR
FT                   TIETGPRNSLDERNAFRVLGGVRGSLTDWLNYDAYYMYARTRNANVQEGNISRSAFQRG
FT                   LDGTDPAINIFGLNTLTPAMVNQISIRAQNGDISTLEVANAALSGFIGDLGFGGGDIGF
FT                   AAGVEYREVASQFIPDTALASGDVIGFNAGSPTEGGYNVREFFAELNVPVFETDGGTRL
FT                   ELTGAGRYSDYSLNAIGGVWTYAGGAELALVDGIVLRGQYQRAVRAPNVGELFGGQAIG
FT                   FPGATDPCGTAAATPGSALGNICVANGVPAANLGSSQIQLNTQIPALFGGNPLLQEETS
FT                   DSFTAGIVLQPSFIPGLTITADYFDIEVEDAISTISLQQSFDLCFNQVQNPAATACQPF
FT                   FAFGPIRNAGGAITTANPPVLGPQNVANLGVSGVDLQVNYTTTIPFSLLTDTGEQTVNL
FT                   NFLGTWTESASFEAFPGANVVECAGEFGQTCGEPTPSFKWTSRLSFVDGPLTTSIRWRH
FT                   LSGVEDDDDTVDYAAFNGVERIPAYDLIDLTFSFDVNEQVTVAFGVNNLFDELPQAPVF
FT                   TAGSVVVQNQNDGTRLGDNQEQANTYPSTYDVLGRDFFVSANFRF"
FT   gene            complement(336338..337246)
FT                   /locus_tag="ELI_01460"
FT   CDS_pept        complement(336338..337246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01460"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62384"
FT                   /db_xref="GOA:Q2ND57"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND57"
FT                   /protein_id="ABC62384.1"
FT                   /translation="MAHDSEAAWGDFWARQSGQQRGGCLPEGWRGIDAVQQEAWHGFAA
FT                   DLPQGARVLDLATGDGRVMRWMLDTRPDLECTGVDLAPSLPPPPKGTTVKSGIPMEELP
FT                   FDDGSFEAVVSQFGFEYGDMAKTAHEIARVLAPGGTVALMTHRLEGPILAHNKARRMQI
FT                   GWALERKDVIGVAKRSLALRAGGVAAVPMEITQAVQEGAHRFGPQSAAWEISEAVRRTL
FT                   LAPAHVPAAQLAATLDQIGVQAANEMGRIASLEAACRTAADEDAWATAFEAAGFVSASS
FT                   APLAEAQESAPFAEFRLLTLA"
FT   gene            complement(337251..338933)
FT                   /locus_tag="ELI_01465"
FT   CDS_pept        complement(337251..338933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01465"
FT                   /product="TPR domain protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62385"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND56"
FT                   /protein_id="ABC62385.1"
FT                   /translation="MSSAPAPQDFHARAVAAERAGNPAEALTILEEGLKAHPGHADLLN
FT                   SAGNVCIRQGDPAKAAEFFAAALEARPSTVDFAINLSIALCGSGKPQAAVAAMAPFENQ
FT                   GREAVRYCSARAAAERQAGNPAAAAEWYDLCLALDPNHARGLHGRARTAIERGEADAVA
FT                   RVDAALAVNSGDADIWLAKAQALDVAGDRQGAREIAEQLVEQAPHWLEGLRFLAQLRHA
FT                   AGDKEWCNHYTLAAMSVQQDPNIPADHISVLAGLDYAADAANVAAEARQRFPQIPQFAL
FT                   LEAVNAGAAGDDARADTIFAELALESADRFVQEARHRLRLGQVDRAHAALDRALAEQPW
FT                   DISAWALRGIAWRLEGDDRAAWLHEQEGLVGLEPLVEADSVLPPAIAKLHQLHDNSPMP
FT                   LGQSLRGGSQTRGILFHRTEPEFAALQDAILATLENYRSGLPPLDEAHPLLRHRETPWR
FT                   ILGSWSVRLLGGGDHHTAHIHPQGIVSSACYLELPEGRGKGEGDLEVGRPAPDLRVDLG
FT                   PVRVIEPKVGHLALFPSTLYHGTTPFGPSRRMTVAFDVVTRED"
FT   gene            complement(338930..339673)
FT                   /locus_tag="ELI_01470"
FT   CDS_pept        complement(338930..339673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01470"
FT                   /product="hypothetical protein"
FT                   /note="COG5040 14-3-3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62386"
FT                   /db_xref="InterPro:IPR039558"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND55"
FT                   /protein_id="ABC62386.1"
FT                   /translation="MAKKLFEINPDLDRAELAARFAHDTRVQVRDFLTEETAKEIRSIL
FT                   QTATPWGLAMQADGSGQDGPQQVLPQQMNTREGQQRAQALGAATDKAAAQGKYAFRYAQ
FT                   YPILQAVQEGWNPGSPHELILEYINAPDFIQLARDITGFDDLVKADGQATLYARQHFLG
FT                   RHIDSHVAEGWKVAYVMNFTIDDWHPDWGGYLQFLDEDGNIEQGFLPRFNSLNLLLVPQ
FT                   PHSVSIVAPFAPLGRYAITGWLRDR"
FT   gene            339816..340994
FT                   /locus_tag="ELI_01475"
FT   CDS_pept        339816..340994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01475"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62387"
FT                   /db_xref="GOA:Q2ND54"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND54"
FT                   /protein_id="ABC62387.1"
FT                   /translation="MPMTTAYIVEAVRTAGGRRGGRLAGVHPVDLLAKSLDAVVERSGV
FT                   DPAAIDDVVTGCVSQAGEQAMQVGRMGVLASKHLPQSTPAVTIDRQCGSSQQAIQFAAQ
FT                   AVMSGTQDAVIASGVESMSRVPMGSNATFHMKEGLGHYKSPGLEEKYPKVQFSQFMGAE
FT                   MIANKHGFDKDQLDSFALGSHAKAIKATETGAFKAEIVPVEVETPEGEQMHTVDEGIRF
FT                   DATLDGIAGVKLISTEGKITAATSSQICDGSSAVLVVSEEFLKTHNLTPLARIHNLTVT
FT                   AGDPVIMLEEPLFATDKALERAGMKIDDIDLYEVNEAFAPVPLAWLKHTGADPDKLNVH
FT                   GGAIALGHPLGASGTKLMATLVHALKRHDKKYGLQTMCEGGGVANVTIVEAV"
FT   gene            341137..341922
FT                   /locus_tag="ELI_01480"
FT   CDS_pept        341137..341922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01480"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62388"
FT                   /db_xref="GOA:Q2ND53"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND53"
FT                   /protein_id="ABC62388.1"
FT                   /translation="MEVSANTPAVVTGGASGLGEATARALAAKGAKVAIFDMNEEKGEA
FT                   VAKDIGGVFCKVNVTSDEEVDAGFAKARDAHGQERILVNCAGIGNAIKTASRDKQTGEI
FT                   KHFPISAFDFVIQVNLIGTFRCIAKSAAGMMSLDPLSDEGDRGAIVNTASVAAEDGQMG
FT                   QAAYSASKGGVVGMTLPIARDLMREGIRVNTILPGIFNTPLMNAAPPQVKEALAASVPF
FT                   PKRLGNAEEYANLAMCMIETGYFNGEDVRLDGAIRMAPR"
FT   gene            342094..342966
FT                   /locus_tag="ELI_01485"
FT   CDS_pept        342094..342966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01485"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62389"
FT                   /db_xref="GOA:Q2ND52"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND52"
FT                   /protein_id="ABC62389.1"
FT                   /translation="MTDYTQILVDKADGIATVTLNRPEKMNAFTGTIMSEIITAMDDLD
FT                   EDDDVRAVIFTGAGDRAFCAGADLTPEGGGRVFSDPNEVDDLSDERVRDGGGRLTLRLF
FT                   DSKKPLIAACNGAAVGVGSTMQLPMDIRLASDNARYGFVFARRGIVPEAASSWFLPKLV
FT                   GISQALEWCYSGRVFDAQEALAGGLVRSVHPQAELMDVARGIAREIADNTSAVSVSMTR
FT                   AMMWRLPSGDHPMDAHRIDSRAIYRLSRGKDAAEGIASFLEKREPNYPGKVSEDMPDFY
FT                   PWWDQPEYK"
FT   gene            342977..343846
FT                   /locus_tag="ELI_01490"
FT   CDS_pept        342977..343846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01490"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /note="COG0005 Purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62390"
FT                   /db_xref="GOA:Q2ND51"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND51"
FT                   /protein_id="ABC62390.1"
FT                   /translation="MSNWHIGVLGGSGLYEGIALEEQQEIEVSSPFGAPSGPVTTGRIG
FT                   DVRLTFLARHGAGHRLSPDSVNYRANVDVMKRCGVTDLLAISAIGSLREELAPGSFVAV
FT                   DQFIDRTLGSRPSSFFGVGLVGHVALSDPVCTRLSGLAADAAEAAGATVHRGGTYLAME
FT                   GPQFSTRAESRMYRAWGGDVIGMTGMPEAKLAREAELPYAMLAMVTDYDSWRDDQAGVE
FT                   TVDILKVLQANADMARKTMLQLVSSLPATREPSPHDTALEYAILTTPEQRDPVLVAKLD
FT                   AVAGRVLG"
FT   gene            343895..344362
FT                   /locus_tag="ELI_01495"
FT   CDS_pept        343895..344362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01495"
FT                   /product="transcriptional regulator marR/emrR family
FT                   protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62391"
FT                   /db_xref="GOA:Q2ND50"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND50"
FT                   /protein_id="ABC62391.1"
FT                   /translation="MASDMTHAPVLADFLPYQLSIASNAVSGRIAELYQARFELKISEW
FT                   RIMAVLGEADALTQRELAARTLMDKVAVNRACKVLEDRGLVARRPNEEDGRSHHVALTG
FT                   EGREIYGQIMPLARDVERQLLEPFAEEERDMLRDLLGRLREASLKIEAAGD"
FT   gene            complement(344400..345395)
FT                   /locus_tag="ELI_01500"
FT   CDS_pept        complement(344400..345395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01500"
FT                   /product="hypothetical protein"
FT                   /note="COG2064 Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62392"
FT                   /db_xref="GOA:Q2ND49"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND49"
FT                   /protein_id="ABC62392.1"
FT                   /translation="MIQNSSGPTLLGVDVILVGSILAGLAALAVMMAIYAAVTIKDPMA
FT                   KRVKALNERRDELKAGIVKSSGKKRQSLVRKTDQTEKVKDTLQNMKVLQQSQIEVIQQK
FT                   LAHAGIRNKELAVVVIGARLVLPIVLGGIVALVVYGLDFFPEWGAMKRYAALVVAMGLG
FT                   YKGPEMLLKNKAAKRTDAIRKGLPDALDLLVICAEAGLTVDAAFNRVAKELGRAYPELG
FT                   DEFALTAIELSFLTERKQAFDNLAYRVDLEAVKGVVTTMVQTERYGTPLASALRVLSAE
FT                   FRNERMMRAEEKAARLPAIMTVPLILFILPVLFIVILGPAACSISDAFSM"
FT   gene            complement(345408..346379)
FT                   /locus_tag="ELI_01505"
FT   CDS_pept        complement(345408..346379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01505"
FT                   /product="hypothetical protein"
FT                   /note="COG4965 Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62393"
FT                   /db_xref="GOA:Q2ND48"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND48"
FT                   /protein_id="ABC62393.1"
FT                   /translation="MSILQLLLFGGGLMALMVVGYSALSGPNAAKESQRRLNAVRYRHS
FT                   ESTDTKVESQLKKAIAARKPKAHRIAGSASRIEALELRLDRTGKGWTVSQYFYASLGVG
FT                   LTVAVLIFLRSGALLLSLGVGAVIGAGLPHFVVGFFINKRTADFNSKFPDAIELLVRGL
FT                   RSGLPVTETLAVVAQEVPGPVGVEFKSIVERIKIGKTMEEGLQDTADKLNIPEFNFFCI
FT                   TLAIQRETGGNLAETLSNLSEVLRKRGQMKLKIRAMSSESKASAYIVGALPFIVFAMIW
FT                   WINPTYIDGFFTDERLIVIGLGGMVWMSIGAFIMAKMVSFEI"
FT   gene            complement(346455..347714)
FT                   /locus_tag="ELI_01510"
FT   CDS_pept        complement(346455..347714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01510"
FT                   /product="hypothetical protein"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62394"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND47"
FT                   /protein_id="ABC62394.1"
FT                   /translation="MPGNRDPFAAYICDDTALDILRPVVIEMGWAPEKCNKGGLRNAVQ
FT                   SLSVSASPNILMVDLSESGDPLNDINALAEVCEPGTVVVAIGQVNDVRLYRDLLASGIH
FT                   DYLLKPLSAGQLRDSLNQAQAVFAAPKAGDGETVKRHISTAVVGTRGGVGASMLSTSLA
FT                   WLFSDEHKMPTALLDLDVHFGTGALALDLEPGRGLTDAIDNPSRIDGLFIERAMIRAND
FT                   NLAILSAEAPINAPLMTDGSAFVQLEEEFRQAFEMTVIDLPRNMLINFPHLLADVNVVA
FT                   LATEMTLASARDTIRILSWLKTNAAHAVPIVIANKVQSGVAEISKADFEASIERSIDFT
FT                   VPYDVKSAANAAKLGQVFVDANPGAKSTQVVRQLAERIIGAGDEDGEDGAPQKKSLLGG
FT                   FDFKSLLKKKEPAAEKAEAE"
FT   gene            complement(347741..348307)
FT                   /locus_tag="ELI_01515"
FT   CDS_pept        complement(347741..348307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62395"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND46"
FT                   /protein_id="ABC62395.1"
FT                   /translation="MPQNRTMYSTKQPVVERTNYTLDVRTGPGGLSIPEQQRLSGWFEA
FT                   MNLRYGDRVSIEDPMLSGSTKDAISQLAGRHGILVSDGAPVTSGYVEPGSARVVITRSS
FT                   ASVPGCPDWSVKSEMNYTNGTHPGYGCAINGNLAAMVADPEDLVKGDEGSGETYVRRGS
FT                   KAVEAYRAKAPEGVGALPSAGGTGG"
FT   gene            complement(348397..350121)
FT                   /locus_tag="ELI_01520"
FT   CDS_pept        complement(348397..350121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01520"
FT                   /product="type II secretion system protein"
FT                   /note="COG4964 Flp pilus assembly protein, secretin CpaC"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62396"
FT                   /db_xref="GOA:Q2ND45"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND45"
FT                   /protein_id="ABC62396.1"
FT                   /translation="MSTIMTNPILFRRQFETANSQTRGKTMKRRLIAKALVASLAALPV
FT                   AAGPAQVAHAQSIVKPSQDVVLSIGRGELISVPGAMADVFIANDAVADVQIKSQRQLYV
FT                   FGKSGGETTIYASNSAGDVIWAANVRVANNIDSLDQMLALAMPEAKIATATMGTNTVLL
FT                   TGTVAAPEDAAEAERLVTAFLGDGANVISRLKMATPLQVNLQVRIAEVSRSLVREIGSN
FT                   LTTRDTTDGFLFGVNRGRNFGSITDIDTSGFPQLDASAQFGLPPGSLSLPFNPATGQFV
FT                   VGGANFPVASNNPGQTALNFAGRLFGLDIASAFDVGERLGLITTLSNPNLTALSGETAT
FT                   FLAGGEFPIPISQGLGTTSIEYRNFGVSLAYSPTVLANGRISIRVRPEVSELSSQGAIT
FT                   LNGFQIPALTTRRAETTVELGSGQSFMIAGLMSNSSQNTVDKAPGLGDVPIIGNLFRST
FT                   SFRKGETELVIVVTPYLVKPVDGTDIKLPTDGYQTPNELQRTLGFLENDGKTGGDRPKP
FT                   TAQDRDGPNPAVSRIDPAAVLPAPKTQKDDRRSAKKSKKSKRDKQRTAAAAPGFSLK"
FT   gene            complement(350118..351233)
FT                   /locus_tag="ELI_01525"
FT   CDS_pept        complement(350118..351233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01525"
FT                   /product="pilus assembly protein CpaB"
FT                   /note="COG3745 Flp pilus assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62397"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND44"
FT                   /protein_id="ABC62397.1"
FT                   /translation="MDRKKLVLLLAALIIAVGTAMAARSMFAGASAPEATAAVQEPQGP
FT                   KVLVAQRGLPVGTIITADALGFQMWPEELVQDAYFIEGESDITQLLGTVVRHPVTAGEP
FT                   LTQGTLVSPGDRGFLAAALGPGMRAITVPVSANTGVAGFVFPGDRVDLMLTQAVKGEET
FT                   DLKATETILRNLRVLATDQTTEQTTNEAGKTVVRAFRTVTLEVTPKIAEKVAVAQTLGT
FT                   LSLALRSIADNQAELERAIASGDVKIPDGASPEEEERIIQAAMNRPNDGATSYVTGGDV
FT                   SRFQSSTLPRSKEEKAQAAAAAFIETAQKNGGMAPGTQVVVRPVPTVRVTRGKQTTEVP
FT                   IGAAGKVLSGQQQGLGEAAQAVPAASAGMVR"
FT   gene            complement(351321..351824)
FT                   /locus_tag="ELI_01530"
FT   CDS_pept        complement(351321..351824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01530"
FT                   /product="type IV prepilin peptidase, cpaA"
FT                   /note="COG4960 Flp pilus assembly protein, protease CpaA"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62398"
FT                   /db_xref="GOA:Q2ND43"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND43"
FT                   /protein_id="ABC62398.1"
FT                   /translation="MVADYLHYGLLVALAIALLTAAFTDLRSRQIGNWLNGAIALGAPL
FT                   FWWSSGLDLWPGVAWQLGVALITFAICAGLFAMRWMGGGDVKLLTALALWIAPALFFNL
FT                   IVIMALLGGVLTLLFGMWHLIRRQRERLAIPYGVAISAAGLWILTTHYFPLAQASIAAG
FT                   SAVG"
FT   gene            351944..352891
FT                   /locus_tag="ELI_01535"
FT   CDS_pept        351944..352891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01535"
FT                   /product="lysophospholipase L2"
FT                   /note="COG2267 Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62399"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND42"
FT                   /protein_id="ABC62399.1"
FT                   /translation="MTRFDRRAIPSSAKEDWWGLPDGHRVRRIDWASEAEPPRGSILFM
FT                   PGRGDHYEKYLESLDEWHRAGWQVTAADWRGQGASGRLGTDEVTGHVDDFAIWIDDLAA
FT                   LWADWKAQTPGPHVLVAHSMGGHLGLRAVAEERVDPGAVVLSAPMLGFVGNLPVSLTHG
FT                   VARLMSRVGDPRRPAWKWSEKPGEIPAGRLKLLTHDDERYQDELWWREKRPELVMGPGS
FT                   WGWVERAYASMRGLFAEGVLESVTTPILLLSTSNDKLVSHRKVVDAAERLPNSELLAFG
FT                   RECHHEILREVDAVRDRAMEGIANFLDRKAPARD"
FT   gene            352899..353993
FT                   /locus_tag="ELI_01540"
FT   CDS_pept        352899..353993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01540"
FT                   /product="glycine oxidase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62400"
FT                   /db_xref="GOA:Q2ND41"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND41"
FT                   /protein_id="ABC62400.1"
FT                   /translation="MADYDIAIIGAGMAGASLAAECVPHARVLLLEAEDMPGYHTTGRS
FT                   AAFWEECYGGPELVPLTLASGAYLREHGFLTERGALYIARRDGVASLDAFMDRFGPTGV
FT                   TIKRVGRAELEQRLPRLRPAWVEGIWQPRCSDIDVAGLHQHYLGQARKGGAAPVCRARI
FT                   SRIERAEGGWRLWSERGQSWSARTIANAAGAWADQIAGMAGAQAVGIQPYRRTVAQLAT
FT                   DPPPPGDQPLVLDIGGGFYFKPDAGRVWLSPHDEEPSEPCDAAPEELVVAEAIDRFEQV
FT                   VDWDIRKIERKWAGLRSFSPDRLPVYGWDRERDGFFWFAGQGGYGIQTAPAAARLGAQL
FT                   LLGRERDALTQGLDANLYSPARFR"
FT   gene            354057..354233
FT                   /locus_tag="ELI_01545"
FT   CDS_pept        354057..354233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01545"
FT                   /product="hypothetical protein"
FT                   /note="COG3422 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62401"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND40"
FT                   /protein_id="ABC62401.1"
FT                   /translation="MAHKFEIYKDNAGEFRVRFKHNNEVMFSTQGYSQKSSAQNAIDSI
FT                   KKNGPDAPTEDNS"
FT   gene            complement(354264..354698)
FT                   /locus_tag="ELI_01550"
FT   CDS_pept        complement(354264..354698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01550"
FT                   /product="ribonuclease H"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62402"
FT                   /db_xref="GOA:Q2ND39"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND39"
FT                   /protein_id="ABC62402.1"
FT                   /translation="MKKVEIFTDGACKGNPGPGGWGVLLRMGKHEKELSGGEPETTNNR
FT                   MELRAAIEGLNALIEPCEVELYTDSKYVVDGITKWVHGWKKRGWVNASKKPVRNDDLWH
FT                   DLIEAELRHKVTWHWVKGHNGHAENERADRLASEAADLQS"
FT   gene            complement(354695..355672)
FT                   /locus_tag="ELI_01555"
FT   CDS_pept        complement(354695..355672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01555"
FT                   /product="hypothetical protein"
FT                   /note="COG2334 Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62403"
FT                   /db_xref="GOA:Q2ND38"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND38"
FT                   /protein_id="ABC62403.1"
FT                   /translation="MAVYTHLSAEDLARLIGHYDVGKLVSAKGIAEGISNSNWLVETTG
FT                   SDGNGARFILTMYERRIDLSDLPFFLGLLDHLSAKGVPVPRTIHDRDGASSRMVDDKAV
FT                   ALIEYLPGVSVGHPTPEQARAVGIALADLHLASTDFALTRENDLRPRDWAAILADAGAG
FT                   AIGTIDRALPSVIEESLSDLLEHWPEDLPSSIVHADLFPDNVLMLGSRVSALIDFYFSC
FT                   HDITAYDLAVTHVAWSFTAGGHDYRTEVGAALLEGYQSVRPLSQSEIAALPLLAQGAAM
FT                   RFIATRIQDWLDTPADALVTRKDPMDFARRLQFYRRDGEKVFNA"
FT   gene            complement(355682..356659)
FT                   /locus_tag="ELI_01560"
FT   CDS_pept        complement(355682..356659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01560"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /note="COG0761 Penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62404"
FT                   /db_xref="GOA:Q2ND37"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND37"
FT                   /protein_id="ABC62404.1"
FT                   /translation="MNAPFQSPEPSQSGKPGLSLLIAAPRGFCAGVDRAIDIVERALDK
FT                   YGAPVYVRHEIVHNKYVVDALREKGAIFVEELDEVPDGVPVVFSAHGVPKSVPAEADRR
FT                   QLLYVDATCPLVSKVHRQAERQIEKDRHIVFIGHAGHPEVVGTMGQVEAGQMTLVETVE
FT                   DVAALPFGADDKLAYLTQTTLSVDDTAEIIAALEARYPEIAGPKAEDICYATSNRQAAV
FT                   KRIAPGSDLVLVIGATNSSNSLRLVEVAERLGTKAKLIQRADDIDPAWLEGVGTIGLTA
FT                   GASAPELLVREVVEKLGEWREVQENTIAAAEENMVFKLPRQLMD"
FT   gene            356729..357379
FT                   /locus_tag="ELI_01565"
FT   CDS_pept        356729..357379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND36"
FT                   /protein_id="ABC62405.1"
FT                   /translation="MNCNFRPTLALAALAVLAACSNEGELVLAEGVGVTAVRTACPSVG
FT                   VPDYTGDITTFRSPTSRTVNDIDVTAAITNVRSTCDETGDRIYSNVTFDVLATRADARG
FT                   ARTVELPYFSTVLRGGTAVVSKRVGSVTVSFADGQARAQGSGQAGAFINRAEATLPADI
FT                   RERITRKRKPGDVDAALDPLADPQVRAALQRATFELLVGFQLSESQLAYNATR"
FT   gene            357435..359180
FT                   /locus_tag="ELI_01570"
FT   CDS_pept        357435..359180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01570"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="COG0018 Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62406"
FT                   /db_xref="GOA:Q2ND35"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND35"
FT                   /protein_id="ABC62406.1"
FT                   /translation="MSELNTIHAAFAAKVDAVLSALEAEGTLPAGVERRNVTVEPPRDP
FT                   SHGDLATNAAMVLAKQAATNPRALAEKIVEHLERDPDITETAIAGPGFINLRLADRAWL
FT                   GELEAIAALGEGYGRSQMGEGKRVNVEYVSANPTGPMHMGHCRGAVVGDALAALLEYAG
FT                   HEVTREYYVNDAGGQVDTLARSAHLRYREALGEDIGAIPGGLYPGDYLKPVGEYLAQEL
FT                   GDRFKDAPEDEWLPIFRAEAVEKMMDVIRADLALLGIHHDLFSSEAALQAAGKPEQAEA
FT                   WLREHGLVYDGVLEQPKGKVIEDWEPVELPLFRSTKFGDDQDRPIRKSDGKWTYFGADL
FT                   AYHMQKAEEADALIDIWGADHAGTVKRIKAAVAALSEGQGKPIPFDVKLVQMVQLMRAG
FT                   EPVKMSKRSGNFITIADMVEEVGKDVVRFTMLTRKPEAQMDFDFAKVVEASKDNPVFYV
FT                   QYAHARIHSTLRKARAEGIEPSTEAIAQLGEEELGLIKQAAQFPRIVEAAAAAREPHRI
FT                   AFFLYDLASAFHSFYNLGNDNPSKRVILAQDPALSAARLFLIDTIGQVIRNGLTLLGVE
FT                   AVEEM"
FT   gene            359182..359913
FT                   /locus_tag="ELI_01575"
FT   CDS_pept        359182..359913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62407"
FT                   /db_xref="GOA:Q2ND34"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND34"
FT                   /protein_id="ABC62407.1"
FT                   /translation="MIAESGDRDKHDEPIEQFEDEQETDELDLDDDEPLPWLESSDYEE
FT                   EEGVDTGRLIGFVLLGLLALGLILGAFYFLTNRGTDPELVADGSTIEAPEGDFKERPED
FT                   PGGKEFAGTGDVAPAVGEGQAREGRLAEGNRAGGSGDGSGSSARPSVDAPTAGSTGNAS
FT                   ASGGVGVQVGAYSTRASAEQGWQQLTRQTDALSGFKYRIQQGTADIGTVYRLQAVAGDA
FT                   AAANRLCDALKADGVACQVKR"
FT   gene            359978..361033
FT                   /locus_tag="ELI_01580"
FT   CDS_pept        359978..361033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01580"
FT                   /product="glycosyl hydrolase"
FT                   /note="COG1472 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62408"
FT                   /db_xref="GOA:Q2ND33"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND33"
FT                   /protein_id="ABC62408.1"
FT                   /translation="MWQAGFLANLEGSMTPAIFGMSGLTLSPEERAFFRDADPAGYILF
FT                   GRNIEDRRQVRALTDELRAIHGREDLFICIDQEGGRVARMRPPEWTGFPAGEAFDRLYR
FT                   IAPASAIEATRVNAQVLAMELAEVGITVDCHPPLDVRQPGAHDVIGDRALGSEPMQVAA
FT                   LGRAILDGLAKGGVLGCIKHMPGHGRTTCDTHKDLPTVHASGEELEVDLAPFRALNQTP
FT                   VGMTGHLLFPLWDEENPSTLSKTIIADIIRGRIGFDGLLLTDDIDMEALSGTIPERAER
FT                   AIAAGCDVVLNCWAKMDDMQGIVERCGTMRTESTTRLDRALAARARAEEADKAALLAKR
FT                   DRLLGIEGAMA"
FT   gene            361030..361842
FT                   /locus_tag="ELI_01585"
FT   CDS_pept        361030..361842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01585"
FT                   /product="hypothetical protein"
FT                   /note="COG1354 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62409"
FT                   /db_xref="GOA:Q2ND32"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND32"
FT                   /protein_id="ABC62409.1"
FT                   /translation="MTEDALVVPDETGGFDSGEWDGIAAAGSKDEGALYLALDGWEGPL
FT                   DLLLDLARRQKVDLRQISILALVDQYLDYIERAEALKLELAADYLVMAAWLAYLKSSLL
FT                   LPKEEQEDPSPEELALRLQLRLQRLGAMRESAARLMARDRVGRDVFLRGAPEGLRTDRK
FT                   TKWQAAWFDVVQAYGQVKARTAPVVHMVQERPVMTLDSALDRVSAMLGVALDWMALEEF
FT                   LPPHADAQLRRSAKASSFVAALELARLGKAEIQQDEAFGELRLRRVKA"
FT   gene            361839..362531
FT                   /locus_tag="ELI_01590"
FT   CDS_pept        361839..362531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01590"
FT                   /product="hypothetical protein"
FT                   /note="COG1386 Predicted transcriptional regulator
FT                   containing the HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62410"
FT                   /db_xref="GOA:Q2ND31"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND31"
FT                   /protein_id="ABC62410.1"
FT                   /translation="MSGQLSDLERAIEATLFASEDPMGVESLATHLGDAAASDVRDALK
FT                   NLAKHYEERGVHLVERSRRWHFQTAPDLAHLLRREKEQVRRLSRAATEVLAIVAYHEPV
FT                   SRAEIEAIRGVQTAKGTLDVLMEAGWVRAAGRREVPGRPVIYATTPEFLQHFGLASRKD
FT                   LPGLDELKASGLLDPVDDAYEALTAMGDEEDRDEDSEGDEEGIETLDDDRPDVTENEFE
FT                   SETPETPA"
FT   gene            362591..362833
FT                   /locus_tag="ELI_01595"
FT   CDS_pept        362591..362833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01595"
FT                   /product="hypothetical protein"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62411"
FT                   /db_xref="GOA:Q2ND30"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND30"
FT                   /protein_id="ABC62411.1"
FT                   /translation="MGQIGIWQILIIALVILVLFGRGKISDMMGDFGKGVSSFKKGLNE
FT                   EDKPAEPAAKIEGPSHEAKPAGEAAKDPRPADKQG"
FT   gene            362852..363268
FT                   /locus_tag="ELI_01600"
FT   CDS_pept        362852..363268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01600"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62412"
FT                   /db_xref="GOA:Q2ND29"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ND29"
FT                   /protein_id="ABC62412.1"
FT                   /translation="MFDIGATELLVIAIVAILVIGPKDMPLALRTAGRWIGKIRQVSSH
FT                   FRTGLDAMIREAEIEEMDKKWRERNAEIMAKHPADQMQPLDAPDPALSAAEARAAHTEA
FT                   AKPARAAEETQADRASADEHPAASEPRLPLEGRD"
FT   gene            363276..364082
FT                   /locus_tag="ELI_01605"
FT   CDS_pept        363276..364082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01605"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /note="COG0805 Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62413"
FT                   /db_xref="GOA:Q2ND28"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND28"
FT                   /protein_id="ABC62413.1"
FT                   /translation="MALGIKDIDETQAPLLDHLVELRTRLLRSVIALAIAFGVCFYFAD
FT                   EIFGILVRPLTASFPAGEGKLIFTQLYEVFFVELKVALFAAFFVSFPIIANQMWAFIAP
FT                   GLYAKEKKAFLPFLFATPILFTAGAALAYFVVMPIAIRWFLGFEGTIGGLDVEALPGAG
FT                   NYLGLAMQFILAFGISFLLPVLLLLLNRAGIVSRAQFVKARRYVIVGVVAVAAIMTPPD
FT                   PGSQLILAGPLYLLFEGSMLLMLFSERKQRKGGQLNAADEAEAETL"
FT   gene            complement(364183..364401)
FT                   /locus_tag="ELI_01610"
FT   CDS_pept        complement(364183..364401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62414"
FT                   /db_xref="GOA:Q2ND27"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND27"
FT                   /protein_id="ABC62414.1"
FT                   /translation="MILRNVLAATAALSLAAAPAVAEASFARASTPVEGESEAGGGGAL
FT                   LGIFAAVAIIGGIIIAASGDDNDALSQ"
FT   gene            complement(364577..364789)
FT                   /locus_tag="ELI_01615"
FT   CDS_pept        complement(364577..364789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62415"
FT                   /db_xref="GOA:Q2ND26"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND26"
FT                   /protein_id="ABC62415.1"
FT                   /translation="MTFRNLTMAVAALGLAAAPVAAESFRAGAPVDGSSQLAENSDLFL
FT                   ILGALAIVAGVIVLAADDDDDALSQ"
FT   gene            complement(364968..366626)
FT                   /locus_tag="ELI_01620"
FT   CDS_pept        complement(364968..366626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01620"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="COG1574 Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62416"
FT                   /db_xref="GOA:Q2ND25"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND25"
FT                   /protein_id="ABC62416.1"
FT                   /translation="MFKKSLAALAALSLATPAVADVLVDNIAGIRIDEDGEVDRFTGLW
FT                   IDDDGRIKQVLDRRDKRPDGTTYSVDGEGRVVIPGLIDAHLHVMGIGFGALTLDLSGTR
FT                   SLAEAQQAIADFAAANPGRQWIIGRGWNQETWGLGRFPTAAELDAAVADVPVVLERVDG
FT                   HATWANTRAMELAGVTAQTKSPSGGRIERLAGSQMPSGVFVDAASELIYSRVPAPRPRE
FT                   RDLALQKAQDILLAMGITAAADMGTSLEDWQTFRRAGDEGRLKLRIMSYAAGVDAMEAI
FT                   AGPGPTPWLYDDRLRLNGVKLYLDGALGSRGAWLKRPYADDPGNTGLPLQNPAQLRNLM
FT                   SRAAMDNFQLAIHAIGDAANAEVLAAIDELAETYGGDRRWRIEHAQVIDPTDIAEFGKY
FT                   GIIASMQPVHQTSDRLMAEARLGPDRLDGAYAWKTIADTGSRLAFGSDAPVESPDPFAG
FT                   WAVAFTREDADGQPFGGWRPQDRVSREAALAGFSADAAYAGFADGRFGRLVAGERADFL
FT                   ILDRDPMLASADDLRDAKVLETWIGGERVYRRRAD"
FT   gene            complement(366626..367531)
FT                   /locus_tag="ELI_01625"
FT   CDS_pept        complement(366626..367531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01625"
FT                   /product="putative oxidoreductase"
FT                   /note="COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62417"
FT                   /db_xref="GOA:Q2ND24"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND24"
FT                   /protein_id="ABC62417.1"
FT                   /translation="MSEIKTIAFLGLGVMGAPMAGHLAWAGYAVTGYNRTASRAAAWAD
FT                   KLGDEGLEVGTADTPAEAARGKDLVMACVGNDEDLEQVLLGETGALPAMREGSLLVDHT
FT                   TVSAKMARRIDAAARERGVAAVDAPVSGGQAGAENGKLAVMCGGSQAAVERARPAMESF
FT                   AARIVHVGEAGAGQTTKMANQMCIAGVLAGLSEAIRLSQASGLDMDKVYDAISGGAAQS
FT                   WQMDNRWATMAKGEFDFGFAIDWMRKDMGYALEEAQRLGLSSPVSALVDQFYAEVQAMG
FT                   GARQDTSALIRRLPQGKKDT"
FT   gene            367619..368872
FT                   /locus_tag="ELI_01630"
FT   CDS_pept        367619..368872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01630"
FT                   /product="threonine dehydratase"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62418"
FT                   /db_xref="GOA:Q2ND23"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND23"
FT                   /protein_id="ABC62418.1"
FT                   /translation="MDTRDPTESAPGIDALTLDDVRAAAKRIEGAVVRTPTMHSITLSQ
FT                   ITGADIWLKFENLQFTAAYKERGALNALLQLSEKQRERGVIAASAGNHSQGLSYHGTRL
FT                   GVPVTIVMPRTTPSVKVMQTESVGGDVVLQGDTFDEAYAHARELERERGLTFVHPFDDP
FT                   HVAAGAGTTALELFEDAPELDCIVTPIGGGGLMSGMATVANALYPDMKVVGVQAELFPS
FT                   MFAKINGVEKDCGGDTLAEGIAVKAPGQFTSKVIAERVDEILLVSEPKLENAVSLLLQI
FT                   EKTVVEGAGAAGLAAVLAHPEKFRGRKIGLVLCGGNIDSRLLANVLLRDLARAGRLARL
FT                   RITLQDRPGALYNVMREFDAHNVNIIEIYHQRIFTNLPAKGLITDIECEARDAQQLSAL
FT                   VAALRGKGYIVSPVELDK"
FT   gene            369117..369854
FT                   /locus_tag="ELI_01635"
FT   CDS_pept        369117..369854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01635"
FT                   /product="Arginine-tRNA-protein transferase, N terminus"
FT                   /note="COG2935 Putative arginyl-tRNA:protein
FT                   arginylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62419"
FT                   /db_xref="GOA:Q2ND22"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND22"
FT                   /protein_id="ABC62419.1"
FT                   /translation="MFTELKGPHADQLNEALGRIGFRRSQTVAYRPSCVDCNACVSVRV
FT                   AATEFAPSNSQKRNLKRNSDLIRVECRPWATTEQFDLLRQYLATRHPEGGMAAMDEMDF
FT                   ADMVEHTPVSSYVIEYREPTETGEPGRLVGACLTDRQGDGLSMIYSFYDPEHVKRSGLG
FT                   NYIILDHIRMAAEEGLPFVYLGYWVDGSGRMEYKIRYRPIEKLGPSGWLRVSGDEQDRL
FT                   VRRAADQRAAARARRSAQFSSAG"
FT   gene            369742..371988
FT                   /locus_tag="ELI_01640"
FT   CDS_pept        369742..371988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01640"
FT                   /product="hypothetical protein"
FT                   /note="COG0729 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62420"
FT                   /db_xref="GOA:Q2ND21"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND21"
FT                   /protein_id="ABC62420.1"
FT                   /translation="MAGSASPATSRTGWCAAPPINARQRALAGPRSSARQASLIAGSLH
FT                   WAAILALALPSQLAAQQSQQQRLEDLIPDSAVEDPDSWAAQGVEARPEDAVDEVADADI
FT                   DTDTPLAELPDMAIEWPDEIELAEAPEVEPDESLEFAEATFGDEDFLPDAQVVEITDSL
FT                   VLAFPAQDEGFTVRNEFVERFDALSNIKAFDDGETNVAQLAARAAADEELLNNLLRNYG
FT                   FYDGLVVRTLGEIQEADEIPAVRFDIVPGPRYRFGVIDLGSLVTAPDANELRAAFEIES
FT                   GDPLDNDRIIAEQLDLDIALGETGYPFAEIAAPSLLIDHDRSEGDLTLPVEPNGKYAFG
FT                   QVISDRPEFLSSRHLQRIARFEAGDVYQRSLQLDLRRAITATGLVSRVSIDVQEVQPPA
FT                   DGDVGVVDLNVAMTPAPLRTIAGAVGYGSEEGFRVQASWEHRNLFPPEGSLRVRGILGT
FT                   REQLAGVTFRKNNFRKRDQILTLDAYASDLETDAVDARTIALRGTFERVSNLLFQKDFS
FT                   WLVGAEVLATDERNVVRAAQTPNPLPRETFFIGSIFGEATIDDTDSLLDPTKGFRLRGF
FT                   AAPEVSRTQGSQYFYLRAQVDGSIYQRVTDNVVLAGRLTAATITGAPRFAIAPSRRLYA
FT                   GGGGSVRGYGFQAIGPVDQFDIPLGGRSLVEGSVEARVQTGFMDGAVSVVPFLDFGSVS
FT                   TSSIPDFETVKFGAGLGLRYATGFGPIRFDVGVPLNPGPNDSSVAVYVSLGQAF"
FT   gene            371988..376190
FT                   /locus_tag="ELI_01645"
FT   CDS_pept        371988..376190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01645"
FT                   /product="hypothetical protein"
FT                   /note="COG2911 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62421"
FT                   /db_xref="GOA:Q2ND20"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND20"
FT                   /protein_id="ABC62421.1"
FT                   /translation="MADETMTEEADRATAAPAPRKRKRRWAKRFTAAIGVLLLLLVGLL
FT                   ALVNSPIGKRYVADQIAQVAPASGLRFEVGRIEGDLFRDARLYDVVLYDPKGAFLRIPE
FT                   AEMDWRPLSWFTSGLDIRTAIARRATLERLPELLPGDPDAPTLPNFDIRIDRLAIENLT
FT                   IAPGIIDERSHRVDLTASADIREGLADVEASGRLGREDRFVLDLEAEPDGNVFDLDLDY
FT                   VAPRDGVIASLVGAEAGYEARVRGGGTWRDWKGFLTVRRDDSMIGGFRLTNKAGLYGLV
FT                   GQIDAAPLSEGLIEAAAAPRLSLAFFTTLEESVLDGALRARSRALNLRADGVVDLANNT
FT                   IDEIEFAGDLLDPDLLGADVARLEGARIEGTLAGAFDALDIQHVLTVDRAIAGTAQIAG
FT                   IRQQGRARYADGRWVLPLDLKVDRIATGTAMVDPRLIDGSLGGQIVLAGDRLTSEALRF
FT                   AFPGATGQVALDGNLSTGRYAVSGPVAINGLPFDNLGVVNAGGQVDFVLPGDGGWRLAI
FT                   DGRANVPRVSNETVANFVGPSLALRGGVTLGDAGPVAFRNVVLDAAKLSLNADGAITPG
FT                   RTTLTGNGRHVDYGPFTIEGAYTDAGPEAVLVLADPLPAAELSNVRLAISPSETGFAIA
FT                   TTGGSLLGPFEGDLNLALPADGPARLDIARLRVWETDITGNVTFADAGARGRIALSGGG
FT                   LDGNISIAPQGEALRFAFDVDANNATFGGDTPIAIRRADIEGEGILLDGSSTVNASVFA
FT                   QGVSYGTVFIGRLAANAELTDGRGKVTGSVAGRRGSRFALQVDANIAPDRVAVAAQGDF
FT                   AGRPLRFPRRAVLTRRSDGGWDLARTQLSYDGGRTVVEGTFGGETLAMRAWFDGMPLSL
FT                   ADIASADQGLGGRLSGTVEYNAPQTGAPTGEMRIKVDKLTRSGLVLTSRPIDLGLVARL
FT                   QPSRLEARAVIAEDGGQRGRAQARITGLPASGGLYERLSAGDLFAQLRYDGAAQALWRL
FT                   ARIETFDVGGPVKVSADVRGTLARPVVRGALASDDLRIQSALSGTNIAQVSVRGRFSGS
FT                   RLRLTRFAGTAANGGQVSGSGVVDLANISATRGPEIDLRIAASNAQLIAANGLDATVTG
FT                   PIRIVSDGIGGTIAGRLRIDRASWQLGVADEDVRLPQIATREINAPADVAPTPAAAAPW
FT                   RYLINATADSRVDVDGMGLDSEWEADIRLRGTTDDPRLGGQARVVRGFYSFAGTRFELT
FT                   RGRIAFDESVPIDPRIDIVAETDRAGIDVAVSVQGSATQPEIRFSSTPALPEEEILARL
FT                   LFGGSVTELSATDAVQLGAALASLRGGGGMDPINQLRTAIGLDRLRIVGADPALGRSTG
FT                   VALGKNIGRRFYVELITDGRGYSATEVEFRITSWLSLLGAVSTVGRESVVVEISRDY"
FT   gene            complement(376221..376769)
FT                   /locus_tag="ELI_01650"
FT   CDS_pept        complement(376221..376769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01650"
FT                   /product="hypothetical protein"
FT                   /note="COG2335 Secreted and surface protein containing
FT                   fasciclin-like repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62422"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND19"
FT                   /protein_id="ABC62422.1"
FT                   /translation="MRTITILPALLAATALAACGDADPSGAPEAISDNLSVVLEDTDEL
FT                   STVRNAMEATGLASLLHGPGTSYTIIAPSDAAFAEITGDEDLEPPVLAALLREHIVPGH
FT                   LDREAIVSAIESNGGPVRVATVGQGTLEFSHNGDDLLATHSESGLSARMTGAGGQAENG
FT                   TLLVVDAVLTAPPARDAAA"
FT   gene            complement(376784..377776)
FT                   /locus_tag="ELI_01655"
FT   CDS_pept        complement(376784..377776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND18"
FT                   /protein_id="ABC62423.1"
FT                   /translation="MATIAAGALMASGALAQPGNGKGQGNERGGGPPAKAEKGPKADRG
FT                   GGPRMRGNPRDDGGVEKTRGNRGNAAARNDDNAKRKAGADGRAQVERGQSGRNRDAGPP
FT                   ARGNGQSASRGASRAFESARRYEDGGRDFDLFREYDRALGAYDGCPPGLAKKYNGCTPP
FT                   GLARQRASYSPSFFGYSGFGGGPFYYDDGYLLRLGEGGLISAAIPLLGGALGIGNTWPS
FT                   YYQPVELRPYYRDYYGLEPNGYRYANNTIYRVDPQTAAIQSVAALLTGDEFVVGQPAPR
FT                   GYDIYNVPYRYRDQYVDGPDGYYRYSDGYVYRMDPETRLVAAAIELALN"
FT   gene            complement(377926..379335)
FT                   /locus_tag="ELI_01660"
FT   CDS_pept        complement(377926..379335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01660"
FT                   /product="glutamine synthetase"
FT                   /note="COG0174 Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62424"
FT                   /db_xref="GOA:Q2ND17"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND17"
FT                   /protein_id="ABC62424.1"
FT                   /translation="MSSAKDIIKKIKEHEIEWVDLRFTDPKGKWQHLSMVASVMDEDAL
FT                   EDGLMFDGSSIAGWKAINESDMILKPDLSETWLDPFSATPMLIVNCDIVEPSTGDWYSR
FT                   DPRSTAKRAEAYLKSTGIGDTIYVGPEAEFFMFDDVRFEDGYAGSGFAIDDIELPTNMG
FT                   KEYEGGNMGHRPRAKGGYFPVAPVDSAMDIRAEMVATMLELGLPCDKHHHEVAAAQHEL
FT                   GLTFGTLVQTADRMQIYKYVVHQVAHAYGKTATFMPKPIKEDNGSGMHTHMSIWEGDKP
FT                   TFAGNEYAGLSENCLYYIGGVIKHAKALNAFTNPTTNSYKRLVPGFEAPVLLAYSARNR
FT                   SASCRIPYGAGDKAKRVEFRFPDAMANPYLAYSALLMAGLDGITNKIHPGDAMDKNLYD
FT                   LPPAELAEVPTVCGSLREALEALEADHEFLLKGDVFTKDQIDAYAELKWEEVMRTETTP
FT                   CPVEFDMYYSA"
FT   gene            complement(379386..379724)
FT                   /locus_tag="ELI_01665"
FT   CDS_pept        complement(379386..379724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01665"
FT                   /product="nitrogen regulatory protein PII"
FT                   /note="COG0347 Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62425"
FT                   /db_xref="GOA:Q2ND16"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND16"
FT                   /protein_id="ABC62425.1"
FT                   /translation="MKKIEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKLEVVVPDNLADRVVEAIAGASQTGRIGDGKIFVSPIESALRIRT
FT                   GEKDDEAI"
FT   gene            complement(379968..380903)
FT                   /locus_tag="ELI_01670"
FT   CDS_pept        complement(379968..380903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01670"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="COG0002 Acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62426"
FT                   /db_xref="GOA:Q2ND15"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND15"
FT                   /protein_id="ABC62426.1"
FT                   /translation="MARSVFIDGAAGTTGLEIRQRLADRTEFDLLVLDDADRKDAAKRR
FT                   EALNDSDFAILCLPDDAAVEAVAMIDPASKTRVIDASSAHRVADGWTYGFPEIAGREAV
FT                   ATARFVSNPGCYPTGFIGLVAPLVRTGLLPHDWPFTCNAVSGYSGGGKALIERFEGTGA
FT                   DIAFRTYGLELSHKHRPEMQQHAGLEHGVLFAPSVVPAFRGMVVEVPLHLGAMATGPHS
FT                   DALREALQSFYQGSPVVTVASGVAPGELLLHRQEQPSDTLTLHVCGNEGGWNVRLVAVL
FT                   DNLGKGASGAAVQNLNLMAGLDETAGLRLT"
FT   gene            complement(380903..381244)
FT                   /locus_tag="ELI_01675"
FT   CDS_pept        complement(380903..381244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND14"
FT                   /protein_id="ABC62427.1"
FT                   /translation="MSENATYPIPEGDLSLSGPVVRPAPGTLPIRGDVAHIALADRFLV
FT                   PHYVVPKPVAVVRGPADLHLAMDTESEVLHVLQEGDGFEALDVSDNWVWGACGPEGPSG
FT                   YVTRTAFDI"
FT   gene            complement(381326..382711)
FT                   /locus_tag="ELI_01680"
FT   CDS_pept        complement(381326..382711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01680"
FT                   /product="leucyl aminopeptidase"
FT                   /note="COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62428"
FT                   /db_xref="GOA:Q2ND13"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND13"
FT                   /protein_id="ABC62428.1"
FT                   /translation="MSKSDLIQPDHGQDAIAIHLVNKDSFEDWSKSLSAGQRAALAAQK
FT                   FDGSGYQVGIVPDGDGWFAVGGVADPEELSSWCMAKLAEVLPEGTYRRAEGNPGPAVHG
FT                   WLTAQYSFEKYTKPENPVGPRILLSKEVKAIGPALSEAHAVCEVRRMVDTPAEDMGPAA
FT                   LESECEKLAKTYDAKLQVTKGDTLEQEYPMVHAVGRAADRKHAPRIMHLTWGKEGDPKI
FT                   AIVGKGVAFDSGGLDVKSAVGMKLMKKDMGGAAHAIALAGLIMEAGLPVRLHLLVPAVE
FT                   NAISSNSFRPGDVLKTRKGLTVEIGNTDAEGRLILGDALTRASEEEPELIIDFATLTGA
FT                   ARVALGPDLPALMTRRDETAEALIEAGKACDDEPWRLPLPEAYREWLKSDIADMNNAHG
FT                   NAYAGASVAGLFLDRFVGEDIEWAHFDTFAWRPFAKPGRPKGGDAYGLRASWHMLQRRY
FT                   SAG"
FT   gene            382777..383589
FT                   /locus_tag="ELI_01685"
FT   CDS_pept        382777..383589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01685"
FT                   /product="hypothetical protein"
FT                   /note="COG1257 Hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62429"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND12"
FT                   /protein_id="ABC62429.1"
FT                   /translation="MKQTCLVALAVAALASCSSPEDVADATGVEDQAGQSAPVATGDTA
FT                   TEGGEAVAIEEESELYSFSYSYPGQVAAIPELKARFDREQAQSRKALIAQAREARADAK
FT                   DMGFPYNAYALGTSWEVVADTPRFLSLSADIYTYSGGAHPNSTATSLVWDREARRALEP
FT                   LDFFASPEALNDAVSEPYCKSLNDQRAERTGEPVDNSDPVFGGCPTVEQLTVVLGSTNG
FT                   KTFDRIGLIAPPYVAGSYAEGEYAVTLPVTEPVMKALKPAYREAFARR"
FT   gene            383633..384463
FT                   /locus_tag="ELI_01690"
FT   CDS_pept        383633..384463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01690"
FT                   /product="methionine aminopeptidase"
FT                   /note="COG0024 Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62430"
FT                   /db_xref="GOA:Q2ND11"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND11"
FT                   /protein_id="ABC62430.1"
FT                   /translation="MSEYQVITADDDVQRDGTIKLHGPEGFEGMRKAGRLAADILDATV
FT                   ELVEPGVTTESIDAAIRGMMLDAGAVPATLGYRGYTHSSCISINHVICHGIPSEKTLKE
FT                   GDIVNIDVTPLLDGWHGDTSRMFFAGEPPLKAKKLVDVTYECLMLGIEAASKPGARLGD
FT                   IGAAIEAHARQYRYGVVREFCGHGLGRLFHDAPEVVHAAKAGTGPELKPGMFFTIEPMI
FT                   NLGKPWGKVLKDGWTAVTRDKSLSAQFEHSLGITEDGIEIFTESTKGLHQPPYA"
FT   gene            complement(384460..385119)
FT                   /locus_tag="ELI_01695"
FT   CDS_pept        complement(384460..385119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01695"
FT                   /product="ABC-type transport system permease component"
FT                   /note="COG2386 ABC-type transport system involved in
FT                   cytochrome c biogenesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62431"
FT                   /db_xref="GOA:Q2ND10"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND10"
FT                   /protein_id="ABC62431.1"
FT                   /translation="MSAFGILLRRDLILLLPGGSRGGAILPLIFFLAVAMLYPFAVGPD
FT                   APLLARTGGGVLWVAALLATILPLDRLVADDLTHGVFDQFALRGIAEETAMASRLVAHW
FT                   LAFAPLLLVACLPAAALLGLEGDTLGLLVLGLLAGTPGLAAIGLIVASLMASLRAGAAL
FT                   GGLLLLPLAVPILIFGAGSLAQGDATGIALAGAISLALCGIAPFAAGAAIRAAREN"
FT   gene            complement(385116..385694)
FT                   /locus_tag="ELI_01700"
FT   CDS_pept        complement(385116..385694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01700"
FT                   /product="ABC-type transport system ATPase component"
FT                   /note="COG4133 ABC-type transport system involved in
FT                   cytochrome c biogenesis, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62432"
FT                   /db_xref="GOA:Q2ND09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND09"
FT                   /protein_id="ABC62432.1"
FT                   /translation="MPAALAARNLACRRGDRLLFTGLELDLADGALLHVTGANGTGKSS
FT                   LMRILAGLLSSSEGDVSRSGSMALLDERLALDPEWPLGKALRFWERLDGCSDPSNIVAI
FT                   MELEPLLDVPVRYLSTGQRKRAAFARLLCTSHDIWLLDEPFNGLDIDACAKVRSLTRLH
FT                   CGGGGVCVIASHQDIGMDAHTLAIEDFAP"
FT   gene            385759..386064
FT                   /locus_tag="ELI_01705"
FT   CDS_pept        385759..386064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01705"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62433"
FT                   /db_xref="GOA:Q2ND08"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND08"
FT                   /protein_id="ABC62433.1"
FT                   /translation="MTVRKLNQEERDTWTSALDGWDMADGRDAIEKTFEFGDFVEAWGF
FT                   MSRVAILAEKADHHPEWFNVYNRVEITLTTHDADPDNGGALSKRDVELANAIDALG"
FT   gene            complement(386195..387007)
FT                   /locus_tag="ELI_01710"
FT   CDS_pept        complement(386195..387007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01710"
FT                   /product="short chain dehydrogenase family protein"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62434"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND07"
FT                   /protein_id="ABC62434.1"
FT                   /translation="MSTRKSIFITGGGSGIGRAIALKFAKEGWFVGLGDISKDGMAETE
FT                   RLIGNGFTYSHQFDVRDRAAWDEALEAFSMAAGGRIDVLANNAGIPIGGSLSENSEDEI
FT                   TRCLDINLKGVLFGAQAAYPHLKKTAPGSCLLNTASAAGIYGSAGGSVYCATKFGVRGI
FT                   TESLDGEWAGDGINVRSLMPSFIDTPLLDMVPNAGTNEHIRSRVQESGLEITPVEEVAE
FT                   AAWDAVHKDKLHWTVGKTARRIAFAARWMPGRVRKQMREGGQMQLLGD"
FT   gene            complement(387041..389005)
FT                   /locus_tag="ELI_01715"
FT   CDS_pept        complement(387041..389005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01715"
FT                   /product="dipeptidyl aminopeptidase"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62435"
FT                   /db_xref="GOA:Q2ND06"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND06"
FT                   /protein_id="ABC62435.1"
FT                   /translation="MTPNIDAFPLIRREHLFGNPTRAAGQISPDGQWLSWLAPRDGVLN
FT                   IWMAPSEDPEAAKPMSASTDRPIREYMWAPDSRSLLYIQDKGGDENFLLYGIDVEAGKE
FT                   TSLTPFDDTRVMLVGGSDTYKDRILIGLNNRDARFHDVHLLDLNTGELTLVLQNDAYAG
FT                   FIADDDLHLRLAVLPNAEGGTDYFKVEDNVVADAPFKSTGIDDALTTSPGGFTRDGKTM
FT                   YWLESEGRNTAALLAMDWVSGTTTLIAQDDRADIGGTLRHKDTGEVLAYSVNYLKREWT
FT                   ALDDDIAGAFEFLDSRLEGEYGINSRTDDDRKWIVGNDPLVKPAASYLYDRDAETLTKL
FT                   YTTRPELEGAPLQPMHTLELTSRDGLTLPSYLTLPPGSDEDGDGVPDAPVPMVLFVHGG
FT                   PWARDGYGFNGHHQWLANRGYAVLSVNFRGSTGFGKDFINAANLEWGRKMHDDLIDAVE
FT                   WAVEAGIAPRDKIAIMGGSYGGYATLAGLTFTPEVFACGVDIVGPSNLETLLASIPPYW
FT                   EPMVAQFHTRMGNPNTEQGLALIKERSPLYKAGEIVRPLLIAQGANDPRVKQPESDQIV
FT                   DAMKDAGIPVTYLLYPDEGHGFAKPANNIAFSAVAENFLATYLGGRAEPIGDTLRSSTA
FT                   EIPAGAEFVEGLAEALESA"
FT   gene            complement(389051..389668)
FT                   /locus_tag="ELI_01720"
FT   CDS_pept        complement(389051..389668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01720"
FT                   /product="putative DNA-3-methyladenine glycosidase ii
FT                   protein"
FT                   /note="COG0122 3-methyladenine DNA glycosylase/8-oxoguanine
FT                   DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62436"
FT                   /db_xref="GOA:Q2ND05"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND05"
FT                   /protein_id="ABC62436.1"
FT                   /translation="MGLTPDQIKDGLDEIASREPRIGAVLKVAGYPEPRLRPTGYKTLL
FT                   RTIVGQQVSVAVATSMWNKLEAELGEDFTPACLLERDFDALRACGLSRQKQGYARSLCE
FT                   LVEAGALDFENLPKEDEAAIEELTRIKGIGRWSAEIYLLFAEGRPDIWPAGDLAVQKAV
FT                   GRIMGHAEMPKEKEVRAIAEDWRPHRGAVAIFAWHTYNMEAI"
FT   gene            389768..390085
FT                   /locus_tag="ELI_01725"
FT   CDS_pept        389768..390085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01725"
FT                   /product="ferredoxin"
FT                   /note="COG0633 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62437"
FT                   /db_xref="GOA:Q2ND04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND04"
FT                   /protein_id="ABC62437.1"
FT                   /translation="MPKLVVTTREGETSEVQVDDGLTVMEAIRDNGFDELLALCGGCCS
FT                   CATCHVHVDESFVEKLPRMSEDEDDLLESSDHRESNSRLSCQIPFTPDLDGLKVTIAPE
FT                   D"
FT   gene            390128..391141
FT                   /locus_tag="ELI_01730"
FT   CDS_pept        390128..391141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01730"
FT                   /product="cysteine synthase"
FT                   /note="COG0031 Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62438"
FT                   /db_xref="GOA:Q2ND03"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND03"
FT                   /protein_id="ABC62438.1"
FT                   /translation="MNITAPHSDTISLIGNTPLVRLQGPSDAAGCEIYGKCEYANPGAS
FT                   VKDRAALWIIRDAEERGELKPGGTVVEGTAGNTGIGIALVANARGYKTIIVMPDNQSQE
FT                   KMDTLRALGAELVLVPPTKFADCNHFVHTSRRLAEETEGAIWANQFDNTANRKAHIEGT
FT                   APELWEQLEGRIDGFTCAAGTGGTIAGVGMALKELDENVVIALTDPHGAALYNYYANGE
FT                   LKAEGSSVAEGIGQGRITGNLEGAPIDTQFRISDEEGLEWVRRLLREEGLCLGLSSGIN
FT                   VAGAVALGKQLVADGRKDARVATILCDTGFRYLSSLYNADWLRSKDLPVFDWLGQD"
FT   gene            391199..391549
FT                   /locus_tag="ELI_01735"
FT   CDS_pept        391199..391549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62439"
FT                   /db_xref="GOA:Q2ND02"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND02"
FT                   /protein_id="ABC62439.1"
FT                   /translation="MNLLPTRLRPAEGAAIVAPKNRAKAETVHRLQVGLLGLAAMILLV
FT                   GVADMIMDRAQQTEAAVPPAAAPTVEPSPTPTQNKALENAGVVPDLPADAEATPLPEGP
FT                   VVPEQGDALPGE"
FT   gene            391530..392303
FT                   /locus_tag="ELI_01740"
FT   CDS_pept        391530..392303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01740"
FT                   /product="hypothetical protein"
FT                   /note="COG3225 ABC-type uncharacterized transport system
FT                   involved in gliding motility, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62440"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND01"
FT                   /protein_id="ABC62440.1"
FT                   /translation="MRCRASKLFAAVLPPLALLFAGCSRPAEPPVEDERLTIGLMSSLP
FT                   VYWSGGNAFVELSQDGVEPHWARMALEAAHDLEAIDALTSENLARTDLLILAQPRVLSP
FT                   MENVALDDWVRAGGKALVFADPALVLESEFPLGDPRRPMDTVLLSPILARWGLELMFDP
FT                   AQAEALRRVRDGDVVLDVAAAGTFEVSGGEGSSCTLAAEGVLATCAIGEGRVVLVADAT
FT                   LLEDTVGTEASAGILSALIARTSDPVREITGRSGK"
FT   gene            392300..392419
FT                   /locus_tag="ELI_01745"
FT   CDS_pept        392300..392419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ND00"
FT                   /protein_id="ABC62441.1"
FT                   /translation="MTREIADRCGENAAILGDSAGLLAFLHRIAGLEGRQKTK"
FT   gene            392639..393136
FT                   /locus_tag="ELI_01750"
FT   CDS_pept        392639..393136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01750"
FT                   /product="hypothetical protein"
FT                   /note="COG2001 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62442"
FT                   /db_xref="GOA:Q2NCZ9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ9"
FT                   /protein_id="ABC62442.1"
FT                   /translation="MEQGFGGYSGQAYSPAGDKGRFVLPPLFRKAVKESSGGRILCLAK
FT                   HDRWNCLVGFGLSRKMEFEAQLDREEERALRLGRDFDRETRSSQLNGFTEIPFDDSGRF
FT                   VMPDYLRGLGEVQDGLYFQGGGRFFTCWNPAELDCMGDDWAAAKAACAALVAEAETKAR
FT                   KK"
FT   gene            393133..394080
FT                   /locus_tag="ELI_01755"
FT   CDS_pept        393133..394080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01755"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /note="COG0275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62443"
FT                   /db_xref="GOA:Q2NCZ8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCZ8"
FT                   /protein_id="ABC62443.1"
FT                   /translation="MSGAAAHVPVLLDEVVAALDPQPGDVLVDATFGAGGYTRALLDSG
FT                   ATVHAFDRDPDAIAAGSQWPETKEEPPRLVLHPRRFSEMVHALAEAGVAQVDGVAMDIG
FT                   VSSMQLDQAQRGFAFSADGPLDMRMSQHGPSAADFLNSAEAEEIADVLYQYGEERQSRR
FT                   VARAIIAARPLETTGDLARVVRKALGYRVGAPKDPATRTFQAVRIHVNGELDELREGLH
FT                   AAEHLLRSGGRLAVVSFHSLEDRIVKRFLQSASGKAGGTSRYLPQTDVSPAIFSDISKA
FT                   IRPSEAEIARNPRARSSTLRHATRTDAPPRKEAA"
FT   gene            394077..394637
FT                   /locus_tag="ELI_01760"
FT   CDS_pept        394077..394637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62444"
FT                   /db_xref="GOA:Q2NCZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ7"
FT                   /protein_id="ABC62444.1"
FT                   /translation="MIVGGSRLRQIGWAAALGVVFALFVALTFRVNAVKSEVVRAERQI
FT                   VALKRETMRLETEFETRANQQQLANWNAVDFGYVAPRADQYLENERQLASLSEPVAPGA
FT                   PAPIRVARSAEPQEYPALVSPLTGRPVGEDADPQPEKAPTARPTLANDARGEDRPSLAE
FT                   RLGMQVDLRSTSPDFTPAAKVSE"
FT   gene            394634..396391
FT                   /locus_tag="ELI_01765"
FT   CDS_pept        394634..396391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01765"
FT                   /product="penicillin-binding protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62445"
FT                   /db_xref="GOA:Q2NCZ6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ6"
FT                   /protein_id="ABC62445.1"
FT                   /translation="MSSLAVSTAISSGRVRLVSDRQEALLVARIRVLVVAVGFALLALI
FT                   ALLRIVFLGIGGGTTGPTTLEEALLPPRGEITDRNGIALARNYPARALWFNPDALGEGE
FT                   ESLVKSPDKVVAELLAIFPDLEQDRVRKMLASGTAGYLRRRVLPEEANRVFDIGEVALE
FT                   LPQETDRHYPQGMLGAHVLGYVDSDGGGKVGMEQVLDDRLSNPVLRGEASSLSLDIRVQ
FT                   GALEDELRKGMLSVNAMGAAGIVLDVDTGEILALASLPEFDPNAVKGEDLIVSDAAYKR
FT                   GEIPRAFNRVTNQVYELGSTFKPLTVAAAIDAGTVRDFGKRYDASGVAIDGFTIRDSHD
FT                   LGASLNIPQMLIHSSNTVTARVSDELGEAKLRQTFEDLGMHERPYIELPARGHPLWQTS
FT                   KWGRLKTMNVGFGHGIAVTPLHLASAYAAMVNGGIWRPATLHRIEPGMAPKGRRVFKES
FT                   TSSRMRQLLRMIALYGTGKNADAAGYRVGGKTGSAEKPGVGGYRRKSLVSTFAAVFPMD
FT                   NPRFVVIAMLDEPKGTTASSFQRTAAWNAAPIVGKLVPRIGPILGVRPDMTRDVDISDL
FT                   KRLVPGAAE"
FT   gene            396388..397875
FT                   /locus_tag="ELI_01770"
FT   CDS_pept        396388..397875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01770"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /note="COG0769 UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62446"
FT                   /db_xref="GOA:Q2NCZ5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ5"
FT                   /protein_id="ABC62446.1"
FT                   /translation="MKLARLAEAAGIAIEGGEDIAVSGFAIDHRKVAPGTVFGAFQGSA
FT                   VNGEDYISQAVAAGAVAVVAQPEATVEGAVHIAEDTPRRAFALLAAQYFTPVPKTIVAV
FT                   TGTNGKTSTVEMTRQLWRMAGERAASIGTLGVTTPDESVSTGLTTPDIVTFLSNMSGLA
FT                   REGVTHVAYEASSHGLSQYRNEGLPVAAAAFTNFSRDHLDYHGTMDEYFEAKMRLFDEV
FT                   VDAGGTAVVWTGNSEWTAQAIERARQRELRLFTVGEQGEDIRLRARTPTQLGQELEIEH
FT                   AGETRKLRLPLIGEYQVANALTAAGLAIATGTDPAAVWDGVSRLQPVRGRLERAVITAT
FT                   GAPVYVDYAHTPDALEAALAALRPHVEGRLLCIFGAGGDRDTGKRAPMGEVASRMADAV
FT                   IVTDDNPRGEDPAAIRGQVLEGAGDNAREMADRREAIREVIESAAAKDIVLIAGKGHET
FT                   GQIIGSGENMRVEPFDDVQVARECAAQISKNAWGATE"
FT   gene            397830..399326
FT                   /locus_tag="ELI_01775"
FT   CDS_pept        397830..399326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01775"
FT                   /product="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /note="COG0770 UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62447"
FT                   /db_xref="GOA:Q2NCZ4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ4"
FT                   /protein_id="ABC62447.1"
FT                   /translation="MRGADFEKCLGRNRMSMHSALLKWPVTRRDALPVALWSAQEIAAA
FT                   TGGTASGDFQCAGVEMDSRDVRPGDLFVALKGESMDGHRFVEKAFAAGAAAALVERPVD
FT                   WPHVLVEDTGAALEALAHAARERADAKRIGVTGSVGKTGVKEAIFAALEKSSRGQAHRS
FT                   VRSYNNHVGVPLSLARMPARSRYGVFEMGMNHAGEIAGLTDHVRPHVAVITTIAPAHIE
FT                   NLGSIEAIADAKAEIFEGLVKGGTAVIPADSEQYEQLRASAEKRGVTIVSFGRADHADV
FT                   RLLDAIPAANGGSLVTAQVRDSRLCFTVAEPGEHWVSNALAVLAAVQAAGGDLGAAGLA
FT                   LAELGGLKGRGARHHVAVTGGKALLIDESYNANPASMRATLRQLGQTPATRRIAVLGSM
FT                   KELGDFGPEFHRQLAEPMGEADLDYAVLVGDEMLALARHLGKAGSGTLGKTPAFAHCDG
FT                   PAEAIAALQEYGLTAGDAILVKGSNSIGLGKLVDHFTRRV"
FT   gene            399349..400419
FT                   /locus_tag="ELI_01780"
FT   CDS_pept        399349..400419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01780"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62448"
FT                   /db_xref="GOA:Q2NCZ3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCZ3"
FT                   /protein_id="ABC62448.1"
FT                   /translation="MLYLIAEWLGFEGALNLIRYQTFRTGATLMTALVIGLIIGPRFIN
FT                   MLRVRQGKGQPIRDDGPQSHLAKRGTPTMGGLMIIVSLVLSLVLWMDLRSPFVWACLAV
FT                   TVGFGLIGFLDDLDKVTKNSHRGVSAKVRLLMEFLVAGIASYIIVSQINTWLYVPFVSD
FT                   RAIPLGPFYYVFAAVVIVGAGNAVNLTDGLDGLAIMPVIIAAGTFAIIAYLAGRVDYSE
FT                   YLGIPHVPGAGELAIFCAAIMGAGLAFLWFNAPPAAVFMGDTGSLALGGALGAIAVASH
FT                   HEIVLAIVGGLFVFEALSVIIQVFWFKRTGKRVFRMAPIHHHFEQLGWSESKVVIRFWI
FT                   VSIVLALMGLATLKLR"
FT   gene            400416..401795
FT                   /locus_tag="ELI_01785"
FT   CDS_pept        400416..401795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01785"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /note="COG0771 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62449"
FT                   /db_xref="GOA:Q2NCZ2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ2"
FT                   /protein_id="ABC62449.1"
FT                   /translation="MITCPAWSGKSFAVLGLARSGQAAAEALLASGADVMVWDRQEEPR
FT                   AAFEGRARVGDPMSEDLTGIDGLVVSPGVPLNTHPIVERAGHFGVPIIGDIELFAQARS
FT                   ALPPHRVIGITGTNGKSTTTALVTHLLKEAGVEARMGGNIGLPILGEEPLPEGGVYVLE
FT                   LSSYQIDLTRSLACEAAALLNITPDHLDRYDGFESYAFSKGRLFTMQGSGQFACFGCED
FT                   AQTRAVCNAAQSRRAEGRAICLEPEQYAAMQGDWPALQGPHNLQNVAAAIALVEEMGVT
FT                   RGDWEAGLTSYSGLPHRMEVVCEHESVLFVNDSKATNPASTAPALAAWPADPEPRVHWI
FT                   VGGLAKEDGLGECEAQLGNIKRAYAIGEAGPRFAELLGGRVPVERSELICEAVKQAVSN
FT                   AEAGDIVLLSPACASFDQFRDFEKRGEHFRQLVGALSGCDIDDICEPTLAGNGDMKGEA
FT                   A"
FT   gene            401792..403021
FT                   /locus_tag="ELI_01790"
FT   CDS_pept        401792..403021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01790"
FT                   /product="cell division protein"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62450"
FT                   /db_xref="GOA:Q2NCZ1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCZ1"
FT                   /protein_id="ABC62450.1"
FT                   /translation="MNSTQQPYVPGVGERMAGAELRSSSAMSELRIWWREVDRVVLFLV
FT                   LALITIGTIAVAAASPSSARRLSTASEKLPDLYFYWAHLRWQFVGIVVLLGASFLSRDN
FT                   ARRLGILIAAGMLGALFLVPLIGYEVNGAKRWIRFGLGFQPSEFLKPGFAIAMAWILSW
FT                   RLKDPNLPVLAIVTGLMGIIALLLMLQPNLGATILFGGVWFVLVLLSGVSAKRIAGIIA
FT                   AGVGALLAAYFLYDNARHRIDDFLGGGTAFDQVDLAQKTLLGGGWSGTGFWLGLKKMSL
FT                   PEAHTDYVFSVIGEEFGLVLCALVVILYLAIIARVLVRLADEENLFALLAAAGLITQFG
FT                   GQAFINILVNLQLFPSKGMTLPLVSYGGSSTIAVCLTIGLLLALTRRNPFLTRETPGLR
FT                   ALLSDKEKGA"
FT   gene            403018..404214
FT                   /locus_tag="ELI_01795"
FT   CDS_pept        403018..404214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01795"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /note="COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62451"
FT                   /db_xref="GOA:Q2NCZ0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCZ0"
FT                   /protein_id="ABC62451.1"
FT                   /translation="MTGANRHYVLAAGGTGGHLLPAFALAAELDRRGHHVALITDERGA
FT                   KIPGKPDFLPAHVIPAGRFGKNPLRWVGGLRAVWKGREMAKRLFESFQPSAVVGFGGYP
FT                   ALPAMLAASREDIPSIIHEQNAVLGRVNRLQAGRVSAIATAYPEIQRLKPKHAEKIHLV
FT                   GNPVRAGVLSLRDEPFPPFTEDGLLKVLVTGGSQGASVLSQIVPDGLAMLPPALRQRLQ
FT                   VTQQCRPEDLDTVRERYKTHDIPAELGSYFEDMAARLADAHLFIGRAGASTIAELTAVG
FT                   RPAILVPLPIATDDHQAHNTREVVKAGGARMIRQEKFTPKELAKQIQALGQRPDTLATA
FT                   AHAAWNCGRPKAVEDLADLVESFGGADMMDVIKVGGNNARAASQGVAVGQGAAKERAE"
FT   gene            404211..405635
FT                   /locus_tag="ELI_01800"
FT   CDS_pept        404211..405635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01800"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /note="COG0773 UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62452"
FT                   /db_xref="GOA:Q2NCY9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCY9"
FT                   /protein_id="ABC62452.1"
FT                   /translation="MRGVPTDIGVIHFVGIGGIGMSGIAEVMHNLGYQVQGSDLAEGPS
FT                   VERLRGRGIQVMIGHAPENIENAAVVVTSTAVKRTNPEVASALENRIPVVRRAEMLAEL
FT                   MRLKSTVAVAGTHGKTTTTSMIAALLDCGDIDPTVINGGIIEQYGSNARLGDSEWMVVE
FT                   ADESDGSFLRLDGTIAVVTNIDPEHLDHYGDFDGVKRAFLDFIHNVPFYGAAILCIDHP
FT                   EVQAVIGQVRDRRVMTYGFSLQADICGVNIRPEGGGNVFDVIVRQRGEEDRRIADVHLP
FT                   MPGRHNVQNALAAIAVSIEMGCSDEVIQRGFESFGGVRRRFTKVGEVGGATIIDDYGHH
FT                   PVEIAAVLGAAQEAVSSSDKGGRVIAVAQPHRYTRLRDLMDDFQSCFNDADAVYVTPVY
FT                   EAGEDPIDGIDAEALVAGLKSRGHRHAATIADPQALARTLAGEIEEGDVVVCLGAGDIT
FT                   KWAAGLADAIAQERGA"
FT   gene            405632..406603
FT                   /locus_tag="ELI_01805"
FT   CDS_pept        405632..406603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01805"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="COG0812 UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62453"
FT                   /db_xref="GOA:Q2NCY8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCY8"
FT                   /protein_id="ABC62453.1"
FT                   /translation="MNTIQPDDWAMHDTGAAPTAEVEGAVAAPVPIEGIRGKLTNQAPL
FT                   AKLVWFKSGGAADWLFEPADLDDLKTFLARLDGDLPVMALGLGSNLIIRDGGVPGVVIK
FT                   LGKAFASVETHDDYTVTCGAGAHGVLVASTARDAGIAGLEFMRGIPGTIGGFVRMNAGA
FT                   YGRETRDVLIDCDVVLPGGSFVTLPVADLQYTYRHSALPDGAVVVSARLQGEPGDPEII
FT                   GAEMERVAEAREQSQPVRTKTGGSTFKNPPGKKAWELVDAAGCRGLTMGGAQVSEKHTN
FT                   FLINVDGATSADIEGLGEEVKRRVYAHSGVELEWEIQRVGRP"
FT   gene            406600..407571
FT                   /locus_tag="ELI_01810"
FT   CDS_pept        406600..407571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01810"
FT                   /product="D-alanyl-D-alanine ligase"
FT                   /note="COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62454"
FT                   /db_xref="GOA:Q2NCY7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCY7"
FT                   /protein_id="ABC62454.1"
FT                   /translation="MSLDRKLHVVVLMGGWANEREVSLMSGEGVAKALEKRGHTVTRID
FT                   MDRQVAAKIAEAAPDVVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKELT
FT                   KQQLVPRGIPMPGGRIVQSEDLYQQDPLARPYVLKPVNEGSSVGVAIVTDESNYGNPIR
FT                   RDAPGPWQEFRELLAEPFIRGRELTTAVVGGQALAVTELKPKSGFYDFDAKYTDGMTEH
FT                   VCPADIPPEIEALCKKYALEAHRILGCRGTSRTDYRWDDEQGDDGLFVLETNTQPGMTP
FT                   LSLVPEQAAYAGMSYEDLVEAIVEAALEHFAAKTGGNDGDQG"
FT   gene            407555..408463
FT                   /locus_tag="ELI_01815"
FT   CDS_pept        407555..408463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01815"
FT                   /product="cell division protein"
FT                   /note="COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62455"
FT                   /db_xref="GOA:Q2NCY6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY6"
FT                   /protein_id="ABC62455.1"
FT                   /translation="MATRVKRKTQGVRRSTAARNRANKARQARDRGKGLFDGAMAMLPF
FT                   TDEQLQRVFLAIILGGAVALAWFVASLAGVPAMARAELAAVASDAGFEVRRVRVSGVDR
FT                   MNELKVYEAALGQRDTPMPLVDLESLREELVELPWVRDARVSRQLPDSLVIDIVERTPH
FT                   AALAKPGRLVLIDATGEELEPITEANAKGMLRVSGPGAAKQVAALGELLDAAPALKPRV
FT                   TAAEWVGNRRWNLTFATDQMLALPQGEDEAATALINFARLDGQNRLLGGKVATFDMRVP
FT                   ERVYMRIPGRSQQVLDSTGAQ"
FT   gene            408463..409716
FT                   /locus_tag="ELI_01820"
FT   CDS_pept        408463..409716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01820"
FT                   /product="cell division protein"
FT                   /note="COG0849 Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62456"
FT                   /db_xref="GOA:Q2NCY5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY5"
FT                   /protein_id="ABC62456.1"
FT                   /translation="MGLPRIARVFGAVNIGSFRVAAMIMGVSETGEMVVLGSGHRQAQG
FT                   IHRGFVTDMTAATYAIRNAVERAEENAGTRVQSVWVGCAGAGLTSRVAKVEVPIGGRRI
FT                   EEEDIEHLLLAANQNIEPDGRMVLHAQPAHYTLDGAHGVANPKGLHAERLGVDIHVMLA
FT                   EGAPVRNLKDAVENAHLSVESVVAAPIAAGYACLSPEERELGTAMIELGGEVTNIGIFK
FT                   HGMLVGLTSIPLGAADITDAVASAFGIRRFQAERLKCLAGSAIASPSDHREMVPVNAPG
FT                   DGVSEDHKINRAELVSVITEQLARLTDEAGRALKGLDFAGARGQVVLTGGGAQLAGVAE
FT                   FMQGALGRPVRVGKPPELRGLPDAMRNPGFATLAGLCIYAANDPIDIRSIDKRYQKTTR
FT                   ATGVGLINRIWSAAREHF"
FT   gene            409876..411639
FT                   /locus_tag="ELI_01825"
FT   CDS_pept        409876..411639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01825"
FT                   /product="cell division protein"
FT                   /note="COG0206 Cell division GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62457"
FT                   /db_xref="GOA:Q2NCY4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY4"
FT                   /protein_id="ABC62457.1"
FT                   /translation="MSINIGPATSDELRPRITVIGVGGAGGNAIANMIDAGIEGVDFCV
FT                   ANTDAQALNTSDAATRIQLGPDITGGLGAGARPEVGKAAAEETVAELEDVLDGVNMCFI
FT                   AAGMGGGTGTGAAPVIAEAARRKGVLTVGVVTKPFLFEGTRRMRAAEAGIDELQKHVDT
FT                   LIVIPNQNLFLVAKADTTFKEAFQLADEVLQQGVRSITDLMVMPGLINLDFADVKSVME
FT                   EMGKAMMGTGEGEGENRALEAAERAIANPLLDGVSMTGAKGVIISIIGGDDMRLLEVDE
FT                   AANHIRELVDEDANIIWGSAFNPDLDGKIRVSVVATGIEAGEAGSVGTSSTMSLAGGRA
FT                   PKRPVLELPEDDEADEDAFELTEPEMAEEPEAEPEAEPAMLGGLSGMDSAYDDEDEDDE
FT                   DDDVDGIVDPLAGLRNDQDEEYEPMPEAASDDSQFAGTATSEEGYASTDSDEVDPEDDW
FT                   GDALDLTEEEPAADASNADADEGDVGGGGQGDKLLLDADQLAERDEPVESAAQGGKRRG
FT                   LVAGSGGSADGGSGDGGGGGGDAGGSTLFERMANLSRGSGSKDKPDSDDDDDEDGGALN
FT                   IPRFLGRQNNQ"
FT   gene            411728..413482
FT                   /locus_tag="ELI_01830"
FT   CDS_pept        411728..413482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01830"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62458"
FT                   /db_xref="GOA:Q2NCY3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY3"
FT                   /protein_id="ABC62458.1"
FT                   /translation="MPIYRSILCASGALAALTIPLAAVSAQDTSGGRAVVQALPSAASE
FT                   ELRTALRQLARNSRDLNALIAAGTASLELGDVEAAVGFFGRADELAPGDPRVKAGKAAA
FT                   YVRTERPVEALRLFEEAEGEGVEIVRLAGDYGLAYDLVGNNRAAQAAYRRVLARAPSDE
FT                   VSRRLALSLAIDGNADAFEETLRPLLAQRDFAAYRTRAFGLAILGRADDAVAIAEAVMP
FT                   RTMSRKIEPYLRYMPRLTRAQQAAAANLGIYPRAAQIGRDDPRIAGLSPPTTAAPQRTA
FT                   DAVLAPSGPPLGQAEAEAAQPAPSRREARRLARAAQRESASDPLTRTRERPRVVRAAPS
FT                   AQQSAPDAAAPGGQTAIAAADPAPAPAMEVPQPAAQIAQAPEQAAPLEPAPAREEPVVV
FT                   ARMDDPATSPGFDLANVGGSTAASAAASSGSNPLGARTAATQPPVPSGRPASLADAFSD
FT                   FSAPLIPQAEPAAGAVDITAITAPREVEAPPEPAKPTHSSRFWVQVATGRDRAALRFDW
FT                   RRLSRAADGLLDGKGPFVTPWGQTNRLLAGPYDSRDAARKALNGLQEKDLDAFTFTSPE
FT                   GQEVEPLG"
FT   gene            413654..414145
FT                   /locus_tag="ELI_01835"
FT   CDS_pept        413654..414145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01835"
FT                   /product="hypothetical protein"
FT                   /note="COG5465 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62459"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY2"
FT                   /protein_id="ABC62459.1"
FT                   /translation="MQFNANEDAAPLDMLAALFEARDWAIESLTDEEITGEIQGSWAKY
FT                   QLRGIWRTMDNVLQIVCVPDIRVPSDKRPAAQELLARVNEQMWLGHFDLWSNGGVVIYR
FT                   HGALLPDDGMLSLNQAQALIESAVEDCDRFYPAFQFVLWGDKSPEAALEASMVDAAGEA
FT                   "
FT   gene            414191..415000
FT                   /locus_tag="ELI_01840"
FT   CDS_pept        414191..415000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01840"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="COG0345 Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62460"
FT                   /db_xref="GOA:Q2NCY1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY1"
FT                   /protein_id="ABC62460.1"
FT                   /translation="MTDIRNMLIVGFGTMTGAMVEGWLKAGIAPEVFTVYHPRGKDVPE
FT                   GVRLVTDWPTERFDAVLLGVKPYMLDDVAPGLARAVSDKTVVLSVLAGIELASLRARFP
FT                   QAEGVVRFMPNLACALGKAPNGLIGEGLSDTQRGMVTDLAEKLGSAEWLEDESRFDLVT
FT                   ALAGSGPGFVYRFIDALAVAGTRLGLDEGQAGRLAIQMVEGAAALAAQSEHSPGELARR
FT                   VASPGGMTQKGLDVLDENDALVDLLTQTLRAARDRGAEMAAEAREKG"
FT   gene            415122..415868
FT                   /locus_tag="ELI_01845"
FT   CDS_pept        415122..415868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01845"
FT                   /product="integral membrane protein"
FT                   /note="COG0670 Integral membrane protein, interacts with
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62461"
FT                   /db_xref="GOA:Q2NCY0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCY0"
FT                   /protein_id="ABC62461.1"
FT                   /translation="MADWNDPRQAQQGFGSVPRAGGDVASRTTFDAGLRKYMLSIYNYM
FT                   ASGILLTGIIAMLTANSGLAYSFASGPMMWIVALSPLAIVFAMSFGMNKFSKGTLQAMY
FT                   WGFAVLMGLSLSTIFLVYTGASIAVTFFATAGAFAGLSLFGYTTQKDLSGWGSFLIMGV
FT                   VGLIIASVINIFLQSEALMWAVSFLGVLIFAGLTAYDTQKLKNIYSSVRGTPMMDKVVI
FT                   MGALNLYLDFINMFLFLLRFMGATRE"
FT   gene            416204..417076
FT                   /locus_tag="ELI_01850"
FT   CDS_pept        416204..417076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX9"
FT                   /protein_id="ABC62462.1"
FT                   /translation="MPPRPAPPLGASSMMSVPQIGIDGQRQTVNAGLSSAQTTWNVRSA
FT                   LNVAALNCLEPRFSVILPNYVQFLDNFERPLRSANNTVTAEFRDRYGARDFRAEQDTYM
FT                   TQVYNYFALPPALDNFCAAALEVSNESLAVAPADLDSFSARALPRLEGVFEDFYRSYEQ
FT                   YQADLASWTATYGINAVPGQPVGTFARTGSLAPTPTEQIIYRETPDGVPRNDGLSGTRD
FT                   SANVTVLPSVDPGASDAAQGPTLQSDPVLVTDPTLQTLPQPTPTPAPSQDSDVVFTSEP
FT                   VVQDDPPEE"
FT   gene            417156..418214
FT                   /locus_tag="ELI_01855"
FT   CDS_pept        417156..418214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01855"
FT                   /product="predicted GTPase"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62463"
FT                   /db_xref="GOA:Q2NCX8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCX8"
FT                   /protein_id="ABC62463.1"
FT                   /translation="MHFLDQAKIYLKSGAGGPGAVSFRREKYIEYGGPDGGNGGKGGDI
FT                   VFEAVQGLNTLIDFRYAQHFKAKRGAHGQGKDRTGAGAPDLVIKVPVGTQVLSEDKEEV
FT                   LADFTEVGQRVTFLAGGMGGRGNASYKSSTNRAPRQHQPGQAGEEMWVWLRLKLLADVG
FT                   LLGLPNAGKSTFINAVSNAKAKVGHYAFTTLVPKLGVVNHKGREFVLADIPGLIEGAAE
FT                   GAGIGDRFLGHIERCRVLIHLVDISGEDPAEAFQTVNAELEAYGEGLEDKPQLVALNKL
FT                   DLADEELVAGFAEELLEAGADEVFAVSGATGAGIEPLLDAVLGYLPDSTSTETKGSEVE
FT                   EVDEEGGEWSPI"
FT   gene            418199..419317
FT                   /locus_tag="ELI_01860"
FT   CDS_pept        418199..419317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01860"
FT                   /product="glutamate 5-kinase"
FT                   /note="COG0263 Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62464"
FT                   /db_xref="GOA:Q2NCX7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX7"
FT                   /protein_id="ABC62464.1"
FT                   /translation="MVADLSDLARSQRLVVKVGSSLLVEHGEARADWLKSLAQDLAQLR
FT                   AKGTKVIVVSSGAIALGAARLGFEKGGRGSLSDAQASASVGQIALAGLWSQALGDVGLT
FT                   AAQILLSLDDLEDRARYLNASATLGRLLDAGAVPVVNENDSVATEEIRFGDNDRLAARV
FT                   AQAAGADAVLLLSDVDGLFTADPAAPDSELVGRIEGITPEVLAMASAASSSGLGSGGMV
FT                   SKLQAAQIAERAGIALAIINGTHEAPIARALDTGVGTVFVPQRSDGARKAWLGGRLAPQ
FT                   GTLRVDAGCAQALQGGASLLAAGIVGISGAFRRGDLVSIVTVSGRKIAQGLAEYDSSEC
FT                   QAIIGKREGDQAAILGYAPRAAVIHRDHMVML"
FT   gene            419330..420238
FT                   /locus_tag="ELI_01865"
FT   CDS_pept        419330..420238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01865"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62465"
FT                   /db_xref="GOA:Q2NCX6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX6"
FT                   /protein_id="ABC62465.1"
FT                   /translation="MTIAITGGTGFVGQALIDLAERKGVKLRSLARRIPEDRRGVDWVQ
FT                   GDLADPAALAKLVDGADAVIHIAGQVRARNPGEFEAANVTGTLNVIEAALDAHVPRFVF
FT                   VSSLAAREPALSAYGASKLRAEKLVAASGLDWTIVRPPAVYGPRDGEMLDLFEMATMNV
FT                   VPMPKQGHASLIHVGDLARLLLAVLPSGEATTGRIFEPDDGKQGGWEHRELALAIGWAV
FT                   GKRPFVPRLSKGMLAFAAKLDGLLRRDEAKLTPDRVGYMCHPDWVSDPAARPPRELWQP
FT                   KIPTREGLKASAKWYRDNKWL"
FT   gene            complement(420243..421028)
FT                   /locus_tag="ELI_01870"
FT   CDS_pept        complement(420243..421028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01870"
FT                   /product="phosophoadenylyl-sulfate reductase"
FT                   /note="COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62466"
FT                   /db_xref="GOA:Q2NCX5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX5"
FT                   /protein_id="ABC62466.1"
FT                   /translation="MNELRAIDRLDTGPRFTDHDAVRLNRMFRGSSTEEMLESVIRDGL
FT                   AGDVTTVSSFGAESAVLLHLLAQVDPGIPVLFLETGKHFPETLAYRDDLVERIGLTNLI
FT                   NLYPDLSELETKDETGLRWSYDPDGCCEIRKVKPLARALSEYDASFTGRKAFQNSERAN
FT                   LPRFEIDTSDAQGRLKINPLIDWDASQIEAYFIQHDLPRHPLVAQGYPSIGCSPCTHKV
FT                   APGEDPRSGRWRGWDKTECGIHMPGSDDGDLPPGYDPAF"
FT   gene            complement(421021..421497)
FT                   /locus_tag="ELI_01875"
FT   CDS_pept        complement(421021..421497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01875"
FT                   /product="hypothetical protein"
FT                   /note="COG3749 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62467"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX4"
FT                   /protein_id="ABC62467.1"
FT                   /translation="MTESPKPASDTVSGTSPDEVQFRFRDDEVADHAQVTVDAFLEQTN
FT                   AVAVRIEPGDDARELLPFLDRLQLVEVNFPAFGDGRGYSSARILREAGYDGELRAIGDV
FT                   LVDQLAYMRRCGFDSFAPEKAIDEDDAKAAFERWPHVYQSAADARRTIPELRHE"
FT   gene            complement(421490..423124)
FT                   /locus_tag="ELI_01880"
FT   CDS_pept        complement(421490..423124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01880"
FT                   /product="hypothetical protein"
FT                   /note="COG0155 Sulfite reductase, beta subunit
FT                   (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62468"
FT                   /db_xref="GOA:Q2NCX3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX3"
FT                   /protein_id="ABC62468.1"
FT                   /translation="MYQYDHYDQAMVDARVEEFRDQTRRRLEGKITEDQFKPLRLMNGL
FT                   YLQLHAYMLRVAIPYGTLNSAQMHALADIADKYDRGYGHFTTRQNIQYNWIKLEDAPDL
FT                   LADLAKVEMHAIQTSGNCIRNISSDHFAGAAADELIDPRPYAELLRQWSSFHPEFSYLP
FT                   RKFKIAVIASETDRAAMKLHDIGIQIVKNDAGEIGAAFYVGGGMGRTPMIAPLIRDFVP
FT                   LDHLVTYAEACLRVYNRYGRRDNKYKARIKILVHELGAEEYTRQVEEEFQHLLDQGVEP
FT                   PRAELERIIPYFADPAFDDASKDAIDRSNPDFADWVDANTHPHKRDGYVSAVISLKPVG
FT                   GIPGDASAHQMHVMADLAREYSFDECRVMHTQNIVLPHVRKSELYALWQKLESEGLGAP
FT                   NLDTIEDIIACPGLDYCSLANARSIPVAQKISERFAAKGRTKELGELKLKISGCINACG
FT                   HHHAGHIGILGVDKKGTENYQLLLGGSEAQDTALAKITGPGFDEEGIVDAVETATDVYL
FT                   SNRENGERFLDTYRRIGMAPFKEALYD"
FT   gene            complement(423126..423422)
FT                   /locus_tag="ELI_01885"
FT   CDS_pept        complement(423126..423422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62469"
FT                   /db_xref="InterPro:IPR021270"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX2"
FT                   /protein_id="ABC62469.1"
FT                   /translation="MKILTGNDLKTGAVVWWDGTGWSLHVNDAVDTGERADEIAASEES
FT                   ARRVNAPYALEATRDENGVRPAHIKDRVRALGPTVRPDLTLKPKDPEAMDWVI"
FT   gene            complement(423419..424177)
FT                   /locus_tag="ELI_01890"
FT   CDS_pept        complement(423419..424177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01890"
FT                   /product="Siroheme synthase"
FT                   /note="COG0007 Uroporphyrinogen-III methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62470"
FT                   /db_xref="GOA:Q2NCX1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX1"
FT                   /protein_id="ABC62470.1"
FT                   /translation="MAETGTIYLVGAGPGDPDLLTLRAARLLERAGLIVHDGLVDPSIL
FT                   ALARPDATLVSVAKQRSKHTLPQEDINALLVREARAGRDVVRLKGGDPLIFGRGGEEAE
FT                   AAQAAGVPVEIVPGISAANGAAAAAQIALTHRDASSIVSFVAGQCKGLKDQDWAGLAGK
FT                   GRTLVIYMGVKTAPQIAEKLMADGLSPDMPIAVIENGARPEMRVLRGLLAGLPGLVEAE
FT                   RVKSPALIVIGDVTARDDARIAQIATEAAE"
FT   gene            complement(424275..425510)
FT                   /locus_tag="ELI_01895"
FT   CDS_pept        complement(424275..425510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01895"
FT                   /product="hypothetical protein"
FT                   /note="COG3264 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62471"
FT                   /db_xref="GOA:Q2NCX0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCX0"
FT                   /protein_id="ABC62471.1"
FT                   /translation="MTTSAPSTTVSDTAPAPSPSPSPEAVPLVDPETGEPLLDPETGEQ
FT                   LTGIPAPQPTEYLDPETGEVLVDPETGEPLAAEPEAVATPEPTPTEAITTAEEAKAAVA
FT                   EKSETVGSMIESMDAMAIELGSMRLSLWDIVFASAIVLLIILGAWIATKAIHALVTRVT
FT                   RLDDTQRLLSEKIVTIVVWAAAFFLGIDLLGIDLTALAVFSGAFGLAIGFGLQKTFGNL
FT                   IAGIILLMDKSIKPGDVIAVSDQAGNSTFGQIQKIGIRAVSITTRDQKEYLIPNENLMI
FT                   NQVENWSYSSKNVRMQVPVGVSYNCDLKLAEKLMLEAAKSSKRVKKSPPPTAWLDEYGD
FT                   SSVNFIIHCWISDPEDGVGNVKSEVLKRLWDLFEEHEVEIPFPQRDLNLRGNAQFDQLV
FT                   AAITQRVKSDKA"
FT   gene            complement(425507..426760)
FT                   /locus_tag="ELI_01900"
FT   CDS_pept        complement(425507..426760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01900"
FT                   /product="cystathionine beta-lyase"
FT                   /note="COG0626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62472"
FT                   /db_xref="GOA:Q2NCW9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW9"
FT                   /protein_id="ABC62472.1"
FT                   /translation="MGGRSGNAQGNGSGRLSDKKKLRTGTKLVEAGRREEWTGPVVNPP
FT                   VWRASTHLYANEAERKAAQGNNVDGQFYYGRRGAPTQWSLCEALTEIEPGAFGTILYPS
FT                   GTAAIVQALMAVLRPGDVLLVTDNAYEPSRTIASGILKRFGVEPRFFDPMDVAGFPDVF
FT                   CDRTKAVLFECPGSLTMEVQDVPALTAIAREKGAVSLVDNTWAGPLGFPALERGCDITI
FT                   MSLTKHVSGHSDVMMGSATARDERLYRRLRRTAQQMGTIVSPDDAALMLRGLRTMEVRL
FT                   QRETASALTLARWLRERDEVAHVLCPLLDGSPGHDIWARDFTGGCGLFSFVLKGRTSEQ
FT                   RAAFIDALDLFGIGYSWGGFESLVIPFDPADIRTATPWPPAGWAVDEHLGIRLSIGLED
FT                   PEDLIADLDQAFTAMGTA"
FT   gene            complement(426712..427560)
FT                   /locus_tag="ELI_01905"
FT   CDS_pept        complement(426712..427560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01905"
FT                   /product="thiosulfate sulfurtransferase, putative"
FT                   /note="COG2897 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62473"
FT                   /db_xref="GOA:Q2NCW8"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW8"
FT                   /protein_id="ABC62473.1"
FT                   /translation="MDALVSTDWLAGQFGSPDLVVLDASLHLPQAGRDAEAEFEKGHIP
FT                   GARFLHLAALHDPASSLPGKIPEPDALAERLSALGAEPESRIVLYDDSALRTACRAWAL
FT                   LRFAGLEKIAVLDGGFAKWRSENRAIETGPGECGHGAAPDLHVERARLRDKAQMLANCA
FT                   DSAEQVIDARDAGRFAGTVEDTVHNLPGGHIPGACNLPFTALFREDGTFKPENELRTAF
FT                   EDAGIDLSRPIVTSCGSGVTASVLIFALHLLGIEDAALYDGSWSEWGADPETPKATGVA
FT                   G"
FT   gene            complement(427591..428304)
FT                   /locus_tag="ELI_01910"
FT   CDS_pept        complement(427591..428304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62474"
FT                   /db_xref="GOA:Q2NCW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW7"
FT                   /protein_id="ABC62474.1"
FT                   /translation="MPSLPTEAAPPMARSTPVKEETPEGSLTDYWWIAAILAGFAAVAV
FT                   ALVFRRRRTASAPILIEAPKVAPTGGAADALATDLTDLRVELEAIRVTRSMRNATLAYR
FT                   LTLTNRGSHALRNLNIGGDLTSAHGGSPITEQLADPAKDLPVIQAVDHLGAGQRKSLTG
FT                   ELRLPLESVRLIRQGKVPIYVPLARIRVSDGRGEPRAFTFVVGKQPQPGLGRLQPFRLD
FT                   TPPQGFSDVGARALT"
FT   gene            428363..428698
FT                   /locus_tag="ELI_01915"
FT   CDS_pept        428363..428698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW6"
FT                   /protein_id="ABC62475.1"
FT                   /translation="MVLGEGCCGAAVAAGLGAPAVGVAVGRGRTVVGAGVGAGVTREVG
FT                   VAAGVGVGAGAVGMTRGPTGTIPLSSTGPCGRGVAVGVGLGGRLKPPCDCAIAGMAHAS
FT                   AIRGRAL"
FT   gene            428812..429294
FT                   /locus_tag="ELI_01920"
FT   CDS_pept        428812..429294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01920"
FT                   /product="probable GTP cyclohydrolase I"
FT                   /note="COG0780 Enzyme related to GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62476"
FT                   /db_xref="GOA:Q2NCW5"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW5"
FT                   /protein_id="ABC62476.1"
FT                   /translation="MRGMSDTPTPAEGAPQFLGKQTALPASPEDAVLDYVPNPRPGALY
FT                   LVRFAAPEFTSLCPVTGAPDFAHLVIDYAPGDTVVESKSLKLFLGSFRNHNGFHEDVTV
FT                   GIGQRLNEEMRPRWLRIGGYWYPRGGIPIDVFWQSGPSPEGLWVPDQGVAGYRGRG"
FT   gene            429356..430870
FT                   /locus_tag="ELI_01925"
FT   CDS_pept        429356..430870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01925"
FT                   /product="hypothetical protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62477"
FT                   /db_xref="InterPro:IPR025515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW4"
FT                   /protein_id="ABC62477.1"
FT                   /translation="MRKAAILIGIIVALLAIAGGAAYYYLQTQVAIADYPRPVRSDTAP
FT                   EIADGDTVLVTQVGIPLETIRRALEKDVPRRLYAIDRQMENCVPRRNIRVFGEDLGRTP
FT                   KVACRITGQVRRGAISVVGRGDRLIARLPVNATVRARDIGGVIKQETATASAMMEVTVR
FT                   ISVGRSWQPRAAVDLDYRWTREPGIDILGQRITFTEPANRELRGVLREVERSLQREVAK
FT                   IAIKPVVEKLWSRGFTTLSLSEDNPPVWLTIAPQEAGVGQFRVAGRQLIADVMVAARTR
FT                   VKVGERPEDVQRKALGPNAGITEGGGFRAVVPVMADYAELEPVLLRELGKLADKGIKRE
FT                   DLGRLELEFEDVEIFATDDDRLAVGIVAEVVPVGRRTGRSWGRTRGEVWLTGRAATQAG
FT                   SEVVRIEDLRIFGDMDAISGDVLIRIMRREEVRSAIEAALVEDFRQDYARIAEKVRAGL
FT                   ADVGSGDIRLSITVDAIDHGEVQVTGQGLYLPVEARGRVEADVAIR"
FT   gene            complement(431066..431138)
FT                   /locus_tag="ELI_t15149"
FT   tRNA            complement(431066..431138)
FT                   /locus_tag="ELI_t15149"
FT                   /product="tRNA-Thr"
FT   gene            complement(431226..432113)
FT                   /locus_tag="ELI_01930"
FT   CDS_pept        complement(431226..432113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01930"
FT                   /product="hypothetical protein"
FT                   /note="COG0410 ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62478"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW3"
FT                   /protein_id="ABC62478.1"
FT                   /translation="MRPDRFTHFLAIDWSGAKGERQRGIALSLADAAGGPPVLVERGRG
FT                   WSREEVADIITHEVPRDTLIGMDLGIALPFADAGAYFPGWDDSPADAKALWALIDDICA
FT                   ADPHLKCGSFIAHTQASRYFRHSREHVGDRFLLSDAPTREGRFRVAEAAQRAQGVRPVS
FT                   NFNLVGAAQVGKSSLTGMRMLHRLRDRVSVWPIDPLPECGPVVVEMYTSIAARGGGVIG
FT                   TKTKLRTYEDLNAALVQLGSPPVPGEGTIDDHSSDALLTAAWLRTVGHDPAYWNPAGLT
FT                   PEIARTEGWTFGAL"
FT   gene            complement(432103..433425)
FT                   /locus_tag="ELI_01935"
FT   CDS_pept        complement(432103..433425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01935"
FT                   /product="ATPase"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62479"
FT                   /db_xref="GOA:Q2NCW2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW2"
FT                   /protein_id="ABC62479.1"
FT                   /translation="MADLFGNDAAPARDDAPREDAPLADRLRPRALGEVIGQEHLTGPK
FT                   GAIGRMVASGKLSSMVLWGPPGTGKTSTARLLADAVGMRFVAISAVFSGVADLKKAFAE
FT                   ADRMAAAGRKTLLFVDEIHRFNRAQQDGFLPFVERGTVTLVGATTENPSFELNAALLSR
FT                   AQVLILHRLDAEALGKLLDRAEALEGPLPLTDEARAALIASADGDGRFLLNQAETLYNA
FT                   NIDAPLGPAELGLFLQRRVAVYDKDREGHYNLISALHKSLRGSDPQAALYYLARMLTAG
FT                   EEPLYVLRRLVRFASEDIGLADPQALTQCLAAKDAYEFLGSPEGELAIVQACLYCATAP
FT                   KSNAAYAAQKAAFRSAKETGSLMPPQNILNAPTKLMKEIGYGAGYAYDHDADDGFSGDD
FT                   YWPEEMEPQTYYAPVERGFERKVKERIAYWDNLRRERRDAS"
FT   gene            433524..434192
FT                   /locus_tag="ELI_01940"
FT   CDS_pept        433524..434192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01940"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1695 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62480"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW1"
FT                   /protein_id="ABC62480.1"
FT                   /translation="MTMTWQKYGRGGWNNLGPMIAMMAASAASDWEDGERRSRSRKGRG
FT                   WQDGAGRTKRRGRMFAQGELRLALLALIAREPRHGYELIRAIEDMTGGGYAPSPGAVYP
FT                   TLQLLEEEGQIKPAKAKGKAKSEGGESETGGKKPFKATKSGKAELEERAEEVDQLMERL
FT                   GAHGERAERVREKSPDLFRAMGNLANVLKIRARSGKLDQNTIDQIVDIIDEVAKRIERL
FT                   "
FT   gene            434282..434734
FT                   /locus_tag="ELI_01945"
FT   CDS_pept        434282..434734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01945"
FT                   /product="Predicted membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62481"
FT                   /db_xref="GOA:Q2NCW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCW0"
FT                   /protein_id="ABC62481.1"
FT                   /translation="MEGMVMNRIGRTATPWHLWVVGIVSALWNLGGVASYLATETGNLD
FT                   AFGMPSDLHSYFYDFPAWAVAFWALGVWGCFFGSLALLLRSKWAVTLFGISIVGLLGTT
FT                   FYERVVAVVPAELQTTGQTLFAVAIWVITIGLFFYARRMRAAGVLR"
FT   gene            complement(434738..435883)
FT                   /locus_tag="ELI_01950"
FT   CDS_pept        complement(434738..435883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01950"
FT                   /product="glycosyltransferase"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62482"
FT                   /db_xref="GOA:Q2NCV9"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV9"
FT                   /protein_id="ABC62482.1"
FT                   /translation="METSDLRIALFSGNYNYTRDGANQALNRLVGYLLRQGAAVRVFSP
FT                   KVRDPDFEPTGELFDVPNIPMPVKGRGEYRMPTGLNTAAKNALREFKPNMVHVSSPDPT
FT                   GHAALKWARERGIPVLASVHTRFETYPRYYGLGFIEPLIERILRRFYNRCDALVAPSQS
FT                   MIDEYRSMGMHDDISLWTRGVDRETFNPSRRDLEWRRSYGLADEDVAIAFLGRLVMEKG
FT                   LDVFADAIIELRKLQAPHKVLVIGDGPARGWFEKALPGGIFVGFQTGKDLGRALASADV
FT                   FLNPSITETFGNVTLEAMASGLPVVAASATGASSLVNDGETGRLVPPGQPQEFAQAMAP
FT                   YCTDDALRLAHGAAGERRSRDYSWDAINQAVVDAYLRIAKC"
FT   gene            436056..437225
FT                   /locus_tag="ELI_01955"
FT   CDS_pept        436056..437225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01955"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="COG1932 Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62483"
FT                   /db_xref="GOA:Q2NCV8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV8"
FT                   /protein_id="ABC62483.1"
FT                   /translation="MTTHASEPALKPDRPQFSSGPTVKFPGWSLDKLKTDSLGRSHRSA
FT                   LGKSRLKYAIDLSKELLGVPEDYLVGIMPASDTGALECAMWTMLDPARPATVAAWESFG
FT                   NVWIQDAVKQLKLPKLTTLDADYGEIPDLHGIPQDNDVVFTWNGTTSGAKIPGTDWLAP
FT                   GREGVTINDATSAVFAMEMDWPKLDATTYSWQKVMGSEAQHGMLILSPKAVERIESYDP
FT                   AWPLPKLFRLKKGDKLNRAIFEGATINTPSMLATEDYIAALEWAKSIGGRQALFERANA
FT                   NAKIVTDWIEATPWVRNMVADPQKRTNTGVCFRFQGDWYDSLSADEQAAVPKTIAKMLE
FT                   ERDVGYDFNGYRDAPPSLRIWCGGTLEREDLKRLLPWIEWAYERVKAGA"
FT   gene            437253..437369
FT                   /locus_tag="ELI_01960"
FT   CDS_pept        437253..437369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62484"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV7"
FT                   /protein_id="ABC62484.1"
FT                   /translation="MLSLSKRRPYFWRALYPKKVQPFDRLRANGFSFLELFQ"
FT   gene            complement(437344..437793)
FT                   /locus_tag="ELI_01965"
FT   CDS_pept        complement(437344..437793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV6"
FT                   /protein_id="ABC62485.1"
FT                   /translation="MPVSSTPMKSFLGHSPACVRRSACGIWRASANIIATACSAVVIEL
FT                   PNGVFITTTPLELAYGISTLSTPIPARPMTLRLVAASRISGVTLVEERMARPSYSPMRA
FT                   LSSSGDSPVITSTSQPRSSKMRAAFESILSEMRTLGLVIGITPEN"
FT   gene            437366..438949
FT                   /locus_tag="ELI_01970"
FT   CDS_pept        437366..438949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01970"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62486"
FT                   /db_xref="GOA:Q2NCV5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV5"
FT                   /protein_id="ABC62486.1"
FT                   /translation="MTKPKVLISDKMDSNAARIFEERGCDVDVITGESPEELRARIGEY
FT                   EGLAIRSSTKVTPEILDAATNLKVIGRAGIGVDNVDIPYASSKGVVVMNTPFGNSITTA
FT                   EHAVAMMFALARQIPQADRRTQAGEWPKNDFMGVELTGKILGLIGAGNIGSIVAARAQG
FT                   LKMKVVAFDPFLTEERAIEIGVEKVDLDSLLARADFITLHTPLTDETRNILSQENLAKT
FT                   KQGVRIINCARGGLIDEAALAEALDSGQVAGAALDVFQTEPAKDSPLFGKPNFICTPHL
FT                   GASTTEAQVNVALQVAEQMADYLVDGGVTNALNMPSLSAEEAPKLKPYMGLAENLGSLV
FT                   GQLAHGNLTKISIEREGAAADLSGKPIEGAVLAGLMRQYSDTVNMVNAPFLAKERGLDI
FT                   RSIRHEKEGAYNTLLRVTVGTEQGDRSVAGTLFGSDAPRLVEIFGVRIEAQLEGHMLYI
FT                   VNEDAPGFIGRIGTLLGEHGINIGTFNLGRRSAGGEAVLLLSVDQPIPQDVVKAACALD
FT                   GVKTVMPLSF"
FT   gene            439042..440163
FT                   /locus_tag="ELI_01975"
FT   CDS_pept        439042..440163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01975"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="COG3705 ATP phosphoribosyltransferase involved in
FT                   histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62487"
FT                   /db_xref="GOA:Q2NCV4"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV4"
FT                   /protein_id="ABC62487.1"
FT                   /translation="MYGPAMTDTDDLLPIGLEDRLPAEARKATHAMRAALGAMDSHGYD
FT                   RVRPPLIEFERSLAGRMDGVQTRRLFRFVDPESLRTLALRSDMTPQVGRIASTGLADAP
FT                   RPLRLCYAGDVATITADQLDPARQRLQLGAELIGADTVAAASEIVMLAVEAVEATGARG
FT                   ISVDFTLPDLVDVLAADAFALAEDRIDAVRRELDTKDAGGLVAAGGEAYLPLIHAAGSL
FT                   GDALAKLRELDGGGTLATRIEALETIADRIGARARVTLDPTERHGFEYQSWFGFTIYAD
FT                   GARGALGRGGTYWIKGSDEAATGFSLYLDALLPALEGREPAATVFLPLGHDPSVAARLR
FT                   EEAWRTVAALEESDDPRALGCSHRLDGSEPVAL"
FT   gene            complement(440160..440978)
FT                   /locus_tag="ELI_01980"
FT   CDS_pept        complement(440160..440978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01980"
FT                   /product="putative oxidoreductase protein"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62488"
FT                   /db_xref="GOA:Q2NCV3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV3"
FT                   /protein_id="ABC62488.1"
FT                   /translation="MTDYPLLTLNDDRQIPQLGFGTWEIDPEDAAGAVKTALEAGYWLI
FT                   DTAAVYGNEKEVGEGIGDWSDIFLQTKIWNESQGYDRTLKAADKCLSRLGRDHVDMLLI
FT                   HWPCPEKGLFVETWKALIELRDQGKAKSIGVSNFREEDLKRIVDETGVVPALNQIELHP
FT                   TFQQREMRKLHDEMGIVTQSWSPLGQGNAFGNETIEAIAEETGQSAPAVVIRWHIQCGL
FT                   STLPRSTNPDHIRSNFTALDFELTDEQMKRIDDLDSDDGRMGPNPGEFNS"
FT   gene            complement(441033..442448)
FT                   /locus_tag="ELI_01985"
FT   CDS_pept        complement(441033..442448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01985"
FT                   /product="hypothetical protein"
FT                   /note="COG4102 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62489"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV2"
FT                   /protein_id="ABC62489.1"
FT                   /translation="MFIGKTNEISRRAFMRRTGQLAMAGAASSYALGLTGIGEAAAFSG
FT                   SGGYKALVCVFLYGGNDHGNTLIPYDAANYNRYLAIRGGANGGEGIALARDSLAASVLN
FT                   QPAGQVLTDDIRYALAPTMPRLKARFDQGLMAPLLNVGPLEAPMTRVQYDNRSVPRPPK
FT                   LFSHNDQQSTWQSSNPEGSVTGWGGRMGDLALTSNTNSMFTVINATGNAVFLAGENALP
FT                   YQVGSGGAVQIGALGRNVYRSGAASSALETLLRQHNGHLLEADYAQTTARSIEYGGFVN
FT                   NALDNSSLTTDFGNGNRLADQLSVVARLIAARGSLGVTRQVFMVSMGGFDNHDGLIGQH
FT                   EGLLGQVDAALDSFYRATVEMGIADRVTAFTASDFGRTLTSNGDGSDHGWGGHHFILGG
FT                   AVNGGRFYGTAPQVSVESNDQVGRGRLLPSTSVDEYSATLARWFGVSDSELPSVAPNIG
FT                   RFATRNLGFMAAS"
FT   gene            complement(442463..444340)
FT                   /locus_tag="ELI_01990"
FT   CDS_pept        complement(442463..444340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01990"
FT                   /product="hypothetical protein"
FT                   /note="COG5267 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62490"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCV1"
FT                   /protein_id="ABC62490.1"
FT                   /translation="MRDQTLETASATVPVRESVGEDGSQGAHPAELHTEGATSAGLAAR
FT                   AAVGSLALATAACGGGDGGSGSSGGGGAPPTGGGGTPAPTVLKPQTDAQAARFILQASI
FT                   AASDGAIAEVKDLGYEPWLDAQMNLGNDRSARAFFADRGYDAVDGNRHYFSRRPADNMM
FT                   WSQLIRGTSGVRKRAALALSEFFVVSLNSVSITWRSQALGEYWDILNEHAFGNYRDLLE
FT                   AITLNPAMGVFLNTLGNRKADGKGRVPDENYGREVMQLFSIGLYELNIDGSLRTDSAGD
FT                   PVDTYDNDDVTGIAKAFTGYDYDYSGVGFTTNAGDGGRQVQDPDYARQPMTADLAKWRR
FT                   PRGEGFHSDEEKSFLGTTIAPGTGAAETLRLTLDALYNHPNVGPFLGRQMIQRLVTSNP
FT                   SPAYVQRVAETFNNNGSGVRGDLRAMFKAVLLDDEALSDSGVSSNTFGKLREPMLRFAQ
FT                   FGRTFGARSSSGNWDVGDLSSSSNRLGQSPLRSPSVFNFFRPGYVPLNSQAADNGLVAP
FT                   EFQIVNESTVATYVNFMERSIEGRGSWMNDIEIPYASELGIAHDSTALLDRLDLLLTAR
FT                   QLSQSTRSTILAALDDNPVAASDPEEDKLRRIHIAVLLVMASNDYMVQK"
FT   gene            444868..446157
FT                   /locus_tag="ELI_01995"
FT   CDS_pept        444868..446157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_01995"
FT                   /product="adenylosuccinate synthase"
FT                   /note="COG0104 Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62491"
FT                   /db_xref="GOA:Q2NCV0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCV0"
FT                   /protein_id="ABC62491.1"
FT                   /translation="MANVTVIGAQWGDEGKGKIVDWLADRADAVVRFQGGHNAGHTLVV
FT                   DGTTYKLSLLPSGIVSGTLSIIGNGVVLDPWALKQEVEKLEGQGVTINDDNFAIADNCP
FT                   LILPIHRDLDGLREAAAGTGKIGTTGRGIGPAYEDKVGRRAIRVCDLEHLDSLEPQLDR
FT                   LCAHHDALRAGFEEPPVDRERLLGDLREIAPFVLRFAQPVWKRLKKVRKAGAKILFEGA
FT                   QGVLLDVDHGTYPFVTSSNTVSGTAASGSGLGPGAAGFVLGIVKAYTTRVGSGPFPTEL
FT                   DDEIGQRLGERGHEFGTVTGRQRRVGWFDAVLVRQTCAISGVTGIALTKIDVLDGLDTV
FT                   KICTGYRLNNNVYDYLPSHAASQAAVEPIYEEMEGWSESTAGARSFADLPANAVKYIQR
FT                   IQELIECPVALVSTSPERDDTILMRDPFMD"
FT   gene            complement(446158..447783)
FT                   /locus_tag="ELI_02000"
FT   CDS_pept        complement(446158..447783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02000"
FT                   /product="putative acyl-CoA synthetase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62492"
FT                   /db_xref="GOA:Q2NCU9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU9"
FT                   /protein_id="ABC62492.1"
FT                   /translation="MIWHFADLFEKIASLVPDNVALIEGDAKRTWREYEDRASRLAAAL
FT                   VEHGIEPDAKVAIYGHNSSAFLEAQFAVFKARAVPINVNYRYVDDELVYLFDNADVDAV
FT                   FFDARFAPRLAAIRDKLPKLKLAIQIEDGSGEKLEGAKDLEAVTAGHDPLPRLAYSEDD
FT                   HYMVYTGGTTGMPKGVVYRQGDFVKAIAGFILGPDIEPSKEILLGAVKQLAAAGMSPIA
FT                   FPACPLMHGTGMWLGGFAAHTAGGAVATLRDEKFDPDRTWEYAAKVGANVIVVVGDAFA
FT                   KPLLASLRAAAERGEPYDLSRLQAIVSSGAMFSAETKLGLLEHLDIEIRDAIGSTEGSM
FT                   GSSITSRAAPPSETAKFELGKDTKVFDENDEEVVPGSDAIGMIANGGFTPIAYYKDPEK
FT                   SAKTFREIRGHRYSFAGDFAKVAKDGSLILLGRGSVCINTGGEKVFPEEVEEALKAHDS
FT                   VWDALVVGVPDDRFGERIVAVVSQSEGHTIDQGEVIDFARTRLAGYKMPRQLVVVDEVA
FT                   RAANGKADYAWAKETALAAVGSDA"
FT   gene            447885..448394
FT                   /locus_tag="ELI_02005"
FT   CDS_pept        447885..448394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02005"
FT                   /product="hypothetical protein"
FT                   /note="COG3034 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62493"
FT                   /db_xref="GOA:Q2NCU8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU8"
FT                   /protein_id="ABC62493.1"
FT                   /translation="MIRFRIPALMLGLAFVASCAPTPQPVSVEAPPVDFLLVDKSDRTL
FT                   ALYRDGAEVRRYTGLQFGDAPLGHKRFEGDERTPEGRYTIDTRNPNSAYYLSLRVSYPN
FT                   AQDRAYAEGQGRDPGGDIFLHGQPNWLPAGRMPGDWTDGCIAFTNAEMDELWRLVRDGT
FT                   PIEIRP"
FT   gene            complement(448396..448500)
FT                   /locus_tag="ELI_02010"
FT   CDS_pept        complement(448396..448500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62494"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU7"
FT                   /protein_id="ABC62494.1"
FT                   /translation="MTKKTAFAIAIVVGLMLLKEVKRLQTQVAELGAK"
FT   gene            448616..449596
FT                   /locus_tag="ELI_02015"
FT   CDS_pept        448616..449596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02015"
FT                   /product="hypothetical protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62495"
FT                   /db_xref="GOA:Q2NCU6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU6"
FT                   /protein_id="ABC62495.1"
FT                   /translation="MQAAPFDYAPVNDAAGSPTAVSIFADRPHVRATIADDVAGAGFRI
FT                   MREAGLADVLDGHPVTLGEIVLLDCPAVDAGVLAALSRLDMRVARSGARLVVSTTIEAL
FT                   EDVFACLDQSQARILVAPTRGERVVALGQELTMIARVRVRESSGEDHISLLRLAEQVSE
FT                   IARKLDSLAPSNDDGGGSAFRFETPKPAYSGPEEADSSGRLGRAARPPLPDPRLVRQII
FT                   RQRQMRARFFDGELFADPAWDILLDLTAARAEHERVSVTSLCIASGVPPTTALRWISQM
FT                   TEAGLLERVEDEQDKRRAFIALSDNAADAMARYFAEVGKDAGRLV"
FT   gene            complement(449613..450425)
FT                   /locus_tag="ELI_02020"
FT   CDS_pept        complement(449613..450425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02020"
FT                   /product="siroheme synthase"
FT                   /note="COG1648 Siroheme synthase (precorrin-2
FT                   oxidase/ferrochelatase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62496"
FT                   /db_xref="GOA:Q2NCU5"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU5"
FT                   /protein_id="ABC62496.1"
FT                   /translation="MPSACPNGWPDPAMIGSLPLFHRVRGKRVVVVGEGEMGEAKTRLV
FT                   ERAGGIPCSEAEAHHAHLAFVALEDEREARAVHRRLKAKGLLVNVADMPALCDFTTPSI
FT                   LDREPVLVAVSTSGASAGLAKHLRLRLERLLPQSLGALASKLAASRDAMRDRFPSGDQR
FT                   RRAVDAALSEGGILDPFESAAADRVEAWLDGNAAPDAIRAETIALASNDPEDLTLKQAR
FT                   LLGVADVVLHDAGIDAAILDRSRADALRRELPQDPTEFEGLVVVLTRA"
FT   gene            complement(450394..451656)
FT                   /locus_tag="ELI_02025"
FT   CDS_pept        complement(450394..451656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02025"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="COG0019 Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62497"
FT                   /db_xref="GOA:Q2NCU4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU4"
FT                   /protein_id="ABC62497.1"
FT                   /translation="MDHFSLNSGVLHAEDVPLPQIAEEVGTPVYVYSRATLERHARVFT
FT                   EGLAEVPDKLIAFAVKSNPNLAVLKVLQKAGFGADVVSGGELRRALAAGMAPAKIVFSG
FT                   VGKTRAELMLGLDEGIGQFNIESREEGRELAELAAARGELAPACLRINPDVDAKTHEKI
FT                   STGKAENKFGIPLVHAREVFAELVQLDGLHLRGIAVHIGSQLGDLEPLETAFGKVGKLV
FT                   ADLREAGHLITHVDLGGGLGVPYKAGEEFPSPADYGAMVARVTRDWRVHLTFEPGRVIA
FT                   GNAGILLTRVIRVKRGGNGPPFVIVDAAMNDLARPALYGAWHDFDAVEPSGEHMTANIV
FT                   GPICETGDTFARDRKCDALQSGDLAVFRTAGAYGATMASSYNSRGFVAEVLVDGDQFAV
FT                   VADRIDAGAIMDAERVPEWLA"
FT   gene            complement(451675..451923)
FT                   /locus_tag="ELI_02030"
FT   CDS_pept        complement(451675..451923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU3"
FT                   /protein_id="ABC62498.1"
FT                   /translation="MMRHTRHSIVLLALVALAACGQQADLKPVAGAELPPAPYGSERQL
FT                   TAEELLERDTLAEPERSVELRRRSETREDDPFDLPPE"
FT   gene            complement(451920..453257)
FT                   /locus_tag="ELI_02035"
FT   CDS_pept        complement(451920..453257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02035"
FT                   /product="argininosuccinate lyase"
FT                   /note="COG0165 Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62499"
FT                   /db_xref="GOA:Q2NCU2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU2"
FT                   /protein_id="ABC62499.1"
FT                   /translation="MREINASIPFDKALWRQDIAGSRAHVAMLAKQGIVSAEDAKAIDD
FT                   GLQQVAAEYERDGVPEDWDLEDIHMTVEARLTELIGPVAGRLHTARSRNDQVATDFKLW
FT                   VREATNCALDGIAALQRALVVRAGEHADSVMPGFTHLQTAQPVTLGHHLLAYYEMLRRD
FT                   ASRFGDNLARADECPLGAAALAGTGFDLDRTMTADALGFARPTANSLDTVSDRDFALDY
FT                   LQAASQCALHLSRLAEELILWASQPFGFVRLPDSLSTGSSIMPQKKNPDAAELVRGHAG
FT                   RIVGATTALIVTMKGLPLAYSKDMQDDKPPVFEAAGLLDLCLAAMEGMIAGADFNAERM
FT                   RHAAGLGHATATDLADWLVREADIPFREAHHITGAAVKLADRKECTLEDLSLDDLKGID
FT                   ARLDERVRAVLTLDASVAARASYGGTAPDRVREQVAAARRALGMEE"
FT   gene            453322..453876
FT                   /locus_tag="ELI_02040"
FT   CDS_pept        453322..453876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02040"
FT                   /product="thiol:disulfide interchange protein, putative"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62500"
FT                   /db_xref="GOA:Q2NCU1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU1"
FT                   /protein_id="ABC62500.1"
FT                   /translation="MSLTLAIVLLALAGCDRAAPDPAQGEGALGAEKASLAGEVDRSRA
FT                   GELMPAETVRLPDGTQLNLGALQGQPVLLNLWATWCAPCKKEMPLLDELALERDGELRV
FT                   LTVSQDLQGAEKVLPYFEQAGFQALEPWLDPHNGLGQHYDAGLPMTVLYDANGQEVWRI
FT                   AGDYDWSSAEAAGLIDEGIGT"
FT   gene            453988..454872
FT                   /locus_tag="ELI_02045"
FT   CDS_pept        453988..454872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02045"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62501"
FT                   /db_xref="GOA:Q2NCU0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCU0"
FT                   /protein_id="ABC62501.1"
FT                   /translation="MKRSIQFIMAHLPFGEHLNHIAQKAAGSFSPEAQLWSLVAQAGYL
FT                   RALDERHPLEGATVVEIGPGWQGLGTLLLHLFGAAKIIAFDHQPHFRRRLFDSLVETAE
FT                   ASIEALSNASGIDRAALARRLGDFPDLDYRAPGDAAVTGLPDASIDLVYSYGVLEHIDR
FT                   PDLEAIARETARILKPTGRAAHNIGLHDHFASAGLGNGVNFLRYSKRRWNFWNRNAILN
FT                   HNRMRLPDYFELFADAGLCPVWSQRELRSENLEALRSLRIHSDFRHFGVEDLAASHLYI
FT                   DLSSNGANETNLI"
FT   gene            complement(454977..455049)
FT                   /locus_tag="ELI_t15147"
FT   tRNA            complement(454977..455049)
FT                   /locus_tag="ELI_t15147"
FT                   /product="tRNA-Val"
FT   gene            455135..456112
FT                   /locus_tag="ELI_02050"
FT   CDS_pept        455135..456112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02050"
FT                   /product="probable L-asparaginase"
FT                   /note="COG0252 L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62502"
FT                   /db_xref="GOA:Q2NCT9"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT9"
FT                   /protein_id="ABC62502.1"
FT                   /translation="MTKRLTVLATGGTIAGIAGSAIAKDYTSGQISIEEYLEQVGGLGL
FT                   AAELSGTQIANIDSADIGPEVWGPLHAAIVDALADETCDGVIVTHGTDTLEETAFLLDL
FT                   TLPATKPVVLVGAMRPADAVGYDGLRNFANAVNVAGDDDAAGRGVLVVMGDRVFGARDV
FT                   RKMRTRGTDAFRGFPRESVGLVSPSSLEWFGAPWRHGDKAHFGWYDDLPEVAIIYAHAG
FT                   LTAAQAVRQIGSDIRGVVIAGVGEGNMPETVRQILVAKCAQGLAVVRASRADEGLVDRE
FT                   PEDDANGFVAARALNPQKARILLQLLLAEGVSDPAAIQRAFDGS"
FT   gene            complement(456242..457354)
FT                   /locus_tag="ELI_02055"
FT   CDS_pept        complement(456242..457354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02055"
FT                   /product="putative NADH oxidoreductase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62503"
FT                   /db_xref="GOA:Q2NCT8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT8"
FT                   /protein_id="ABC62503.1"
FT                   /translation="MSTTGKQLFTTLEADGTLTVEIEEVTVPEPKGNQVLVKMEAAPIN
FT                   PSDLAILTGAADLENAEYTAGKYVANMPEPFNSGSKARHGQKLPAGNEGAGTVVATGDS
FT                   DMAKALDGQRVACVPGSAYSQYCLADAAMCLPLGDHSAEDGASAFVNPMTALGFAENAK
FT                   MDGAKAMVHTAAASNLGQMLVKICQEDGLELVNIVRKAEHVDLLKGLGAKYVVNSSDDD
FT                   FMDQLRKAIDATDAFYGFDPIGGGKATDNVFKAMEQVAVSKMTEYSRYGSNQQKRMFIY
FT                   GRLDMGPTILTPSYGFGWTLSGWLLTPFLQQAGMETMMRMRQRVLDNLTTTFASSYKRK
FT                   VNLEEMLTKDAVLDYRAMKTGEKYLVTPWS"
FT   gene            complement(457380..458123)
FT                   /locus_tag="ELI_02060"
FT   CDS_pept        complement(457380..458123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02060"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62504"
FT                   /db_xref="GOA:Q2NCT7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCT7"
FT                   /protein_id="ABC62504.1"
FT                   /translation="MTRFALTLEFDGTPFMGLQRQKHGPSVQQAVEEAARATLNQDITL
FT                   HSAGRTDTGVHALGMRSHFDAETDLTPFRLMGGLNAHLRPHPIAVTNCEIMPEDWHARF
FT                   ACIGRSYVYRIINRRAPLTIDRKRAWQVPQQLDHEAMQRAAQLLVGTHDFTTFRSTQCQ
FT                   AKDPVKSLDRLEVERDGDEIRVHAEARSFLHHQVRSMVGCLKLVGQGTWREEEVEEALL
FT                   ARDRQRLGLNAPPHGLYFVAAEYPR"
FT   gene            complement(458220..459110)
FT                   /locus_tag="ELI_02065"
FT   CDS_pept        complement(458220..459110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02065"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62505"
FT                   /db_xref="GOA:Q2NCT6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT6"
FT                   /protein_id="ABC62505.1"
FT                   /translation="MGTPDFAVPTLRALHAAGHEVVAAYTQPPRPAGRGKKLQPSPVQK
FT                   AAEELGIEVRSPTSLKKADEQEAFAAINADVAVVAAYGLILPQPILDAPKHGCLNVHAS
FT                   ILPRWRGAAPIHRAIMAGDAVTGVTIMQMEAGLDTGPMLATIRTPINDKTTGELTEELA
FT                   ELGANLMVQTLRELDKHVPIAQDNAEATYAPKIDKAEARIDWAKPAEEVVRHIHGLAPF
FT                   PGAWCEIEGERVKLLRAEMAGDEGAAGEVLDDQFTIACGTDAIRPLRLQRAGKPAMDLD
FT                   DFLRGKAVAKGTVLS"
FT   gene            459109..459228
FT                   /locus_tag="ELI_02070"
FT   CDS_pept        459109..459228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62506"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT5"
FT                   /protein_id="ABC62506.1"
FT                   /translation="MKIVRNLPIPFALSLSKGCPYFQRGKKKEQGFDKLSPNG"
FT   gene            459238..459834
FT                   /locus_tag="ELI_02075"
FT   CDS_pept        459238..459834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02075"
FT                   /product="recombinational DNA repair protein"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62507"
FT                   /db_xref="GOA:Q2NCT4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCT4"
FT                   /protein_id="ABC62507.1"
FT                   /translation="MASQEIEQLASTLARLPGLGPRSARRAVLWLVKKRDTALPALLEA
FT                   LEGVQDRLVECDTCGNVDTQNPCGICADPRRDRKSICVVEDVADLWALDRARLFTGRYH
FT                   VLGGKLSALDGVRPEDLNIANLLGRVEEGGIDEVVLAMNATLEGQTTSHYIAERLEEFP
FT                   VRITQLAHGLPVGGELDYLDEGTLAQALRARRPVQ"
FT   gene            459929..460513
FT                   /locus_tag="ELI_02080"
FT   CDS_pept        459929..460513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02080"
FT                   /product="polypeptide deformylase"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62508"
FT                   /db_xref="GOA:Q2NCT3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCT3"
FT                   /protein_id="ABC62508.1"
FT                   /translation="MAIREILEVPDPRLKTVSEPVQPDEFNDDLKQLVDDMFETMYAAP
FT                   GIGLAAIQVGVPKRVLVIDLQEPDMDAEPEECGHDHGDGEGAHKHYPVKNDPRIFINPE
FT                   IIDPNEELSTYQEGCLSVPEIYADVDRPKTCTVKYQDLTGKTHQEDLDGLLATCLQHEM
FT                   DHLEGILFIDHLSRLKKQMALKKLKKMRQAA"
FT   gene            complement(460589..461020)
FT                   /locus_tag="ELI_02085"
FT   CDS_pept        complement(460589..461020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02085"
FT                   /product="hypothetical protein"
FT                   /note="COG1145 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62509"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT2"
FT                   /protein_id="ABC62509.1"
FT                   /translation="MRSLHEGDFIMSIKEMIREHPQVGADWNEALGEAVKHAMYCAAIC
FT                   NSCADACSAEEGDMRACIRKCMDCSDICTATYRVASRRTAGNVGIIEAMLRTCIAACEA
FT                   CIDECEKHDNDHCRRCARMCRECADDCLKALNGMEQRGE"
FT   gene            461019..462476
FT                   /locus_tag="ELI_02090"
FT   CDS_pept        461019..462476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02090"
FT                   /product="DNA recombination protein"
FT                   /note="COG1322 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62510"
FT                   /db_xref="GOA:Q2NCT1"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT1"
FT                   /protein_id="ABC62510.1"
FT                   /translation="MDRWNGSGGRLGLHVRSDYVPPMDPALLIILTLVLGLAIGGGIGW
FT                   YVGSRPVADLRARFDERDAEAKKYADDVARMAPELATMSDRARRADALAETLDHTREEL
FT                   TALKAQAAGFAEQKRLLEESREKLLKEFENTGAQVLGKAQEAFLARANERFGHSEKASA
FT                   EKLAALLKPVDERLKKYEEQVETLENQRKDAFGQLHGLIENMQRGQEEVRREAQRLGNS
FT                   LTNAPKARGRWGERALQNVLEQCGLAEHTDFHLEQSMDTESGRLRPDAIVNVPGQKKLV
FT                   IDAKVSLNAYQEAFEADDDDARKRHLDLHAKSMRNHVQTLGSKGYQNQFEEAPDYVVMF
FT                   VPGEHFVAAALEHDPELWDFAFHNKVLLATPTNLVAIARTVAQVWRQDKMAAEAQEIGR
FT                   MGAELYDRLRVAGEHMKRVGGGLETAVANYNKFVGSFERNVLTSGRRMAEKGLEIGKEI
FT                   EEVPLVEGAPRYTDDDLLTDGSEEAAE"
FT   gene            462681..462953
FT                   /locus_tag="ELI_02095"
FT   CDS_pept        462681..462953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62511"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCT0"
FT                   /protein_id="ABC62511.1"
FT                   /translation="MRAFVQSLSLASLEAGMADYSLRCSGSQDIGAEEIHFSALSFDGA
FT                   LNLAKKHLNGRQAVLLEDGRPICSMQMVSETGAWLIGRPPLDNGS"
FT   gene            complement(463129..463863)
FT                   /locus_tag="ELI_02100"
FT   CDS_pept        complement(463129..463863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02100"
FT                   /product="transcriptional regulatory protein"
FT                   /note="COG0664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62512"
FT                   /db_xref="GOA:Q2NCS9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS9"
FT                   /protein_id="ABC62512.1"
FT                   /translation="MQDLLAKYGRVTQLLPEDRKVFSSLATETREYARGTRLSTDEFEA
FT                   PDRLWIVERGRLFASQDLPSGARAITRLYFSGDIVGTANIPFHKSTQTITVNSEAVLYH
FT                   FSRRKLVDAFVNMPRVAAIFYTFAALENAILNDRLVSIGRTRGRARLASLLLEISSRHN
FT                   LTFLEPPDRFDLGLTQAQIGDAIGLTDVQVNRLMRSFDRAGLIHRDNGRVQLLDPGKLA
FT                   EMGQFRDRYDDLDLEWFEEDHK"
FT   gene            complement(463936..464748)
FT                   /locus_tag="ELI_02105"
FT   CDS_pept        complement(463936..464748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02105"
FT                   /product="rRNA methylase"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62513"
FT                   /db_xref="GOA:Q2NCS8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS8"
FT                   /protein_id="ABC62513.1"
FT                   /translation="MTRRQITGFSNPTVKYLRSLREKKHRKRERKFLAEGLRLLTDARE
FT                   CDRVPEMLVMAERRDPHPLLTALEEAVTGAGGEVIETSDEILAKITGKSNPQAVAGVFA
FT                   EWNTSLSALDRQSAPIWLVAQALRDPGNLGTMLRTGDAVGAGGLILLDDCVDPFSVEAV
FT                   RASMGAVFTQQIAQARWDDFLLWLRSGDGQLVAASLRDAVPYRGAAYAAPCFILVGNES
FT                   QGLPENYETACDLRVTMPMRGRADSLNAAVAGAVLAYEVLDTFENPAS"
FT   gene            complement(464753..465031)
FT                   /locus_tag="ELI_02110"
FT   CDS_pept        complement(464753..465031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02110"
FT                   /product="PTS system phosphocarrier protein HPr"
FT                   /note="COG1925 Phosphotransferase system, HPr-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62514"
FT                   /db_xref="GOA:Q2NCS7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS7"
FT                   /protein_id="ABC62514.1"
FT                   /translation="MSEVRREVVIVNQRGLHARASAKFVGAVAELPDNVQVKVAKGGNE
FT                   AVGGSILGLMMLGAAKGDTIEIIVAGDGRDQVLEELCTLVEDGFGEE"
FT   gene            complement(465028..465456)
FT                   /locus_tag="ELI_02115"
FT   CDS_pept        complement(465028..465456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02115"
FT                   /product="PTS system mannose/fructose-specific component
FT                   IIA"
FT                   /note="COG2893 Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62515"
FT                   /db_xref="GOA:Q2NCS6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS6"
FT                   /protein_id="ABC62515.1"
FT                   /translation="MIGLILVTHGQLAEQFVAAMEHVVGHQGAVATVCIGPSDDAEQRR
FT                   AEIATAIDDVDSGNGVIILTDLFGGTPSNLAISLLETGRIEVIAGINLPMLIRLAGARK
FT                   TMDVVDAVAAAREAGRNYITVASEFLGQNEAPPAKKAS"
FT   gene            complement(465514..466383)
FT                   /locus_tag="ELI_02120"
FT   CDS_pept        complement(465514..466383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02120"
FT                   /product="predicted P-loop-containing kinase"
FT                   /note="COG1660 Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62516"
FT                   /db_xref="GOA:Q2NCS5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCS5"
FT                   /protein_id="ABC62516.1"
FT                   /translation="MSGAGKSTSLRVLEDLGWETLDNFPIRLLEPMIGEVLSSDNPAPL
FT                   AVGFDSRTRGFVPNEIIELCKRLVQRDDLTLTTLFLDCTSEELERRFNETRRHHPMARG
FT                   RTALEGIRAEREVMEPLRRWAEAVIDTSELAANELQQLIREQFHHDDPASQSVTVSSFG
FT                   FARGMPPLADLVFDMRFLDNPHWVANLREQTGLDPAVGEYITARGDFDEIFQRMRDLIL
FT                   ALLPRYRAQGKAYVHVAFGCTGGRHRSVFTAETMAQALREAGFSPTVVHRNLASRAADQ
FT                   FEGPQGRN"
FT   gene            complement(466497..466916)
FT                   /locus_tag="ELI_02125"
FT   CDS_pept        complement(466497..466916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02125"
FT                   /product="hypothetical protein"
FT                   /note="COG1493 Serine kinase of the HPr protein, regulates
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62517"
FT                   /db_xref="GOA:Q2NCS4"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS4"
FT                   /protein_id="ABC62517.1"
FT                   /translation="MLYQASCVAIGGRAVLIEGPPGAGKTSLALALIDRGASLVGDDGV
FT                   RLERRGTRLFATPPPNIAGRIEIRNVGIVHLPCVEAPVALLLRLDPDAPRYIEGAESET
FT                   LGSVPIPRIAFASAHAADAIRAEYALRLHGIDVAG"
FT   gene            complement(466916..468505)
FT                   /locus_tag="ELI_02130"
FT   CDS_pept        complement(466916..468505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02130"
FT                   /product="two-component signal transduction histidine
FT                   kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62518"
FT                   /db_xref="GOA:Q2NCS3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS3"
FT                   /protein_id="ABC62518.1"
FT                   /translation="MAERRFATDIVRPLERMSVLDRISLTARILLVNILPLAVLGGGIF
FT                   YLDSYRAQLLDERYKLARIEAQITAEALAGATRERQEALLVQIGKEQRMRLRMFDAEGQ
FT                   LWADSFALDEPGFAFDDISDDTWEQRFARWIDRAIDTIVSAEPVTDYIEPESQRADAWP
FT                   EVVRAREQGLSQITLYDWVDGTPVITAAAPVGLNGATLLTTRNAVDITEAVRSARTSLL
FT                   IGVGFALLASTLLSLFLARTIVKPLQILSQSAQRVRLGRERDVEVPRLPHRRDEIGMLA
FT                   RAISDMTDALRQRIDAVEHFAADVAHEIKNPLASLRSATESLSKVEDPELRSQLLDIAT
FT                   HDVRRIDRLVTEISDASRVDAEISRATFERVDMAALVGNILASRESRALNAGRTINFDP
FT                   PARAARVMGVPVRLERVIDNLLDNAVSFSPEDGTIQIGMSVQDGCVSLSICDHGPGIPE
FT                   AERGKIFDRFHSVRPEAEDFGNHSGLGLAIARTIAEAHGGSLLADDRPDGQQGACLTLS
FT                   LPEARTSSTGAP"
FT   gene            complement(468498..469253)
FT                   /locus_tag="ELI_02135"
FT   CDS_pept        complement(468498..469253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02135"
FT                   /product="two-component response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62519"
FT                   /db_xref="GOA:Q2NCS2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS2"
FT                   /protein_id="ABC62519.1"
FT                   /translation="MAEQAEASVDTATKRRIIALVDDDRNILTTVSIALQSEGYDTRVY
FT                   SEGDTALKALLENPPDLGVFDIKMPRMDGMELLRRLREHSELPVIFLTSKDDERDEEAG
FT                   LEMGADDYISKPFSLRLLLARIRAILRRSGLEEGESVGTAPGESEVGETYARGRLTVDP
FT                   ARHQVTWDGKPVSLTVTEFLILEALAARPGVIKSRNQLMDAAYPDEVYVDDRTVDSHIK
FT                   RMRRKFRSVDREFGAIETLYGAGYSFSDG"
FT   gene            469487..471103
FT                   /locus_tag="ELI_02140"
FT   CDS_pept        469487..471103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02140"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /note="COG1866 Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62520"
FT                   /db_xref="GOA:Q2NCS1"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS1"
FT                   /protein_id="ABC62520.1"
FT                   /translation="MTALSTSLADQGISTNATIHPNLGTAQLVEHAIDNGEGRLSKYGS
FT                   LVVETGKHTGRSAKDKFIVRDSETEDTVWWDNNASIDPEHFAALKEDFLKAVAEKDTLY
FT                   VADLFGGSQPEHRVKVRVINEFAWHNLFIRTLLCRPMASELDGFAPEYTIIDLPSFQAD
FT                   PERHGTRSETVIAVNLSEKLILIGGTKYAGEMKKSVFGILNYLLPAKGVMPMHCSANIG
FT                   PDGKTAVFFGLSGTGKTTLSADASRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSEEAE
FT                   PEIYATTRMFGTVLENVVMDEETRELDFDDNTLAENTRGAYPIDYIPNTSEENLGPVPS
FT                   NVVMLTADAFGVLPPIARLTPDQAMYHFLSGYTAKVAGTEIGVTEPEATFSTCFGAPFM
FT                   PRHPSVYGNLLKERIAKGGVQCWLLNTGWTGGKYGVGNRMPIKATRALLNAALDGKMDD
FT                   VEFRKDPNFGFDVPVSVPALAEAGIDQTILDPRSTWADKEEYDATAQKLVQLFVDNFEP
FT                   FAAHVDEGVRQAAPSSEPQAA"
FT   gene            471298..471516
FT                   /locus_tag="ELI_02145"
FT   CDS_pept        471298..471516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62521"
FT                   /db_xref="GOA:Q2NCS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCS0"
FT                   /protein_id="ABC62521.1"
FT                   /translation="MKIKNAFLSLGAVALAASPVVAQTLPTSAPIEGESEVGGSGAGIA
FT                   IGFGLALLVATFFISESMDNDDDPVSP"
FT   gene            471640..471999
FT                   /locus_tag="ELI_02150"
FT   CDS_pept        471640..471999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02150"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62522"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR9"
FT                   /protein_id="ABC62522.1"
FT                   /translation="MGLFNSILGQASDYADVANMAEKLGIDPEVAEKAIAALGQSHGEP
FT                   GDTVEGAAAKTGLDTGVLSRIVDQIGGEGSLGQYADELKKNPQAAGILDMLDRDGDGNP
FT                   LNDVLGMAKGLFGKK"
FT   gene            complement(472021..473646)
FT                   /locus_tag="ELI_02155"
FT   CDS_pept        complement(472021..473646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02155"
FT                   /product="putative thioredoxin reductase"
FT                   /note="COG0664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62523"
FT                   /db_xref="GOA:Q2NCR8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR8"
FT                   /protein_id="ABC62523.1"
FT                   /translation="MENFGDELETMKRVPLADDHVAAIRKISVERSYEPGEMVSEVGEP
FT                   MDTFIYCLEGEIEVVDPYTRERLMDASVGPTQFVGEIGFLNRGTWFLPMRAAKPTKTIE
FT                   APREAMLDLMSRVPELSDHIITVFAARRRKQFELKSSSIKVIGADRDPAVQRVERFLAR
FT                   NRIPFQSYDLDGSDKETVEVCTLTDHSPSVIVDKDEVLEDPTPRKVAQHLNLDLDICSQ
FT                   RVFDVLIVGGGPAGVAAAVYTGAEGLCALVVEDTAIGGQAGTSSRIENYMGFPTGISGT
FT                   DLVYRGQIQALKFGTRFAMPRRVEHLERRDDGLFCATLDDGDEVCAKVVLVSTGVQYRR
FT                   LPLERLEEFEGAGVFYAATDMEARFCNNTEAVVIGGGNSAGQAAMYLSRTAGHVHLVVR
FT                   GDSLAESMSSYLTQRLEADERVTIHYNTQVTALHGEGHLKAVSFESGGKERRIDTRALF
FT                   IMIGAAPNTGWLSNLVETDDKGFVCTGSSVGKRSPFETSCDGIYAVGDVRADSVKRVAS
FT                   AVGEGSVVVSELWSYIDAQEREVA"
FT   gene            complement(473768..474148)
FT                   /locus_tag="ELI_02160"
FT   CDS_pept        complement(473768..474148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62524"
FT                   /db_xref="InterPro:IPR022016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR7"
FT                   /protein_id="ABC62524.1"
FT                   /translation="MGIFSSIKNAIFGDDEDEKKAPPPQPRPVPTPAASPTPQAKAMNA
FT                   IDVVARLSAKPGADRLNWKTSIVDLFKLLDLDPSYENRKELAQELGRTDYSGSAEDNIW
FT                   LHRATMAEIAKNGGKVPPEMLN"
FT   gene            474258..474764
FT                   /locus_tag="ELI_02165"
FT   CDS_pept        474258..474764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62525"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR6"
FT                   /protein_id="ABC62525.1"
FT                   /translation="MNLGRMLNESGAIASMAQELGVDEGVARTAAGALLPAIVAGMGRS
FT                   ATGGGGGDALGGLGGLAGAILGGGGGGLLESVLAPKPTPTRQGNDILGTIFGSKDVSRS
FT                   VAGEVAGITGLDEGLLKKMLPLLAMAVAGYLAKGGSQAVGSGVGGGGSPLGGILGAIVG
FT                   GLSGR"
FT   gene            complement(474765..476633)
FT                   /locus_tag="ELI_02170"
FT   CDS_pept        complement(474765..476633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02170"
FT                   /product="hypothetical protein"
FT                   /note="COG4805 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62526"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR5"
FT                   /protein_id="ABC62526.1"
FT                   /translation="MSETQFQITRRQMLAGTGASAAALTLPGCAAAGQAVTESANAATG
FT                   AGGQAAAEALLEQVAWNLLELQPERATGLGVDTGEYAYLRGQLEDTSPAGKAKLRDQLF
FT                   IDRQRVRSFPREGLDIDTVTNLDVVESGYDVALAGLDLPYGDIPVGSWRTAPYVVIQNA
FT                   GAYLDLPRFMDATHPLRDAADVEAYLSRLSQVPSVLEGERIRIANARLQSVVPPDFLLA
FT                   KATGQMRTTLLDAQEGGALLEPLLKSELPAATTASRQAKDIITSRIAPALEAQLAELFA
FT                   QQKVATGAPGISTRPGGEEWYQWALRSSTTTNLTADEIHRQGLEELRLLHDRMDPILRE
FT                   IGYTSGTVGERMQALGADPRYKFSEGDEGREEIFAFIDERIDWIRAQMPRAFNTLVDPN
FT                   LEVRRIPPAEEVGAPGAYGGAGSKDGTIPGRFWINLRTTDLHRKYDLADLTYHETIPGH
FT                   VWEGEYSNRLPLIRSILAFNPFSEGWALYGEQLADELGAYDDFKVGRLGYLQSLAFRAC
FT                   RMVVDTGLHSKGWSRERAVNFFVERNGSKAQEVASEVDRYCSWPGQATGYKLGHSRIVD
FT                   LRDRTQRELGKAYDLKAFNDAVILGGNAPMDVLAKNVERYIASARG"
FT   gene            476698..476901
FT                   /locus_tag="ELI_02175"
FT   CDS_pept        476698..476901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62527"
FT                   /db_xref="GOA:Q2NCR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR4"
FT                   /protein_id="ABC62527.1"
FT                   /translation="MTDVVLSVLMLAAFALLLGAFALWRKGVRKQAGLMVVLAIIAVGN
FT                   VLIWTVPDADGTAPTDRLEQAD"
FT   gene            complement(476920..477597)
FT                   /locus_tag="ELI_02180"
FT   CDS_pept        complement(476920..477597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02180"
FT                   /product="hypothetical protein"
FT                   /note="COG0810 Periplasmic protein TonB, links inner and
FT                   outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62528"
FT                   /db_xref="GOA:Q2NCR3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR3"
FT                   /protein_id="ABC62528.1"
FT                   /translation="MAYTDTRNTSARAPAVIGVAIIHAAIGVVLVTGLASTISETFTPP
FT                   PLIGGQIELPPPPPPEPTPEPRVEPEPNAAPPVYTPAPPFQLDPQPPVLDTTDLLPPPT
FT                   PLPIPKAIPGPSPRPSVTPSPSKLFDPVAPKPRNGDWVTDNDYRSSWINRGWEGTAGFR
FT                   LEIGKSGRVENCTITRSTGHGALDDATCALVKRRARFEAARNDQGDVVSGRFSSAVRWQ
FT                   IPE"
FT   gene            complement(477773..478429)
FT                   /locus_tag="ELI_02185"
FT   CDS_pept        complement(477773..478429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02185"
FT                   /product="predicted hydrolase"
FT                   /note="COG2945 Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62529"
FT                   /db_xref="GOA:Q2NCR2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR2"
FT                   /protein_id="ABC62529.1"
FT                   /translation="MPTVIFPGPEGRLEGRFSPPPRPRAPVAMILHPHPQGGGTMNEQI
FT                   TQKLYKTFVDRGFATLRFNFRGVGRSQGSFDNGIGELSDAAAALDWVQSIHEEAQVTWV
FT                   AGVSFGALIGMQLLMRRPEIRGWISIGAPASMYDFSFLAPCPASGIFIHGAQDTVVQPS
FT                   SVTKLVEKLRTQKHITVHHEEIPRANHFFQNEQDELMASVDNYLDFRLDPACPIT"
FT   gene            478606..479529
FT                   /locus_tag="ELI_02190"
FT   CDS_pept        478606..479529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02190"
FT                   /product="cysteine desulfurase"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62530"
FT                   /db_xref="GOA:Q2NCR1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR1"
FT                   /protein_id="ABC62530.1"
FT                   /translation="MEEGFRIWANPSSPHAEGRKAKAALEDARERVKRALGWDGEVIFT
FT                   SGASEALALGLQRCKAKRRIVSAVEHDAVFRAAPDAQVYSDDITIGADDILAIQHVNSE
FT                   TGVVNPVGQMIETIRPTGALVLSDCSQSAGKRDLPNADMLVISAHKFGGPIGIGALLVR
FT                   DFALLEPMGGHERGYRQGTENVAGAIGMAAALEAGPWNTSSKERKNFALSLGNPVLSFG
FT                   EQADYIFALAHPTMSAQALLIRLDAMGFAVSAGSACSSGTLKKSRVLDAFGVDDDTASR
FT                   TIRVSIGWNTTSEELERFAEAWRSLA"
FT   gene            479546..479653
FT                   /locus_tag="ELI_02195"
FT   CDS_pept        479546..479653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62531"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCR0"
FT                   /protein_id="ABC62531.1"
FT                   /translation="MSEAKLTRSVDGCTFLLFRVRQKEEQGFDKLSPNG"
FT   gene            479667..480743
FT                   /locus_tag="ELI_02200"
FT   CDS_pept        479667..480743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02200"
FT                   /product="aminotransferase NifS, class V"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62532"
FT                   /db_xref="GOA:Q2NCQ9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ9"
FT                   /protein_id="ABC62532.1"
FT                   /translation="MIYLDYQATSPLAPEARDEMLRWLDGPDGTGFGNPHSPHRMGRQA
FT                   AAAIELARDRVAALFPAGGRVIFTGGATEAVNLAIRGTAHLGGSVSVSAIEHAAVLDTA
FT                   RDLGQAHVLNVARDGQCNTKQDLPNDCRLVCLMQVNNEIGVIQPTVDWHRKAKGNNALY
FT                   LCDAVQAYGKMEVTGADMIAISAHKFHGPKGVGALWVRDGVDLHEVQTGGGQEFGLRSG
FT                   TLSPALIAGMGAAAAEASDRMERDADHVGNLWHRAREIFADWDLNGSAEARYFGNLNIR
FT                   RKGLDVNRLMSECRDVMFSAGSACASGSGRTSHVLEAIGLSKKQAKSSIRLGFGRYTTM
FT                   DEIEQAATTINQAAEAQL"
FT   gene            480740..481069
FT                   /locus_tag="ELI_02205"
FT   CDS_pept        480740..481069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02205"
FT                   /product="Ferredoxin, 2Fe-2S"
FT                   /note="COG0633 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62533"
FT                   /db_xref="GOA:Q2NCQ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ8"
FT                   /protein_id="ABC62533.1"
FT                   /translation="MKIVFETAEGAAVEAEAAPGDTLLAIAQGAGLPLEGTCEGQMACS
FT                   TCHVIVAKEWFAQLPEASEEEEDMLDLAYGVSATSRLSCQIELTEKMDGLTVRIPSDSR
FT                   DMSGV"
FT   gene            complement(481066..481812)
FT                   /locus_tag="ELI_02210"
FT   CDS_pept        complement(481066..481812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02210"
FT                   /product="two-component signal transduction histidine
FT                   kinase"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62534"
FT                   /db_xref="GOA:Q2NCQ7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ7"
FT                   /protein_id="ABC62534.1"
FT                   /translation="MQDITGVEKLTEREKVCLREWLQHKSAKEIAIDLGITHHAVEKRL
FT                   KMARLKLNVGSSLEAARILAAYEDYGRTTSHSPDLSPNPAQRPSLVSRLIAWRAIAVGC
FT                   LAAALLILAFTSEDPAGLGTEANRIEKVYDEQLTAHLDALIAAAEIGPDGEIFLTRPMG
FT                   DSRFIEPGSGFYWQISADDREDFTSRSLRSRTLDVLPNGGKHEAVISDSSQFADEKLRM
FT                   IQRTVRMPGSNADWTFIVARHIDEPD"
FT   gene            complement(481990..482880)
FT                   /locus_tag="ELI_02215"
FT   CDS_pept        complement(481990..482880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02215"
FT                   /product="hypothetical protein"
FT                   /note="COG1196 Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62535"
FT                   /db_xref="GOA:Q2NCQ6"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ6"
FT                   /protein_id="ABC62535.1"
FT                   /translation="MRKFVITGAAVSLLALTACSEQVDYEEATVDAADYVEAEAAADAM
FT                   EAASEEAAAGSAIPSLAELPVSLPKLAYLYDYRWRMPADEIGPLQRRHANLCEQQGPAS
FT                   CQILGMSKSGEEADEVYGELQMAVASRQARAFGALLEDEAEDAGAEQVSAEIGSQELSK
FT                   QMVDTEARIAARTELRDRLMAVLKTRRGTVEELVEAERSVARVNEEIDQARSWLKEMEG
FT                   RVAYSRVTVRYETGVPVTNDFLAPVAGAVGSLGTVLGYLVAFLILAGAVALPIGGLVWA
FT                   GRSINRRFERAAVEG"
FT   gene            complement(483042..483581)
FT                   /locus_tag="ELI_02220"
FT   CDS_pept        complement(483042..483581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02220"
FT                   /product="protease"
FT                   /note="COG0693 Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62536"
FT                   /db_xref="GOA:Q2NCQ5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ5"
FT                   /protein_id="ABC62536.1"
FT                   /translation="MKRVLIIATDGFEQSELMKPKKRLEEAGIDTTVASLEEGEITGWK
FT                   DKNWGDSVKVDLTVEEVSADDYGALLLPGGQINPDALRMNDTVIGLIREFNEANKPIAA
FT                   ICHAPWLLAEANIIRDRTVTGWPSIRTDLSNAGANVIDSEAAVDGNLITARNPDDIPAF
FT                   SNALIEQVQQRVPENA"
FT   gene            483792..484670
FT                   /locus_tag="ELI_02225"
FT   CDS_pept        483792..484670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62537"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ4"
FT                   /protein_id="ABC62537.1"
FT                   /translation="MALVASAQAQDAAEETPPPAFPETEIFLFDYDASAEGDALSNGRN
FT                   VTQRPGYDNQPYFTPGSATFLYARDDGTQTDIWEYDIASGTHRQITRTPESEFSPTPSP
FT                   DDKTISMVFERNNSIWQIERSAPDAPTWALEAAGVPEPVGYFARNYASGDILYWSRYGF
FT                   NVALTSAEKPAYHFISGHAVPATPHVIPGSAEISFVHRQTNEQVWIKAFDPETRAIRPL
FT                   TPLVGTNANYTWTPDGAILQIEDGKVHRWREDGAGWAEVGDLSEPGITSANRIAVSPDG
FT                   KRIAVVGLPGK"
FT   gene            485036..485158
FT                   /locus_tag="ELI_02230"
FT   CDS_pept        485036..485158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ3"
FT                   /protein_id="ABC62538.1"
FT                   /translation="MLLFAYNLKISREAIWQKICVGTYICISPLFSKGFIASVD"
FT   gene            485671..487980
FT                   /locus_tag="ELI_02235"
FT   CDS_pept        485671..487980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02235"
FT                   /product="DNA topoisomeraseIV subunitA"
FT                   /note="COG0188 Type IIA topoisomerase(DNA gyrase/topo II,
FT                   topoisomeraseIV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62539"
FT                   /db_xref="GOA:Q2NCQ2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ2"
FT                   /protein_id="ABC62539.1"
FT                   /translation="MSDPTEITEPDPFDAIVDAPFDSALEERYLVYALSTITARSLPDL
FT                   RDGLKPVHRRLLWTMRQLKLDPTNTFKKSARVVGEVIGKYHPHGDTAAYDAMVRLAQDF
FT                   ALRYPLVEGQGNFGNIDGDNAAAYRYTEARLTRTAMALMAGLDEGTVDFIPTYNGEEEE
FT                   PELMPGLFPNLLANGASGIAVGMATNIPSHNVHEIIDATLELIDNPHVEHARLMELFQG
FT                   PDLPTGGLIVDSPEVISNAYETGRGSFRIRGRFHAAEAEKQADQGAGIERLGGGQWQLV
FT                   ISEIPYQVQKGKLIEQIAQAIADKKLPILDDVRDESDEQIRIVLVPRSRNIDPELLKES
FT                   IYKLTDMETRFGLNLNVLDATRTPMVMGLKELLENWVRSQIEILQRRTQHRLDQIARRL
FT                   ELVEGYIIAFLNLDRVIEIIRYEDEPKQVMMAEFSLTDRQAEAILNMRLRSLRKLEEME
FT                   LKQEKTDLLAEQEELEKLLGSPARQRTRLKRDLKALQKEYGLDTELGARRTTIAEAEPT
FT                   VEFSMDAMIEKEPVTVVLSQKGWVRAAKGHVDLEGSKDGCGDFKYKEGDGPAFAVHCQT
FT                   TDKVLLAADNGRFFTLGADKLPGARGFGEPVRNTLDIDAEAQIVAMLVSNPRGRLLLAA
FT                   DTGKGFAAEMGELVAETRKGKQVVNLKGDAKLRVVRPIADCDDHVAVVGENRKLVVFNL
FT                   EELPVLARGQGVQLQRYRDGGLSDAKTFVLDQGLSWQMGGKGDRTRTETDIWQWKVARG
FT                   GAGRLPPQGFPRDNRF"
FT   gene            complement(488318..488866)
FT                   /locus_tag="ELI_02240"
FT   CDS_pept        complement(488318..488866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62540"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ1"
FT                   /protein_id="ABC62540.1"
FT                   /translation="MSEHEDKRSFAMKFTKIVGAAAALAFATAAQAAPAVGDTVYGPEG
FT                   NEVGTITTADATTVVIATGEHDAPVPANVLAEGPDGPVISVTKAQLNEIMAAQKAEAAA
FT                   KRDAALVEGAMVHSADDVMLGTVASIEGDNVVVDLTEGSVALLREHFTLPANGILTARF
FT                   TAEQVAETVAAAQEAATAG"
FT   gene            complement(489058..490245)
FT                   /locus_tag="ELI_02245"
FT   CDS_pept        complement(489058..490245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02245"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62541"
FT                   /db_xref="GOA:Q2NCQ0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCQ0"
FT                   /protein_id="ABC62541.1"
FT                   /translation="MQQILPSAPWTQRDDLASLVGVLGADNLRWVGGAVRDTLLGDAVK
FT                   DVDAATPLLPEDVMERLAAADIRTVPTGIDHGTVTAILPGGPVEITTLRKDVSTDGRRA
FT                   TVAFAGEWRDDAARRDFTINALYADPKTLAISDFFGGLEDLEARRVRFIGDARERIRED
FT                   HLRILRYFRFQARFGAELDEEAEEACAELAETLKGLSRERVAMELLSLLALPDPAPTIA
FT                   RMRERGVLPVILSEAGKAEVARLQALIASEARYSIAPDPLRRLAALLPPVATLAESVAA
FT                   RLRLSRAQRDRLVSLARRQPEDETRARPLAYEEGLDNARDRLLLAGADPAPLQDWHVPQ
FT                   FPLKGGAIVARGVGAGPEVARILQGIEARWVEEGFPPEARVAELLDEALNARDLP"
FT   gene            complement(490362..490961)
FT                   /locus_tag="ELI_02250"
FT   CDS_pept        complement(490362..490961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02250"
FT                   /product="NUDIX hydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62542"
FT                   /db_xref="GOA:Q2NCP9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP9"
FT                   /protein_id="ABC62542.1"
FT                   /translation="MSTFFERLQRVFDDGHGYPHPDLITDERFAEGRPKPAAVLIPVVE
FT                   RAEPGVILTQRPTGLRSHPGQVAFPGGKIDEGETPLEAALREAEEELAMPREKVRVIGA
FT                   TDNYITGTGFDVTPVLGVVPPDLPLVPNPGEVESWFEVPLATLFDRSNYTANTVLWRGA
FT                   ERTYYEMHYEGYRIWGVTAAIIANLAHRLELTELFD"
FT   gene            complement(490958..491506)
FT                   /locus_tag="ELI_02255"
FT   CDS_pept        complement(490958..491506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02255"
FT                   /product="hypothetical protein"
FT                   /note="COG3816 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62543"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP8"
FT                   /protein_id="ABC62543.1"
FT                   /translation="MPYQPPPELADLTLDQIAEQVAARKLPPVEHWAPERTGDSRMRIA
FT                   ADGTWYHDGSPITRPAMVRAFSGLLVRDEDGSHHLLSPFEKLAIQVEDAAFVATDMVER
FT                   DGALAFRLNTDELIVAGPDHPLVARGDAETPAIYLNVRGGLEARLNRSTYEQLAEHALA
FT                   LGDDWTVTSQGETFSLLPA"
FT   gene            complement(491558..492079)
FT                   /locus_tag="ELI_02260"
FT   CDS_pept        complement(491558..492079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02260"
FT                   /product="putative acetyltransferase"
FT                   /note="COG3153 Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62544"
FT                   /db_xref="GOA:Q2NCP7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP7"
FT                   /protein_id="ABC62544.1"
FT                   /translation="MATIIPLSAVEPALVEQLLDEAFGEDRMARTAYRVREGSPWLEAL
FT                   SFAALDDGDFLAGSIQLWPVALATPDVKGHPLIMVGPVAVLPALQGEGYGKALMGAALG
FT                   AVEAMAADGTSALPQVMIGDAEYYGQWGFSADHTGNWHCPGPYDPARLLLRCDNPGILP
FT                   DEGMLGPWAG"
FT   gene            complement(492140..493324)
FT                   /locus_tag="ELI_02265"
FT   CDS_pept        complement(492140..493324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02265"
FT                   /product="dehydrogenase"
FT                   /note="COG2133 Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62545"
FT                   /db_xref="GOA:Q2NCP6"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP6"
FT                   /protein_id="ABC62545.1"
FT                   /translation="MIQTRFTSLALLSLPAIALASCGSAYSGDSAEAQSTPSPTAMEAD
FT                   AQIGPFAVSDMGTFAEPWAAAFAPGTHTLFITEKAGTMKFVDTRTGRLGTVTGVPEVDY
FT                   GGQGGLGDIAFLPSEAANTIDSRTIYLSWAEAGAGDTRGAVVGRGQLACQQADACTIED
FT                   LAVIWRQAPKVTGRGHYSHRIAFSPDERYMYVASGDRQKQDPAQDTSNTLGTIVRLNLD
FT                   GSPAANNPVGSEIWSYGHRNILGLAFDDAGRLWDLEHGPAGGDELNLVERGVNYGWPVV
FT                   SNGDNYNGTPIPDNDTRPDLRAPVFGWTPVIAPGDMIFYSGSMFGDWSGDLLIAGLKTQ
FT                   AIIHLDMEGTSAEEIARYDFGERLREIVQGPDGAIYVLEDGDDGRLRKLTPSAS"
FT   gene            493323..493961
FT                   /locus_tag="ELI_02270"
FT   CDS_pept        493323..493961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02270"
FT                   /product="ribonuclease HII"
FT                   /note="COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62546"
FT                   /db_xref="GOA:Q2NCP5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCP5"
FT                   /protein_id="ABC62546.1"
FT                   /translation="MVSETPEDAIVSRPEAQGCVFGVDEAGRGPLAGPVVAAAVVLGDA
FT                   YPKGLDDSKKLTAKRRAVLDEDIRKTCGWGVGVVDVEEIDTLNILGATMRAMSLAVQGL
FT                   AAKLGGDPDMVLIDGNLTPHGRCDLWQWEAQAIIGGDGIEPAISAASIVAKEWRDRIMT
FT                   EAAQDYPEYGWLSNKGYGTAQHLEALRLHGPTPLHRRSFAPVAQQELFR"
FT   gene            493958..494887
FT                   /locus_tag="ELI_02275"
FT   CDS_pept        493958..494887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02275"
FT                   /product="putative oxidoreductase protein"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62547"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP4"
FT                   /protein_id="ABC62547.1"
FT                   /translation="MSAFAYSDIPDQSGKTAIVTGANTGLGYCIAEALARSKAKVLLAC
FT                   RSEDKAREAMDRIAEAVLGADTEFLELDLQDMDSIRGAAKAAQSQARLDILVNNAGIMV
FT                   PPLKLAMGVESQFATNHLGHFALTGLLLDKLAQNGGARIVNQSSIAHRGAKIGFDNLDG
FT                   AKGYSRQRFYGQSKLANLLFTFELDRRLRAAQSPVSAYAAHPGIAETELMRHLGPLALM
FT                   GKVVGVFLNSAKDGALPALQAATWPDAEPGGYYGPYGLGEISGPRSGRAIASRTARDPL
FT                   LAARLWEISVELTGVDPGLPADDVEQDI"
FT   gene            complement(494911..495810)
FT                   /locus_tag="ELI_02280"
FT   CDS_pept        complement(494911..495810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02280"
FT                   /product="hydrogen peroxide-inducible genes activator
FT                   protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62548"
FT                   /db_xref="GOA:Q2NCP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP3"
FT                   /protein_id="ABC62548.1"
FT                   /translation="MPTLRQLEYLVALDELAHFGRAAARCHVSQPTLSQQLKQLEERLG
FT                   VTLVERGTPPAMTPTGRELARRARQVLTEVEEIRRLAEQSRCGMAGTIRFGVTPTLGPY
FT                   LMPSAILHLHRDFPDLKLYIREGIPDQQLAELARGELDMMLAPLPVAEPGLHIEPLFRE
FT                   PLQLVGPPDHKLATMKVREPEDLAGEAVLSIDPAHHLHRQTEAMCGELGAYLLRDYQGT
FT                   SLDSVRQMAGSGLGLAFLPELYLRAETGGEDMVTRLDIEGWSATRSIAAVWRERTALSE
FT                   TYAEIAQLIADHARRLLA"
FT   gene            496215..497423
FT                   /locus_tag="ELI_02285"
FT   CDS_pept        496215..497423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02285"
FT                   /product="putative Na+/H+ antiporter protein"
FT                   /note="COG3004 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62549"
FT                   /db_xref="GOA:Q2NCP2"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCP2"
FT                   /protein_id="ABC62549.1"
FT                   /translation="MFYTAATALRDFLKQESAGGIVLMFAAVLALIFANTALADTYFSV
FT                   LATEIAVTVGGGGIEKPALLWINDGLMAVFFFLVGLEVKREVLTGQLSSWKQASLPLIA
FT                   AFGGIVLPALVFYGINSGTPENLSGWAIPAATDIAFALGILALLGKRVPVALKALLLAI
FT                   AVIDDIAAIAIIAIFYTPGVELAMLGAAAITLLILSAFGRAKAGSSIPYIVLGIVLWYF
FT                   VLKSGVHATLAGVALAMTVPLIDRKGNHMLEHMEHALHSWVAFLVVPIFALANAGVSFE
FT                   GVELSALFAPLPLGIALGLIVGKQVGIFGFAWLAVKTGFAQLPSSVGWLQVWGLSLVAG
FT                   IGFTMSLFIGNLAFADPAQINAVKIGVLSGSLIAALVGIAILVLGAKAPAAKSADERVQ
FT                   APA"
FT   gene            497420..498343
FT                   /locus_tag="ELI_02290"
FT   CDS_pept        497420..498343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02290"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /note="COG0530 Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62550"
FT                   /db_xref="GOA:Q2NCP1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP1"
FT                   /protein_id="ABC62550.1"
FT                   /translation="MTTAILAIIGGLIALAIGGELLVRGAVALARRLGISNLLTGLVIV
FT                   GAATSMPEMVASVQAALIGSPEIAWGNIAGSNIANSLLILGATALIAPIAITGIGKRDA
FT                   AVAVGASALMWVLAWWQTGTIWLGVALLALLGLYIAWRYSHPRVLADEDVGEGGDLGLG
FT                   PALALTLGGVGVLVLGGTWLVGGAIDIARMAGISETVIGLTIVAVGTSLPELAASAAAA
FT                   FRGKPGLAIGNVVGSNIYNILLIGGATMLLAPFPIPAELALVQIPLVIGSAVLIWALLA
FT                   YGQRIGRITGALLLAGFAANTALQFL"
FT   gene            498544..499686
FT                   /locus_tag="ELI_02295"
FT   CDS_pept        498544..499686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02295"
FT                   /product="modification methylase"
FT                   /note="COG0863 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62551"
FT                   /db_xref="GOA:Q2NCP0"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCP0"
FT                   /protein_id="ABC62551.1"
FT                   /translation="MMGVVETTKQRVRRASKLVAVPKETLPLGQILSGDCVEAMRSLPD
FT                   ASVDLVFADPPYNLQLGGDLNRPDGSHVDAVTDHWDQFDSFAIYDQFTREWLTEAKRIL
FT                   KPDGALWVIGSYHNIYRVGAILQDLGFWILNDIVWRKTNPMPNFRGTRFTNAHETLLWA
FT                   SQGEKAKYHFNYTAMKTLNDELQMRSDWVIPICNGAERLKENGTKAHPTQKPEALLYRV
FT                   LLATTEKGDVVVDPFFGTGTTGAVAKRLGREWIGCEREDVYRGVAMKRIEKELPLDESA
FT                   LKVMQSKRAAPKVAFGALVEAGFLKPGTEVFDTKRRWVATVRADGSLECGKQTGSIHGL
FT                   GKELQGAPSCNGWTFWHYEDEGVAKPLDAARQLYLLAVED"
FT   gene            complement(499822..501180)
FT                   /locus_tag="ELI_02300"
FT   CDS_pept        complement(499822..501180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02300"
FT                   /product="Beta-lactamase class C family protein"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62552"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN9"
FT                   /protein_id="ABC62552.1"
FT                   /translation="MKLVGLLGCSLLTCMSANVAAEPAASHFEKWLTAFNSGDKATIQK
FT                   FYEEHLGDADAVTARNLRAETCGFHLARIEDESDKSFRALLSQRCFPALFRVSFGVADD
FT                   GETLEEFKLQPFAMSEARTLAATRDIADRLAGLDSFTGSMIVVRDGKEPWTYTAGTFSK
FT                   DDERPITLETPMFLASAGKMFTAVGILQLVEKGQVELDASLSRYLSDYPNSEMAKVTIR
FT                   QLLGHRGGTGEDGILQREDGANRAWVRTIDDLIKLNGSRAPAFPPGSKFDYSNYGFILL
FT                   GAVIERVSGQSYQNFIQQNVFDPAGMTHASFPDLEHIADIPVGYTTFFESEPEPIAATD
FT                   VLPWRGTAAGGGVASAIDLLRFFNALRSDILLSSDTLAIATEASETGWYGLGFVTQGGK
FT                   HPLWGHGGFGYGMNVAAQRFPEDEVTFICVATRDMACDRMIYAWSDRLFGAVE"
FT   gene            501668..502792
FT                   /locus_tag="ELI_02305"
FT   CDS_pept        501668..502792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02305"
FT                   /product="dihydropteroate synthase"
FT                   /note="COG0294 Dihydropteroate synthase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62553"
FT                   /db_xref="GOA:Q2NCN8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN8"
FT                   /protein_id="ABC62553.1"
FT                   /translation="MTETVYIRPIGFVPGPQAEEGDAIRLAGSMVYAHRFAVILRRDGQ
FT                   VAERWTCSPEHIAQVLGELPDSVGAEAETQWANLTITHPPLSLGERTVRLDQPQVMGIL
FT                   NVTPDSFSDGGKFLGADGSWPEAGKAQAAAMLEAGASIIDIGGESTRPGAEVVIEDHEI
FT                   ERVLPAVEYCAAMGAAISVDTRRAGVMAAALDAGASIVNDVSGLQYDPRSAELVAARGC
FT                   PVILMHAPGSGQDLHEGGDYESVVFDVFDQLKARRDTAVAAGISADRIMLDPGLGFGKK
FT                   LSDNTALINALPLFHALGHPILLGASRKRMIGALSNEAPVEQRLGGSIALAVAGMDAGA
FT                   HMLRVHDVAETVQARNVWRGLRDAALTDFSDLAM"
FT   gene            502952..504187
FT                   /locus_tag="ELI_02310"
FT   CDS_pept        502952..504187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02310"
FT                   /product="putative phosphodiesterase/alkaline phosphatase
FT                   D"
FT                   /note="COG3540 Phosphodiesterase/alkaline phosphatase D"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62554"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN7"
FT                   /protein_id="ABC62554.1"
FT                   /translation="MRDLMKDKGHTMRSLLAAIPLALAAPLAAQGATVDAAPSDFLEGY
FT                   YAKLRQDITLPAAPVGVPLPSTAATLTRIAFGSCNHQSRSQHMWAQIAATDPDLFLFIG
FT                   DNNYGDQGWAGDAALTTLREAYAVQAETPELAAFRGQVPMMVTWDDHDYGFNDGGGSFA
FT                   FKTWSETLFETFWDSTAEVKSRPGIYESRIFGPSDRRTQIIMLDTRFFRSELERMEYQD
FT                   ERPPLGPYVQSDDPSKTMLGEAQWAWLEQELAKPADLRIIVSSIQVLTDAHDYESWEAL
FT                   PLERRKLYEMVGQREDSGVVFLSGDRHAGGIYADTPLSAGEQLWELTSSSLNYSFSSTE
FT                   ANTAREPDPRRLTDFISEENFGLVEIDWDAETVTLSLRGSEGEVRVSETMNWGAPVSDA
FT                   PMIMEESGSGAG"
FT   gene            complement(504173..504955)
FT                   /locus_tag="ELI_02315"
FT   CDS_pept        complement(504173..504955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02315"
FT                   /product="oxidoreductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62555"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN6"
FT                   /protein_id="ABC62555.1"
FT                   /translation="MAKLDDKLCVVTGGARGIGFATCKAFLAAGADVILTDIDEEAGQA
FT                   AANELRCRFHKLDVQHESDWEDLADAAPAIDVLFNNAGITGFEDSPGPHDPENASLAEW
FT                   RRVHAVNSDGTFLGCRYAIRAMKAKGSGSIINMSSRSGLVGIPGAAAYAASKAAIRNHT
FT                   KSVALYCAQQGWAIRCNSIHPAAILTEIWEPMLGDGPDREAKMAALVADTPLKRFGTVE
FT                   EVAALCVYVASDESGYMTGAELTLDGGLLAGSAASPGS"
FT   gene            complement(504996..505442)
FT                   /locus_tag="ELI_02320"
FT   CDS_pept        complement(504996..505442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62556"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN5"
FT                   /protein_id="ABC62556.1"
FT                   /translation="MPDGPAPKLEAAESAAPADDSFRDALDRLSRKVDADNFERMRWGR
FT                   DEAPKLVRLVQLVKGAVDDRSDIDINEEGGEGNTKRFVVKVHGQRVAALAIALDKGRAI
FT                   ASIGTIERSDFTVAKGDPVHTRYENVDEAWIATALASLMERIGG"
FT   gene            complement(505455..506873)
FT                   /locus_tag="ELI_02325"
FT   CDS_pept        complement(505455..506873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02325"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="COG2204 Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62557"
FT                   /db_xref="GOA:Q2NCN4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN4"
FT                   /protein_id="ABC62557.1"
FT                   /translation="MAEDETRLLMLIDDEPAQSRLIGALAAREGWRTLVVADAETAIAT
FT                   LGTRQGMQLSAIILDQWVPGDDACQLIGELKSRRPALPILMLTQSASPLLAVEAMRAGA
FT                   TDYLIKPVAPERLMRALRSATKREAPKDELQPLTEKMPAVLDFDAMIGTEPAFRTALAR
FT                   AAKIARGHGHVLIEGESGTGKEMLLRAMHAASPRAKAPFRMINIGGIPANSIESALFGH
FT                   EQNAFPGAFDRQVGALQFCDGGTLIIDEIDRLSGELQQRLSATLAEGIVRPIGAKHGFK
FT                   IDIRLLTASNLPLEDLVEAGHFEADLLEQIAATKICLPPLRERPGDIPALARHFLGRIG
FT                   EQPGLKHLSLADSALGLLGAYDWPGNVRQLQAVLFRAAVFCEGEALTSRDFPQLSEIVG
FT                   ELAETGASLPEAVGVMLYTEDGNLRPLDEIEADVIRLAIGHYRGRMTEVARRLGIGRST
FT                   LYRKLSDLGIDNAA"
FT   gene            507036..507158
FT                   /locus_tag="ELI_02330"
FT   CDS_pept        507036..507158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62558"
FT                   /db_xref="GOA:Q2NCN3"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN3"
FT                   /protein_id="ABC62558.1"
FT                   /translation="MAANDMKSAKETYSGFISATKVAIPIIAVITLIVVILIAD"
FT   gene            507165..508277
FT                   /locus_tag="ELI_02335"
FT   CDS_pept        507165..508277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02335"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="COG3288 NAD/NADP transhydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62559"
FT                   /db_xref="GOA:Q2NCN2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN2"
FT                   /protein_id="ABC62559.1"
FT                   /translation="MRIVALRERAAGETRVALTPETAKKFIALGAKVAVEAGAGARAAI
FT                   PDAAYEEAGASVGTAEAVLKGADIVLGVQAPDVDLLGGAKPGAWVAATFDPFQQRDRVE
FT                   AYAAAGLEALSMEFMPRITRAQSMDVLSSQANLAGYKAVIAAADQYGRAFPMMMTAAGT
FT                   VQAARCFVMGVGVAGLQAIATARRLGAQVSATDVRPETAEQIKSLGGKPVFAEGLEASG
FT                   DGGYAAELSDEQKAAQAELVSGHIAKQDIVITTALIPGRAAPRLVSDDQIATMKPGSVI
FT                   FDLAVAQGGNVEGSKPDEVVERHGVSIMGFSNTPATLGPDASALFARNLYNFLSAFWDE
FT                   DAGRPVLDEEIGDAVRLTHGGKVVNERLLR"
FT   gene            508359..508946
FT                   /locus_tag="ELI_02340"
FT   CDS_pept        508359..508946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02340"
FT                   /product="hypothetical protein"
FT                   /note="COG2335 Secreted and surface protein containing
FT                   fasciclin-like repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62560"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN1"
FT                   /protein_id="ABC62560.1"
FT                   /translation="MRNKLKITTAALAFGLTVAGCTTYGGTADTMADDDIAYVDGAAMY
FT                   PSKNIIENAVNSPIHTTLVAAVKQAQLVDTLMGPGPFTVFAPTDAAFAKVPEATVSSLM
FT                   MDENRAMLQGVLTYHVVPGRVTAADLMQRIRAGNGTAMIATVQGEQLTVSMMGNRVMLR
FT                   GKNGSMAHVSQADVMQSNGVIHVVDGVLLPGM"
FT   gene            509084..509365
FT                   /locus_tag="ELI_02345"
FT   CDS_pept        509084..509365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02345"
FT                   /product="probable NAD(P) transhydrogenase subunit alpha
FT                   part 2 transmembraneprotein"
FT                   /note="COG3288 NAD/NADP transhydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62561"
FT                   /db_xref="GOA:Q2NCN0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCN0"
FT                   /protein_id="ABC62561.1"
FT                   /translation="MDFISILSIFVLACFVGYYVVWSVTPALHTPLMAVTNAISSVIIV
FT                   GALIASAEAGSAVAKWLGLAGVVLASVNIFGGFAVTERMLAMYKKKEK"
FT   gene            509536..510939
FT                   /locus_tag="ELI_02350"
FT   CDS_pept        509536..510939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02350"
FT                   /product="PntB, NAD(P) transhydrogenase, beta subunit"
FT                   /note="COG1282 NAD/NADP transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62562"
FT                   /db_xref="GOA:Q2NCM9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM9"
FT                   /protein_id="ABC62562.1"
FT                   /translation="MNPWVALAYLVAGVFFILALRGLSSPATSRAGNRFGMVGMLLAVV
FT                   TTLVTHDIANIVEIGIAILIGGIVGFTIARRIAMTAMPELVAAFHSLVGMAAVLVGWAA
FT                   YLNPGAFGLLVGDSIGAVSKIEMGLGIGIGAITFSGSVIAFAKLSGKMSGAPILLPARH
FT                   VINLGVLAAIIILTGLFAMAQGPAETLPYIVAITVLAFAIGFLLIIPIGGADMPVVVSM
FT                   LNSYSGWAAAAMGFTLGNTAMIITGALVGSSGAILSYIMCRAMNRSFISVIAGGFGADD
FT                   SAGGSEAREQRPYKQGSADDAAFMLEQAEKVIIIPGYGMAVAQAQHALREMADLLEAKG
FT                   VEVKYAIHPVAGRMPGHMNVLLAEASVPYENVFELEDINSEFAQADVAFIIGANDVVNP
FT                   AAKTDKSSPIYGMPVFDVDKAKQVFFIKRSMGGVGYAGVDNDVFYMDQTMMLLSDAKKM
FT                   VEEINKALD"
FT   gene            510939..511277
FT                   /locus_tag="ELI_02355"
FT   CDS_pept        510939..511277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62563"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM8"
FT                   /protein_id="ABC62563.1"
FT                   /translation="MRSFAAAICAALLLTGCVEKIAENRVENALLKAGLSQRNSACMAE
FT                   RMVDRLTIAQLRKLEALRGKPGEPIKPRTLRQFVDRVRAVGDNEVLAVTSTSAALCATG
FT                   LANEARRD"
FT   gene            511308..512540
FT                   /locus_tag="ELI_02360"
FT   CDS_pept        511308..512540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62564"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022442"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM7"
FT                   /protein_id="ABC62564.1"
FT                   /translation="MHGEKGEEFMTRFLIGAASLALATPAWAETITVEAGEGAQERLQE
FT                   ALILAEPGDEIVLGVGRFMLTDGLSLDVDGVTVRGAGMDATVLDFGGQQGSGEGFLITS
FT                   DDVTVRDFALENPKGDGVKSKGADNIVYYRVRVTWTDGPKASNGAYGIYPVESTGVLVD
FT                   GVKVSGASDAGIYVGQSSKITVRNSIAEANVAGIEIENSRDAIVENNITTRNTGGILVF
FT                   DLPDLPVMGGGNVIIRRNLVVANDEPNFAPPGNIVASVRRGTGILVMANEDVLIEGNIV
FT                   TNNPTAGAMVIAYTQPFEDERYNPYARNVVIGSNVFADNGTDPQLDAAEQLLAAFGGAL
FT                   PPVLWDGIAEGDTGLRVAPRTGGWTLGLSEPGQDLASGSPAPLDVPEPLGDTRDDTSIG
FT                   APAALLQRIVP"
FT   gene            512537..513556
FT                   /locus_tag="ELI_02365"
FT   CDS_pept        512537..513556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62565"
FT                   /db_xref="GOA:Q2NCM6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM6"
FT                   /protein_id="ABC62565.1"
FT                   /translation="MRHRLALLGAATLVLAGSIVARATPPAEMVDISLILGDELPKSLD
FT                   DFAFFADVRAQAPNAGVVPYGLNVPLYSDGAEKLRFLYVPTGQQIGANGEGLLQFPVGS
FT                   ALIKTFAFGEGTERRLIETRVLLHRADGWLALPYRWNEEQTEARLALAGGRLAITRPDG
FT                   EEISYRIPNKNQCKECHSVDGAIVPIGPKGRNLSGEWLGEIYEAGLLDEVNDGMDMMPN
FT                   WASRDTMPAAQMARAYLDVNCAHCHRPGGSASNSGLDLRLEQRDPIKIGILKRPVAAGR
FT                   GSGGHEFDIAPGHPERSILVHRMGSTEPGVAMPELGKSTVDEEALEVIERWIAQMEAP"
FT   gene            513553..514524
FT                   /locus_tag="ELI_02370"
FT   CDS_pept        513553..514524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02370"
FT                   /product="hydrolase, alpha/beta hydrolase fold family
FT                   protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62566"
FT                   /db_xref="GOA:Q2NCM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM5"
FT                   /protein_id="ABC62566.1"
FT                   /translation="MKRLLKILAVIVALLVIAFFILRTPDTDPEEMRAKYGTAPSQFVT
FT                   LANGQELHLRDEGPRDAMPIVLLHGSNADMSTWQPWAEALRNDYRVIRFDQIGHGLTGA
FT                   AFDEDYSGDRFIESVHLVADRLDLDRFVLAGNSMGGGIAMGFAMRHPERLSGLVLVDAG
FT                   GAPIRREGGGNLAFTLAQMPVVGNVMSAMLPRSIVERSLKQSVSKTEIVDDAMVDRYFD
FT                   MARYPGNRAATRARFSQERVPFEAEQVARVTVPTLVMWGEEDSLIPYTAAGWFMEHLPN
FT                   ATLANYPGIGHLPQEEAPERSVADLKAWLAGIAGNEPAIEPA"
FT   gene            514643..515320
FT                   /locus_tag="ELI_02375"
FT   CDS_pept        514643..515320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02375"
FT                   /product="Aspartate racemase"
FT                   /note="COG1794 Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62567"
FT                   /db_xref="GOA:Q2NCM4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM4"
FT                   /protein_id="ABC62567.1"
FT                   /translation="MIGGMSWISTRTYYEYINQLMQKRCGPKASAPLLIDSLDYRDFTA
FT                   LDTEADWDRATGLLIDSARRLEQAGAEGIVITANAMHRVYDKLVDAVSIEVLHIADSTG
FT                   ERMQAKGASDAAILGTKAVMTESFFRKRLVSHGVDLLPPEMAHAEQLERLISQELKLGK
FT                   KTRDAERTLKSMITWYEQHGAKAIVLACTELELVVDIDANVLPIYDTARIHCEAAIEWI
FT                   DCS"
FT   gene            515413..516573
FT                   /locus_tag="ELI_02380"
FT   CDS_pept        515413..516573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02380"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="COG0232 dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62568"
FT                   /db_xref="GOA:Q2NCM3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM3"
FT                   /protein_id="ABC62568.1"
FT                   /translation="MSRSHLASDPAASRGREFAHQQSETRGPRSAFQRDRDRIIHSIAF
FT                   RRLKSKTQVFVAPDGDHYRTRLTHSLEVAQIGRVIARALGLDEDLTEALCLAHDIGHPP
FT                   FGHAGERALHDASSRQGGFDHNAQTLRTLMRLESPYPSHDGLNLSWEVLEGLAKHNGPV
FT                   AEPHPALGELDTAFPLDLGQWGSLEAQVAAVADDIAYDNHDIDDGLRAGILDFDDLLTL
FT                   DFLADLWRDIEERYPGVPHERLRRELVRSQIGLMVNDVIMHTRSSTEGMESIDDVRGAA
FT                   RMLGGFSPEMFEQERALKKFMYDRLYYHPQQVAAGEKAREVISRLYAAYDQDPELMGGG
FT                   WSSDIPQQAAERSRHIVDYIAGMTDHFALEQCRQIYGKAPSGLGTV"
FT   gene            516675..517373
FT                   /locus_tag="ELI_02385"
FT   CDS_pept        516675..517373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02385"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62569"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM2"
FT                   /protein_id="ABC62569.1"
FT                   /translation="MSTRTRIALVGATGLIGQEILQLSVGREDLRIVGVARREVPLPEG
FT                   ARMEVFVAEPAKWGEVFEAVRPDAVICALGTTIRKVGGDKQAFRAVDHDLVLDTARAAV
FT                   DAGVERFLSVSSVGADRHSKNFYLSVKGETEADLTKVGFKRLDILRPGLLRGARNGDMR
FT                   PAEKLGMLASPLVDLFLHGNARRYRSVRASQVAEAALALAMRKTQGRFVHDYDAIQRAA
FT                   RMLPAPLVED"
FT   gene            517389..517838
FT                   /locus_tag="ELI_02390"
FT   CDS_pept        517389..517838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02390"
FT                   /product="Putative integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62570"
FT                   /db_xref="GOA:Q2NCM1"
FT                   /db_xref="InterPro:IPR025461"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM1"
FT                   /protein_id="ABC62570.1"
FT                   /translation="MWDTIFSINTAIAMIGWAILLFAPRRELPMTVVLYLGVALLCLVY
FT                   SVGLVGIVTGLFDPVGPADAAVDFTTIDGVQTIFASRGGVTVGWTHYLAFDLFAGLWIA
FT                   RDADAKNVSRWIQAPILLATFMAGPLGLLIWLVLRETRRAPRRAD"
FT   gene            complement(517835..517966)
FT                   /locus_tag="ELI_02395"
FT   CDS_pept        complement(517835..517966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02395"
FT                   /product="hypothetical protein"
FT                   /note="COG5510 Predicted small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62571"
FT                   /db_xref="GOA:Q2NCM0"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCM0"
FT                   /protein_id="ABC62571.1"
FT                   /translation="MARKTLLALGIVALSLTATACNTVKGLGRDIQSVGEAGEEVID"
FT   gene            complement(518131..518259)
FT                   /locus_tag="ELI_02400"
FT   CDS_pept        complement(518131..518259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02400"
FT                   /product="hypothetical protein"
FT                   /note="COG5510 Predicted small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62572"
FT                   /db_xref="GOA:Q2NCL9"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL9"
FT                   /protein_id="ABC62572.1"
FT                   /translation="MVRKTLVALGIAALSLTATACNTVKGVGQDIESVGEAGDRVI"
FT   gene            complement(518291..519214)
FT                   /locus_tag="ELI_02405"
FT   CDS_pept        complement(518291..519214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02405"
FT                   /product="putative membrane protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62573"
FT                   /db_xref="GOA:Q2NCL8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL8"
FT                   /protein_id="ABC62573.1"
FT                   /translation="MDGSVARPRPLLALGLRLLTALSLATMAMLVKLGEQRGVHLLEMI
FT                   FWRQAITLVVITGLLAWLGRLADIRTRRFGAHARRAIYGITGMMFVYGAVILLPLAEAT
FT                   TISFTTPMFAVLLALLLFREKIGLYRWGAVLVGFAGVAIVMQPGSGGAVDPFGIAIGLV
FT                   AAFMVALISFQIQDLNTTETPYSIIFWFTALTAPLAALSLPFVLTAHDPVTWGIVLAMA
FT                   LCGAAAQILLTTSLRFGSAATIIVMDYTSLIWAVTYGWTVFDRVPPPTLWLGAPLIICA
FT                   GLLVAWREHRLKQHARIEELTRSTAV"
FT   gene            519263..519493
FT                   /locus_tag="ELI_02410"
FT   CDS_pept        519263..519493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62574"
FT                   /db_xref="GOA:Q2NCL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL7"
FT                   /protein_id="ABC62574.1"
FT                   /translation="MEFLRALIFASDAELLALWGAGFLLLAAFATYMEKRRTRRTEFDR
FT                   VGWVPWFGIFFVSVIFGGGLLALAVPGMLRG"
FT   gene            complement(519839..521326)
FT                   /locus_tag="ELI_02415"
FT   CDS_pept        complement(519839..521326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02415"
FT                   /product="pilus assembly protein CpaF"
FT                   /note="COG4962 Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62575"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL6"
FT                   /protein_id="ABC62575.1"
FT                   /translation="MASGSRPAFGVARPMKGGAKAKADPGGEQFPPLPGETEGKEDSAS
FT                   APTPRAGADDALTRLADRANHIHEKTEIGGFEASVHKIKEQVLPRLLERVDPEAAATLS
FT                   KEELSEEFRPIIMEVLAELKVTLNRREQFALEKVLIDELLGFGPLEELLQDPDVSDIMV
FT                   NGPDQTYIEKKGKLVLAPIQFRDESHLFQIAQRIVNQVGRRVDQTTPLADARLKDGSRV
FT                   NVIVPPLSLRGTAISIRKFSEKPITLDMLKDFGSMSDKMCTALKIAGACRMNIVISGGT
FT                   GSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLPLETRPPNLEGQGAITIGDLV
FT                   KNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLHANSPRECLGRMENMILMGD
FT                   IKIPKEAISRQIAESVDLIVQVKRLRDGSRRTTDITEVIGMEGDVIVTQNLFKFEYLDE
FT                   SEDGKILGEFRSSGLRPYTLEKARQFGFDQAYLEACL"
FT   gene            521615..521830
FT                   /locus_tag="ELI_02420"
FT   CDS_pept        521615..521830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62576"
FT                   /db_xref="GOA:Q2NCL5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL5"
FT                   /protein_id="ABC62576.1"
FT                   /translation="MSRILIDLPDDDIRSLDAMARANGRSRAAEMREAVALYLRRQADG
FT                   NWIAQGSGYWADKDAADTKTGGGEGG"
FT   gene            521833..522198
FT                   /locus_tag="ELI_02425"
FT   CDS_pept        521833..522198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02425"
FT                   /product="hypothetical protein"
FT                   /note="COG1487 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62577"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL4"
FT                   /protein_id="ABC62577.1"
FT                   /translation="MSDPVFDTDIIGDWLRGVPQAAAELARYRKHRTSRLSWMELLAAE
FT                   PLESRDALEALLTPFQVIELDARIGAAAADIVRRSGLGLTRAIILATAQCSGAILITRN
FT                   TEDFPAAMPGIRVPYTL"
FT   gene            522217..524040
FT                   /locus_tag="ELI_02430"
FT   CDS_pept        522217..524040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02430"
FT                   /product="glucosamine 6-phosphate synthetase"
FT                   /note="COG0449 Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62578"
FT                   /db_xref="GOA:Q2NCL3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL3"
FT                   /protein_id="ABC62578.1"
FT                   /translation="MCGIIGIVGKEEVADRLVDGLRRMEYRGYDSAGVCTIADGTLIRR
FT                   RAQGKLQNLVAELAKAPAPGDIGIAHTRWATHGAPTAENAHPHATDEVALVHNGIIENF
FT                   KPLKAELTEGGRSLTSDTDSEVVAHLVSAEVERGASPEEAIKTVLPRLRGAFALAIAFR
FT                   QRPDMLIGARLGSPLVVGYGEGETYLGSDALALAPLTQKIAYLEEGDWVVITRDGAQIY
FT                   DAENTPVERETVTSGASAAAVEKGNYRHFMQKEIFEQPTVVAQTLNSYVRQADESVALP
FT                   QIDFDLTAIKRITIVACGTSFYAGMVAKYWFETFARVPVDIDVASEFRYREPVLEDGGL
FT                   AIFISQSGETADTLAALRHCKENGQTIAAVVNVPTSTMAREADLLLPTHAGPEIGVAST
FT                   KAFTCQLAVLAAVAAHMAVKKGKMSREEEQEVVRHLLEAPACLNAALDHDDDIAAMAPL
FT                   IAPARDVLYLGRGQDYPLAMEGALKLKEISYIHAEGYASGEMKHGPIALIDEAVPVIVL
FT                   APSGPLFEKTVSNMQEVSARGGKIVLISDAEGLAEAGDGCLATIEMPKVHPLIAPLVYA
FT                   VPVQLLAYHVAVVKGTDVDQPRNLAKSVTVE"
FT   gene            524134..526485
FT                   /locus_tag="ELI_02435"
FT   CDS_pept        524134..526485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02435"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62579"
FT                   /db_xref="GOA:Q2NCL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL2"
FT                   /protein_id="ABC62579.1"
FT                   /translation="MSENRSDALSLPATLPLLAILGIKECDSADWPRLRALQYARVAQH
FT                   TRFRLGAHFACAAISCWISLQHLAWLTVLGWAIGLALTLSIFTSQDWLLRKADGRTLSQ
FT                   REAFRHASGSALVAIAWAAQPVLHWLYGTPTSMLQAWLIVMVVTLGSSLALAAAPLGAI
FT                   IYIATTSMTAIVVFGLAGQYPPAVAALLYMLVILWGVYQRAEAFLRQSAAEAGMNERNE
FT                   VVSLLLREFEENEADWLWQIDTQRKVRSVSPRFAFALGLEPGEADGMPFLQLIAGDAWK
FT                   TGQFPTSLHDLAERLKRKESFSNLLVKVSIDGVTRWWELSGTPMLDEEGKYVGYRGVGS
FT                   DVTEQRESSEKIAYLARYDTLTELPNRLMVNESLGEAMKYAKQWRSRCAFMMIDLDRFK
FT                   AVNDSLGHQTGDELLAEVSGRLKSILSENEMCGRLGGDEFAIVIRDVKDRDYVDTVARR
FT                   VIEHLSQPYEVNHHMLYVGASVGSAIAPRDGRSVEELMRNADLALYRAKDLGGGEHFQY
FT                   EPSLHKSAEERRQLEFSLRMALDRQEFELAYQPVVDANDETIISFEALLRWNSAEHGFV
FT                   SPAKFIPLAEDTRLIVPIGSWVLEQACIEAANWPDPVKVNVNVSPEQLVEPDFVATVVR
FT                   ALSTSGLPANRLELEVTESIFVRDALVAGKALKEVMHLGCQVALDDFGTGYSSLGYLRQ
FT                   LSFSTIKVDRMFVQGAAQGSKESLAIIRAVVAMADSLDMTTTAEGVESFEEAELIRELG
FT                   CTKIQGYYFGRPMVKAEARKLFDVPGRLRA"
FT   gene            complement(526513..527184)
FT                   /locus_tag="ELI_02440"
FT   CDS_pept        complement(526513..527184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02440"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /note="COG0047 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62580"
FT                   /db_xref="GOA:Q2NCL1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL1"
FT                   /protein_id="ABC62580.1"
FT                   /translation="MRTAVITFPGSNCDRDMAVALERASGKAPLRVWHADKDLPERLDF
FT                   IALPGGFSYGDYLRSGAMAANSPIMRAVKREADRGVAVLGVCNGFQVLAESGLLPGALM
FT                   RNAAQTFICRTAALEVVTNRSLFTSGYEAGRTIHIPVAHHDGNYFADAETLDRLEGEGR
FT                   VAFRYHENPNGSQRDIAGILNAAGNVLGMMPHPERAVDAAHGGTDGLPLFKAALERLAA
FT                   A"
FT   gene            complement(527190..527423)
FT                   /locus_tag="ELI_02445"
FT   CDS_pept        complement(527190..527423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02445"
FT                   /product="phosphoribosylformylglycinamidine synthase small
FT                   subunit"
FT                   /note="COG1828 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, PurS component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62581"
FT                   /db_xref="GOA:Q2NCL0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCL0"
FT                   /protein_id="ABC62581.1"
FT                   /translation="MKVRIHVSLKPGVLDPQGRAVHHALEGLGFAGVENVRIGRLIELD
FT                   VADDTSDASLTEMCEKLLANTVIENYRIEKAD"
FT   gene            complement(527600..530479)
FT                   /locus_tag="ELI_02450"
FT   CDS_pept        complement(527600..530479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02450"
FT                   /product="peptidase, M16 family protein"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62582"
FT                   /db_xref="GOA:Q2NCK9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK9"
FT                   /protein_id="ABC62582.1"
FT                   /translation="MKGPLFAAPMALVIAVPLAAQPTTEALVPAAAAQTADEAVWAYEE
FT                   SDLVPEQGYVFGVLDNGMRYVIRQNDTPEGTALVRMEVAAGRLDERDDERGLTHYIEHM
FT                   AFNGSTNVPEGEMIKLLERLGLAFGADTNASNTFGYTNYRLDLPNNDPALLDTALFLMR
FT                   ETASELLFDEEAVERERGVILAEQRDRTNYAQLNALDQIEFLVPGSLLTKRFPGAGRED
FT                   VDTADAATLRALWERVYVPGKTTLIVVGDFPVDVMREAIVKHFSSWQGPDGADQPDAGP
FT                   VDPGRQGETDIYTDPALTEAITFARNAAWIDRPDTMADRRASILRALGYSILRRRLTKL
FT                   ARAEDPPFRSVGVGTSDIFEAGRQTTLTVAPIEGQRERGVMEAVTTFRQFVEFGVSAAE
FT                   IAEQVANRRTGLENAVAGQATRSHGTFAGRATALVRNDRIPTSPEFDLALFEEVAATAT
FT                   PETVMAAIRADIVPLDNPLIRFQGPNAPEGGAEALRALWDAAVGAPVDAPQESAIAAWT
FT                   YTDFGAPGEVVSDTVDERLDIRTITFDNGVRLNLKPTDLAEDRISLAVTIDGGNFIESR
FT                   EEPLKVDLTALFAAGGLGAYTQDELQTVLAGRSVGFSLGASTDSFRFSRTTTPRDLELQ
FT                   LQLIAAYLTDPGYRPEPIKRFRNGLGDFYARLTATPGAAYSSASGAILSDDDPRFSLPE
FT                   RGALEALTFDDLREAISDRLANGAMEVALVGDFDPGRAIDLVARTLGALPPREAAFRDY
FT                   PDSRQRSFTATRERQTIYHDGEDNQASLRFVWPTRDYSDQQAFSELAMLRSVLTLKLTE
FT                   TLREDLGKAYSPSVGSSLSRYYPGYGTFQVVANIDVGEVEATRAAILETLNRLRNEPVD
FT                   DDTLQRARQPILETIDNALKTNGSWMRYVRRAQSEPDRIDRFLASRGIYEAITAEQLQE
FT                   TAAQYLTEGGAVEFLVLPRPEDQADTAAQ"
FT   gene            530561..531442
FT                   /locus_tag="ELI_02455"
FT   CDS_pept        530561..531442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02455"
FT                   /product="hypothetical protein"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62583"
FT                   /db_xref="GOA:Q2NCK8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK8"
FT                   /protein_id="ABC62583.1"
FT                   /translation="MARIDLVYNPVSGSFREQGLAALVAALESEGFAVELLSTQADGVR
FT                   LSGRADLICVHGGDGTLRDTVQAMGEGAGDTPLCIARSGTINLVARELGYSARPKDFAR
FT                   DLAAAWARGPSGWVRSPLFRLGEMPIVSCLSIGPDSVAVAHVSGALKRRIGRLAYAVAM
FT                   LRLLRTWPRQAMTIAGTLADGTPFACEAEAAIVSHARLYAGPFQLSPRAALAEDSVELI
FT                   TLRRCGRLGMLAFIAAAMLRLPVERFGFAQIRSARRIAFDRCITPVQVDGDHMPDCAFA
FT                   IEPSGITLTYVV"
FT   gene            complement(531446..532264)
FT                   /locus_tag="ELI_02460"
FT   CDS_pept        complement(531446..532264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02460"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62584"
FT                   /db_xref="GOA:Q2NCK7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCK7"
FT                   /protein_id="ABC62584.1"
FT                   /translation="MSRRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAEKKGTISG
FT                   KGVINNRISEHVFTRLSHIGIPTHFIRRLNMREQLVRQCEIIPIEVVVRNVAAGSISKR
FT                   LGIPEGEPLPHTLIEYYYKDDSLGDPLIAEEHIACFNWASPEEMQDIASMAIRINDFMA
FT                   GMFAAIDIRLVDFKLEFGRIYDGDFSRVILADEISPDGCRLWDMNSGEKLDKDRFRRDL
FT                   GGESEAYQEVARRLGLLDEDRNNGEGGPGEVFDMSAHRSRLRGTPTPPKK"
FT   gene            532418..533338
FT                   /locus_tag="ELI_02465"
FT   CDS_pept        532418..533338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02465"
FT                   /product="hypothetical protein"
FT                   /note="COG1493 Serine kinase of the HPr protein, regulates
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62585"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK6"
FT                   /protein_id="ABC62585.1"
FT                   /translation="MGRFFYRHSGCHIVSELELPEWQAFALAGADAAIDETDIAIRLGD
FT                   TLEAAPVPDHLPEVEGDTVRFSVPDTGKWEVSAGNAIEVHPLAGADPIAVRLFTLGTAW
FT                   GVTGYQRGWPMLHGSAVMGPKGAVLFCGRQGAGKSTLAAALAERGCPLVSDDLSRAVPG
FT                   RADRPTMLYPSSVRHKLWEEAIAGLGMTGREKVRDHMQMEKFHIATERHVPLDQPVPLV
FT                   AIYALRFGGEIAIEREMGGDAAHMLLAQTAYRPRFLEAMGRLTEQAVYAAQISASVPIH
FT                   GLTRPRDFGQLDAVCDRILAHMESH"
FT   gene            complement(533529..533601)
FT                   /locus_tag="ELI_t15145"
FT   tRNA            complement(533529..533601)
FT                   /locus_tag="ELI_t15145"
FT                   /product="tRNA-Phe"
FT   gene            complement(533687..533848)
FT                   /locus_tag="ELI_02470"
FT   CDS_pept        complement(533687..533848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02470"
FT                   /product="hypothetical protein"
FT                   /note="COG3024 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62586"
FT                   /db_xref="GOA:Q2NCK5"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK5"
FT                   /protein_id="ABC62586.1"
FT                   /translation="MKKPCPICKKPRSEDHSPFCSTRCKDRDLARWFTDGYSVPGPPAA
FT                   PEDILREE"
FT   gene            complement(533845..534798)
FT                   /locus_tag="ELI_02475"
FT   CDS_pept        complement(533845..534798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02475"
FT                   /product="ribonuclease"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK4"
FT                   /protein_id="ABC62587.1"
FT                   /translation="MAEWLVERGIGEDRALLVEGDQTLAAKLHWPGDLFAGQILPARLT
FT                   TRRSGSNRGVASTANGLEILIDKLPHDVTEGSKVSVTLTRAPIAERGRLKLAQGRVSEA
FT                   GPSPDALASLAAREVRRFPAGLWEEVWDGASSGEIAFVGGSLLFSTTPAMTLVDIDGDG
FT                   SPRELALAAIPALARALRQFDLGGSIGIDFPTIADKAGRKAVDAALGEALADWPHERTA
FT                   MNGFGFVQIVARLEGPSLLHRMATSRIGAAARMALRRGELVEGAGVTLLTVHPALKAKL
FT                   KPEWLAELEKRTGRPARLETDPGLAIEAAQAQIIAA"
FT   gene            complement(534791..535309)
FT                   /locus_tag="ELI_02480"
FT   CDS_pept        complement(534791..535309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02480"
FT                   /product="nucleotide-binding protein"
FT                   /note="COG0424 Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62588"
FT                   /db_xref="GOA:Q2NCK3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK3"
FT                   /protein_id="ABC62588.1"
FT                   /translation="MARLGIEPAAIVPAQIDETPHKAELPRDYALRMAREKAQAVDASG
FT                   HVLAGDTVVAAGRRILPKAEDQATARQCLELLSGRRHRVLSAIALKSPDGTLREKLSET
FT                   VVRFKRLSEEEIAAYLASGEWEGKAGGYAIQGSAEGLIAWIQGSHSGVVGLPLFETRAL
FT                   LKAAGMTIG"
FT   gene            complement(535493..535750)
FT                   /locus_tag="ELI_02485"
FT   CDS_pept        complement(535493..535750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02485"
FT                   /product="translation initiation factor 1"
FT                   /note="COG0361 Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62589"
FT                   /db_xref="GOA:Q2NCK2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCK2"
FT                   /protein_id="ABC62589.1"
FT                   /translation="MAKEELLEMRGKVVELLPNAMFRVELENGHEVLGHTAGKMRKNRI
FT                   RVLVGDEVLCELTPYDLTKARITYRFMPGRGGPGQGPGPQ"
FT   gene            536022..538946
FT                   /locus_tag="ELI_02490"
FT   CDS_pept        536022..538946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02490"
FT                   /product="hypothetical protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62590"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK1"
FT                   /protein_id="ABC62590.1"
FT                   /translation="MALVFASPGFAQQAQPSGPDGSETAPDDEAARTADGTIVVTADRL
FT                   PGQLDVPQAPLVELDAEDIAGFGVGSIQELVAQLEPASGSARGRGGGRPVFLINGIRVS
FT                   SFREFFRYPPEALEKVEVLPEEVAQRFGFPPDRRVINFILKDDFSSREVELEYEQPDRG
FT                   GYTRTEQEFGYLAIAAGGRLNLNFEANDTSLLTEAERDIVQTPGSLPTVAGDPDPAAAR
FT                   SLVADSRGFEGSINWASAFQESGGSLSLTGQLERQKSRSLSGLDSVTLTGPGGASEFRT
FT                   FNGDDPLERRSVTDAASIEMAYSQPLGDWQFTVTAGGNVSDTRLEIDRRADTAVLQAAA
FT                   LNGSLALTAPIPGQPDPGFDIAITETAGATGKATLRGTPFLLPAGEASLTVDAGYDWSY
FT                   IDSDDTRSAVGSNLSRAIVEGGVNLGIPLTSKRENFLGAVGDFDLNLQAGIDHLSDFGT
FT                   LRDFSIGLNWEPFDDFQLGVTYVDNEAAPSLGFLGNPVTTTFNVPVFDFATGRTELVTV
FT                   TDGGNPNLLAESQRDWKFSANWKLPVDGDVRLNVDYVRNRSSDVSQGFPALTDAIEAAF
FT                   PGRATRDAAGRLVALDTRPVTFEETRAERISFGLNMRGQIGKRPERPEGGPPGAARGAS
FT                   PSTGGPEARGGGGGGAFDPARMQALRDRFCATPEGKTPDLTGVPEPILARLRGEDGQID
FT                   PERLKQLRARFCTEEGQQQADDRFARMRAALCGETPDLDALPPQMAARLRREDGTIDPE
FT                   RLERVKQRVCNREGGDGAVGDGAGGAGAGGAGEGSGQGGQQARGGGRGGGGFNPFTGRG
FT                   NRDPRPRYFLSLNHTVELENTILIAQGVPLLDQLRGDATSTFGLPRHSTRLEGGLFFGG
FT                   IGTRISARYTGKAFVEGSGLPGSSDLFIDDLATVDLRVFANIGELAGEEEGFLKGLRIS
FT                   LRADNIFDGRRVVRDQNGDTPLRFQPFLIDPTGRYLGVDIRKLF"
FT   gene            complement(538973..539776)
FT                   /locus_tag="ELI_02495"
FT   CDS_pept        complement(538973..539776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02495"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62591"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCK0"
FT                   /protein_id="ABC62591.1"
FT                   /translation="MTAATIDQDSDRMPEARPPSRLLALAEPGRAMGELAAFYALTPFR
FT                   SLLPRGDGHGVLVLPGFMASDYSTRPLRRLLTGLGYDAVGWNLGRNVRVDNSRVEAMAG
FT                   CVEELHERSGGKVSIVGWSLGGVFARELAKMMPEKVRFVISLGSPISDDRNHTNARRLF
FT                   EFLNGESPEPLRQGKFQNLAEAPPVPTTSILTKTDGVVHWRGSVQAESEQTENIEVYAS
FT                   HCGMGANPSVAYAIADRLAQAEGQWKPFRAEGVYSLAFPRSRLFH"
FT   gene            complement(539773..541353)
FT                   /locus_tag="ELI_02500"
FT   CDS_pept        complement(539773..541353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02500"
FT                   /product="hypothetical protein"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62592"
FT                   /db_xref="GOA:Q2NCJ9"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ9"
FT                   /protein_id="ABC62592.1"
FT                   /translation="MDASFVALETPTSPMHIGSILIYNPETAPGGFVRFKDILSFFESR
FT                   MQLSTTIRQRMVRVPFDLDYPYWIEDPEFDLEYHIRHIALPKPGDWRQLCIQAARIFAR
FT                   PLDLEKPPWEFTVVEGLDNIPGVAPGSYAMVTKVHHAAIDGMSGIDLMEATHTLDPNDP
FT                   PPNTPDTWKPERIPGPAELLGKSYVNTLLNPAKQLEVAAKAVPGIAKAVTGLVKKEFSL
FT                   SSDMVAPRTRFNRKISPHRVVEGRSFPLEDIKAIRALAPGSKVNDVFLSIIGGGLRKYL
FT                   AAKDDLPKATLTAMAPISVRSKDEKNDMGNQVAAMIAPLGTHIEDPAERIAWVHSKTTN
FT                   SKAMTDAMGARNMTEISKVSPALYMSLGAQLYTRLGLANRGVGPIFSTVVTNVPGPPVP
FT                   IYSSGARLESMMGLICLTDGMGLAHTVQSYVGEATICFTACRELLPDPDFYIECIEESF
FT                   EELRDAAAVVAKTPTDKPAKKAPAKKAPAKKAPAKKIAAKPRTTKSKPKTKPKTAAKSP
FT                   SGSKGKTTA"
FT   gene            541542..543632
FT                   /locus_tag="ELI_02505"
FT   CDS_pept        541542..543632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02505"
FT                   /product="excinuclease complex nuclease subunit"
FT                   /note="COG0322 Nuclease subunit of the excinuclease
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62593"
FT                   /db_xref="GOA:Q2NCJ8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ8"
FT                   /protein_id="ABC62593.1"
FT                   /translation="MSGTKAGSPNDPRGAERFNEERAAYTVASAKPDLEGGVKAIREVV
FT                   RTLKPKPGVYRMLDARGDVLYVGKARSLKARVANYTQVSNLSGRLQRMVSQTRGMEIVT
FT                   TNSEAEALLLEAQLIKRYRPPFNVLLRDDKSFPFILLRADHDFPRIMKHRGARRAKGNY
FT                   YGPFASAGSVNTTINALQKLFLLRSCTDSFFSNRDRPCLLYQIKRCSAPCVGRIDEEGY
FT                   AELVREAKDFLGGKSDAVQRKIERQMARAAEDLDFETAAILRDRLRAATFIQGSQAINA
FT                   SGVGDADVFALAHKNGQIAVQAFFIRGGQNWGHRAFFPTHTKDVEEPQVLSNVILQFYE
FT                   EVPPPPTVLVDRELPESELIEAALSELAGKKVQLSIPQRGDRRKLMQQASRNATEALDR
FT                   RLAERGTQAKLNRELAEFLELDAPPERIEVYDNSHIQGAKAVGAMVVAGPEGFIKNQYR
FT                   KFNIREAQSNDDFGMMREVMRRRFRKLAEGEGPYEEDLSTRARTASSAAARDERDGAAD
FT                   TVRPEQRSSEAKRSRERGSRGKKDTHETIWPDLVLIDGGKGQMSSVRDTLAEMGIEDVP
FT                   LVAIAKGPDHGREGREVFHFPDGREKTLPVNSPLLFHLQRLRDEVHRYAIGAHRAKRSR
FT                   AITASPLDEIPGIGPARKRALLLHFGTASKVRAAALEDLQRAPGVSNAVARKVYDFYHA
FT                   GG"
FT   gene            complement(543681..544184)
FT                   /locus_tag="ELI_02510"
FT   CDS_pept        complement(543681..544184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02510"
FT                   /product="peptidoglycan-associated protein"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62594"
FT                   /db_xref="GOA:Q2NCJ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ7"
FT                   /protein_id="ABC62594.1"
FT                   /translation="MKLTHVSPFALAALLALSACGKKDIEELPIPGDAPPASTGQTSGI
FT                   APGSQADFMQQMGGKEIIYFDTDRFNIDDIDAAALQQQAQWLSQYPGKRATIEGHADER
FT                   GTREYNLALGERRANAAKNYLASLGIDTSRLSVISYGEERPVALGSDQAAWSQNRRAVT
FT                   VTID"
FT   gene            complement(544416..545111)
FT                   /locus_tag="ELI_02515"
FT   CDS_pept        complement(544416..545111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02515"
FT                   /product="putative two-component system response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62595"
FT                   /db_xref="GOA:Q2NCJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ6"
FT                   /protein_id="ABC62595.1"
FT                   /translation="MNILVVDDEPSILEALRPVLAARGYSVLTAGDGKAALDAIKSNPI
FT                   DLVLLDLGLPDVDGSELIAPIKRSADASVVILSARHLEADKVRALDEGADDYVDKPFGT
FT                   DELLARIRVIERRRAMLSGATPTKLVSDDIVFDIERRELTLMGEPVHLSPKEFALFEVL
FT                   ARNSGQVVTQRRLMIAGWGNTTVDNQYLRSYISLLRDKLEIDPSDPELLLTEPGVGYRL
FT                   AVPLSPAEG"
FT   gene            complement(545108..546643)
FT                   /locus_tag="ELI_02520"
FT   CDS_pept        complement(545108..546643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02520"
FT                   /product="probable sensor protein"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62596"
FT                   /db_xref="GOA:Q2NCJ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ5"
FT                   /protein_id="ABC62596.1"
FT                   /translation="MDAERAEFGYQPTMSLLRESPERSNLAVSLAIDFGVFFIAALVTW
FT                   LAQYFDRPITAVLAFLTGVIMIAVHSGMTRAVIGAVAASIVYNFFLSEPVYQFGVTTAD
FT                   ETIPLVAFNVSALLVGFVVGRLSDYASDAQTARAETQFLLTLSDKLQSAISFEDVELAI
FT                   NRALPMQGLESVKVYLSRGDAYVRPTTGEVEMESFSALIAENTDHPPGSRAKILELLGA
FT                   RGSLGLVKFQLVHTAKGEDVALRLQSITALIAVAIERCLLLDELAEARTAARSEELKDA
FT                   ILASVSHDLRTPITVIETAASALKSSDVSLDGEQRHKMLVSIVEQCHRLDRYTNQLLDV
FT                   GRIQAGISKLRMGTVDLAEIAQLAIRHVRSGKPEVVFERNFPRERCLVSGNEGMLENAL
FT                   FNLFDNAAKFGGADGPVTVEIAIEGRYARLSVSDRGPGIPAHELDTVFKRFHKSGRNTA
FT                   NGGAGLGLFIARGFIEAANGSIAIESPVDGQHGTRATVRLDLAREPELREAAA"
FT   gene            complement(546686..548029)
FT                   /locus_tag="ELI_02525"
FT   CDS_pept        complement(546686..548029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02525"
FT                   /product="probable cation efflux pump (multidrug resistance
FT                   protein)"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62597"
FT                   /db_xref="GOA:Q2NCJ4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ4"
FT                   /protein_id="ABC62597.1"
FT                   /translation="MDVRTRLFLTDPPGPLLVRMATPNSLAFMIQSFVSLGEVWIIGQL
FT                   GTVSLAAIALSFPLLMLTQAMAGGAVGGAVTSSIARALGRGDSEAANRLIWHALAICAG
FT                   GSALFLLLFLAAGESLLRFLGGSGIILGQAASYCLILFSGGLFLWLLGVTGAVFRGMGD
FT                   MKTPAALMVLGAFVQVPLTAVLVLGLLGAPRLGIAGAAVSAVATGFLVSTVMLFLLTRP
FT                   GRIIRLERGALVFERRLFRDIFAVAAPASLSPLLTILIILSLTAMIARFGEAALAGYGI
FT                   GSRIEFLLIPLVFGIGAAMTSLVGLAIGAGDIARAERIGWTGGAMAAALAGVVGALLTL
FT                   FPDRFIGAFTQDPEAFAAARSYVRIVGPFYAFQGLGLALYFASQGAGYMFWPVAATIAR
FT                   VALALGGGWWLGFRLECGLDGIYIAAAAAMAIYGLMMAGSVKLGAWRE"
FT   gene            complement(548145..549665)
FT                   /locus_tag="ELI_02530"
FT   CDS_pept        complement(548145..549665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02530"
FT                   /product="hypothetical protein"
FT                   /note="COG3670 Lignostilbene-alpha,beta-dioxygenase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62598"
FT                   /db_xref="GOA:Q2NCJ3"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ3"
FT                   /protein_id="ABC62598.1"
FT                   /translation="MPSSPTITRQPPVRTTLEPSNHPYLSGAWTPLHEEVDVDALDVIE
FT                   GEIPADIDGIYLRNTENQVHQPLGRHHPFDGDAMIHQVGISGGMASYRNRFVRTQCFEA
FT                   EQVAGRSLWGGLMDPAGTSERPGFGAHGGLKDTGSTDIIVHAGVAYATLYQCGEAWMLD
FT                   PETLENLGKAPWGPLDGISAHPKVDEATGELMFFNYSKHAPYMHYGVVDRAGRLAHYVP
FT                   VPLPGPRLPHDMAITKNWSILNDMPLFWDEDLLQRDIHAARLHEGLPTRFALIPRHGGP
FT                   EDIRWFEAEPTFVLHWTNAWEETAEDGSVEVVLEGYHQSNPMPQPLEEFGQYAHMMAYV
FT                   DEHSFECRLHRWRFNLATGETREERLNERIVEFGTINPRFAMRPSRYVWSTTTKPGWFL
FT                   FNGYVRHDTQTGEEQVYELPEGVYASESPMVPRQGGTDEDDGYLVTLLIDENSGSSECA
FT                   ILDASDITKGPICRLALPHKICSGTHSTWVERSQLEADRAFHRARFAA"
FT   gene            complement(549748..549903)
FT                   /locus_tag="ELI_02535"
FT   CDS_pept        complement(549748..549903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02535"
FT                   /product="hypothetical protein"
FT                   /note="COG3727 DNA G:T-mismatch repair endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62599"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ2"
FT                   /protein_id="ABC62599.1"
FT                   /translation="MNRLRDEKNRSALISAGWEVLEIWECQLDEPDLTNRLNSFLFSAN
FT                   EADEKK"
FT   gene            550483..550767
FT                   /locus_tag="ELI_02540"
FT   CDS_pept        550483..550767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62600"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ1"
FT                   /protein_id="ABC62600.1"
FT                   /translation="MIVPPSWQDPLRKLLSTKFDGNLPVVLDHGRKFSHNLFGMLTEFL
FT                   LVKLGERSREIIGPEIILPFAFGCPRIRMRRKTAVEILRKQSTRNFSIL"
FT   gene            551383..551475
FT                   /locus_tag="ELI_02545"
FT   CDS_pept        551383..551475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62601"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCJ0"
FT                   /protein_id="ABC62601.1"
FT                   /translation="MFTVRKVGRARVIIQFVHENRAEASLLESK"
FT   gene            complement(551635..552540)
FT                   /locus_tag="ELI_02550"
FT   CDS_pept        complement(551635..552540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62602"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI9"
FT                   /protein_id="ABC62602.1"
FT                   /translation="MRGSQAALEYPAKGKKMIEGLRQEAMAAVYRMRTFSLCREVWGSA
FT                   ISDITRDMTDPKAIYDLGSKLAEVFALTGSAGRDQSSLSGGGAAWEGLICWYLNTVLTD
FT                   TRAVVMKQSKALVPNVVSNAMTITYKNVRTNTESDLTGIVLPRNQELINGIYERDRFNE
FT                   LISQNLRLTSVHSIQCKTNWNDNAQIPMLWDMVYQFRDVKSHSVKIGVDGVDLDDFADF
FT                   TYSFVTVPTGKKVVKPNSMQVHRVHSLSGGNYWGRPSQNGVAESIPEIFKRVFKHAFDL
FT                   DVRTHIKNLVDNGRIRGLTP"
FT   gene            complement(552756..553682)
FT                   /locus_tag="ELI_02555"
FT   CDS_pept        complement(552756..553682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02555"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="COG1946 Acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62603"
FT                   /db_xref="GOA:Q2NCI8"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI8"
FT                   /protein_id="ABC62603.1"
FT                   /translation="MSDTVPPEKLVGGLVKLLTVEKRATDVYQGRPQKGGTGRVFGGQV
FT                   IAQALQAAQATVGGSGTDGKQAHSLHAYFLRGGKEGPPIEYRIERDFDGRSFANRRVVA
FT                   SQENEDGTSTPILNLTASFQAPEDGMEHEDAPMPDVPAPDDLRSDMEVRREIAEKAGDK
FT                   LSEAQRNMMLRPRPIDMRTCDRLHWMNREPSEPRAHSWFRTVAPLPDDPQLHRAIISYA
FT                   SDYTLLGTSALPHGLSWMRGELVGASLDHALWFHRPARADEWLLYATQSPWSGSGRGMN
FT                   LGRIFNQRGELVASVAQEGMMRKRKSK"
FT   gene            complement(553737..554630)
FT                   /locus_tag="ELI_02560"
FT   CDS_pept        complement(553737..554630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02560"
FT                   /product="hypothetical protein"
FT                   /note="COG2850 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62604"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI7"
FT                   /protein_id="ABC62604.1"
FT                   /translation="MNYVSTLHESTIGGISHSGEVFPPEARKAFAANYPEVPHKLRHTL
FT                   ESHRLLTLDALAGLASALPSSSIEYNRGDLPIGVDGKPGSTGMTIEDTIRHIATSNSWA
FT                   VLKNVEQVPAYRDLLLRLLGELKADVESRTGAMLRPQGFVFISSPNAVTPYHFDPEHNI
FT                   LLQLKGSKAMTQFPAGDPAFAPDEIHETYHSGGARELQWHDAMLPGGKEFPLEPGEALF
FT                   VPVMAPHFVRNGADSSISLSITWRSDWSFAEADARGFNRLTRKLGISPKAPGRWPKQNR
FT                   AKAYAYRALRKTGLVA"
FT   gene            complement(554634..555779)
FT                   /locus_tag="ELI_02565"
FT   CDS_pept        complement(554634..555779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62605"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI6"
FT                   /protein_id="ABC62605.1"
FT                   /translation="MTRIEGALAECATLQPAHFEVRPWEGHELAEDPRPWQDLSRLASD
FT                   PNPFFEPWALIPALREFAAPGVVQLATLTVGKVLVGLLPLSLTRDYYGRPIPHISVWLH
FT                   HNAFCGAPLVAAGYEASFWSQMFRWAGDASPTALYLHLARLPADGSLHAALGTVLDLEK
FT                   RAAAVVQRHKRAFLCSDQAPGDYLAQSLNAKRRKDLRRQYKRLAELGELVFERTMGQED
FT                   LSGWIDAYLDLEQRSWKGEQNTALADCPNTARYFRDTLTGAAAAGRLERLAYRLDGKPI
FT                   AMLSNFLSPPGAFSFKTSFDDAYAKYSPGVLLQRENLDLLRNADIAWCDSCAAEGHPMI
FT                   DRIWRERREILSINIAIGGAHRRLAMKTLTRFETGAWAEGI"
FT   gene            complement(555925..558057)
FT                   /locus_tag="ELI_02570"
FT   CDS_pept        complement(555925..558057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02570"
FT                   /product="H+ translocating pyrophosphate synthase"
FT                   /note="COG3808 Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62606"
FT                   /db_xref="GOA:Q2NCI5"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI5"
FT                   /protein_id="ABC62606.1"
FT                   /translation="MNLVLIAIGLGLLAVIYGFVTSRQVLGASAGNAKMQEIAGAIQEG
FT                   AQAYLNRQYTTIGIVGVIAAIVLGLLLGVVPAVGFVIGAVLSGVAGYIGMNISVRSNVR
FT                   TAAAAEKSLQSGLTIAFRAGAITGMLVAGLALLAIAVFFYALIGPMGYEVTSRTVIDGL
FT                   VGLAFGASLISIFARLGGGIFTKAADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVG
FT                   DCAGMAADLFETYVVTVGATMVLTALLLPSIGDLLLPLMALPLLIGGACIVTSIIGTYF
FT                   VRLGGGTNVMGAMYKGFLVSAVGAIPLIYLVTQYALGEMDSVINAGTGMVEFTGMDLFL
FT                   CALLGLVITGLIIWITEYYTGTNFRPVRSIAKASETGHGTNVIQGLAISLESTALPTIV
FT                   IAGGIIIAYQLAGLMGIAYGATAMLALAGMVVALDAYGPVTDNAGGIAEMAGLDDSVRE
FT                   KTDLLDAVGNTTKAVTKGYAIGSAGLGALVLFAAYTTDLRVFFPEFLDGDLTNGEVSFS
FT                   LENPYVIVGLFLGALLPYLFGAMGMTAVGRAAGDVVKDVREQFAADKGIMAGTSRPDYA
FT                   RTVDLVTKAAIKEMIIPSLLPVLSPVVVYFVITAIAGQDNGFAALGAMLLGVIVGGLFV
FT                   ALSMTAGGGAWDNAKKYIEDGNHGGKGSEAHKAAVTGDTVGDPYKDTAGPAVNPMIKIT
FT                   NIVALLLLAVLAGGHA"
FT   gene            558273..558467
FT                   /locus_tag="ELI_02575"
FT   CDS_pept        558273..558467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62607"
FT                   /db_xref="GOA:Q2NCI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI4"
FT                   /protein_id="ABC62607.1"
FT                   /translation="MQIALQKMFLVMPFLFGIGFIAPLIAQTMAYWGWEPPLAMSRIGF
FT                   GLLIGGGWGLYATIRGRWV"
FT   gene            558464..559468
FT                   /locus_tag="ELI_02580"
FT   CDS_pept        558464..559468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02580"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="COG3239 Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62608"
FT                   /db_xref="GOA:Q2NCI3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI3"
FT                   /protein_id="ABC62608.1"
FT                   /translation="MSDRIDTEEKPFDFDLGPPDSDPVVVPETDRSGDAPAIPLRPDEG
FT                   LDKYARVELLKQEREIAAKYHGGPMWGYVVAAFIGFAVWVAMFPLTMFGVVHPLIALVV
FT                   STFITVAGYVTCHEAMHDNIAKRGSKDRWMNQWVGEVSLIPIAVPFSMGKVTHLEHHKH
FT                   CNDPDNDPDYTDEAPNIWAAWYKTWWNRQPRVDGTINRYKRACENLGTPEANKALKQTV
FT                   YVQLFYLATLFTMAWNGYAIAAAVCWWLPRQLGLSWIRFFLSWAPHHPREGHTGRYDQA
FT                   YIFKSRIGHFFSMCMETHLIHHLYPGIPNHRTKAAYQEMKPVLEKRGVDCSAL"
FT   gene            complement(559472..560344)
FT                   /locus_tag="ELI_02585"
FT   CDS_pept        complement(559472..560344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02585"
FT                   /product="thiamine-monophosphate kinase"
FT                   /note="COG0611 Thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62609"
FT                   /db_xref="GOA:Q2NCI2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI2"
FT                   /protein_id="ABC62609.1"
FT                   /translation="MTNEFDFIARLRALATDPAARGLNDDAAVLEIGGQLLVVTHDMMI
FT                   EGVHWLQGQDMADVAWKLVAVNLSDLAAKGARPIGIIVGQTIPDEEERFLSGLRDALRA
FT                   FNVPLLGGDTVSAGQGRTALGLTALGSSVSGIVPGRDGAQPGDLLYITGPVGAAMMGFE
FT                   ALQAGTEDNSLAFRRPMPLLAEGAALAPHVSAMMDVSDGLLLDAWRLATTSGVTLAIDT
FT                   AEVPLGAPEERRDDALRWGDDYQLLFTASPTAELPARAIPIGTVEEGEPPLLVDGIAIF
FT                   EPEGLGYRH"
FT   gene            complement(560341..560718)
FT                   /locus_tag="ELI_02590"
FT   CDS_pept        complement(560341..560718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02590"
FT                   /product="transcription termination factor"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62610"
FT                   /db_xref="GOA:Q2NCI1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI1"
FT                   /protein_id="ABC62610.1"
FT                   /translation="MEKTPLARLLDEFHQHRLGREIEDGEHYADAEVDFFDDIVSGVDA
FT                   RSDEIDELVTAKLAAGWTLARLDKTMVQILRAGTYELIARADVPKAAAISEYVDVAKAF
FT                   FDDREAKFVNGLLDAVAKQVR"
FT   gene            complement(560784..562076)
FT                   /locus_tag="ELI_02595"
FT   CDS_pept        complement(560784..562076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02595"
FT                   /product="histidinol dehydrogenase"
FT                   /note="COG0141 Histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62611"
FT                   /db_xref="GOA:Q2NCI0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCI0"
FT                   /protein_id="ABC62611.1"
FT                   /translation="MQRLKNTDPDFEAKFAKIVEARRESSQDVGRDVFDILARVKAMGD
FT                   KALVEYTTRFDQHNLTNDNDWMIAPDQCKAAYDALDADLRDALQLAADRIQAYHEDQLP
FT                   HDRDYTDDAGVRLGAKWRPVDAAGLYVPGGRAAYPSSLLMNAIPAKVAGVERLAIVTPT
FT                   PKGETNPLVLAAAHIVGVDEIWRVGGAQAIGALAYGTDRIERVDVITGPGNAWVAEAKR
FT                   QLYGVVGIDMVAGPSEILVIADGKNDPDWIAADLLSQAEHDPTSQSILITDDADFAEQV
FT                   EDRVDVQSAMLATRKVARESWDAHGVLIVVEDLEQAIPLANRLAAEHVELAVDDPEALM
FT                   GKLHHAGSIFLGRMVPEAVGDYVAGPNHVLPTGRRARFASGLSVLDFMKRTSFISMDKA
FT                   GLEAIGPAAIKLAHAEGLPAHAASIELRLKT"
FT   gene            complement(562076..562771)
FT                   /locus_tag="ELI_02600"
FT   CDS_pept        complement(562076..562771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02600"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="COG0040 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62612"
FT                   /db_xref="GOA:Q2NCH9"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH9"
FT                   /protein_id="ABC62612.1"
FT                   /translation="MLFARSLPICAAMPQSQLTFAVPKGRILEEALPVMARAGVVPEDG
FT                   FHDKSNRALSFATSREDMRMIRVRAFDVATFVAHGAAQLGIVGSDVIEEFDYSDLYAPV
FT                   DLDIGHCHLAVAEPAESAGAIGSASHLRVATKYPNLTRRHFERMGIQAECVKLNGAMEL
FT                   APSLGLAGCIVDLVSTGRTLKENGLVETSRILDISARLIVNRAALKTDSRVAELVEAFR
FT                   ADADNRKAA"
FT   gene            562825..563871
FT                   /locus_tag="ELI_02605"
FT   CDS_pept        562825..563871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02605"
FT                   /product="hypothetical protein"
FT                   /note="COG4427 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62613"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH8"
FT                   /protein_id="ABC62613.1"
FT                   /translation="MDIKSLDEAIEWQAQHAEEGGAPGTAKVIRGLLAVSRTETATGRR
FT                   IANWQGLTLKDAMPLRINGGLHNLVLTGEDTRLGAVYGGLMTDQAAVDELVCELFESYD
FT                   ARLLPWLDGPPQTNEAGRSASLMAGLLWLAQHVPAQFEMLELGSSAGINTMMERYFFDL
FT                   GGVTTGPEASPMRIAPDWKGDPPPTTAPQIVSIRGCDVAPIDLSDPEAALRLKSYVWPE
FT                   AFERMGRIDAAVELAGQRPPDVVKQDAGSFVAEALAQPQDKGVTRVLFHSIVWQYIPDD
FT                   QQQAIRDAIDEAASKATPERPLAWVSLETNRKTFRHELHVTYWPGGAEPTLLACAHPHG
FT                   AWVEWWGG"
FT   gene            complement(563970..564881)
FT                   /locus_tag="ELI_02610"
FT   CDS_pept        complement(563970..564881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02610"
FT                   /product="Alpha/beta hydrolase fold"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62614"
FT                   /db_xref="GOA:Q2NCH7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH7"
FT                   /protein_id="ABC62614.1"
FT                   /translation="MEQVRVTLENRIELDVVDTGPRDGPALIFLHGFPESHRTWRRQIA
FT                   HFSDRYRCIAPDQRGYHGSSKPEGVENYTPDKLIGDVFLLADALAVERFTIVGHDWGGA
FT                   LAWGVAMRGQQNRVERAILCNAAHPLIYSKLLWTDAQQRAAGQYMRVYRDTSRDDEIRE
FT                   RGLLALLEGTENATGALPDDDSEERAAIFEDWSDGKAAIGMLNWYRATPMAVPPADAPL
FT                   EIPANAKLPKVPKLTIPTLVVWAMDDHALSPGNIERLEDHVEDLTLVRIEDCGHFLLWQ
FT                   EPEQVNAAMESFLATHLQPRSP"
FT   gene            complement(564887..565702)
FT                   /locus_tag="ELI_02615"
FT   CDS_pept        complement(564887..565702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02615"
FT                   /product="putative oxidoreductase/dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62615"
FT                   /db_xref="GOA:Q2NCH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH6"
FT                   /protein_id="ABC62615.1"
FT                   /translation="MSYDGQCWWITGASSGIGAALAKELGERGARVILSGRDEARLAEV
FT                   AGEIATETMTLPFDVRDEDAMLAATEKAIEWSGGVDGFVANAGVSQRSRATKTDMQVYR
FT                   DIIDIDLTAQIAATQALLPHLAARKSGSLLFISSIAGKVGVPMRTAYCAAKFGLAGYAD
FT                   ALRAELSQDGIGVHVIYPGSIATNVSRNALSADGSARGRSDDVIDNGIAPDEAAKTMLD
FT                   AVALNQREIIVAEGMEEAMGEMRRTPDQLFDQVAAMVANGYMEKMEADG"
FT   gene            complement(565721..566605)
FT                   /locus_tag="ELI_02620"
FT   CDS_pept        complement(565721..566605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02620"
FT                   /product="pirin-related protein"
FT                   /note="COG1741 Pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62616"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH5"
FT                   /protein_id="ABC62616.1"
FT                   /translation="MITETITPTTHDLGKFEVRRALPSKGRTMIGPFIFVDQFGPAQLD
FT                   IGSAMDVRPHPHINLSTVTWLFEGAIDHRDSLGSFSTIRPGQVNLMTAGKGIVHSERSP
FT                   QTERSRGPKLYGMQTWLALPDGKEEIEPDFEAIADLPVVEDEWARATIVMGDLWGKRAP
FT                   TTTHADTIYAEIVLAPTGTMPIDAEADERALMLVGGQASVDGHELGLYELTVLEPGRTM
FT                   RLASEQGGRIMLMGGEAFPTERHVWWNFVSSSKDRIRQASEDWKQGRFPTVPGDDEEFI
FT                   PLPEGKPKTVSYP"
FT   gene            complement(566602..567072)
FT                   /locus_tag="ELI_02625"
FT   CDS_pept        complement(566602..567072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62617"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH4"
FT                   /protein_id="ABC62617.1"
FT                   /translation="MIELQFQSRLAAPMERVWSDAVTMRGIAREMPPVARMKGPPEIDD
FT                   LRASGWAPGRVAVHSKLVAFGLLRIGSFDLMLTEVEEDLVNGRAHFVEQSQMTGMRSWR
FT                   HRREVAGDDAQCIVSDTLTFEPRLLPGLSRALIGWFFRQRHKRLRNMYGVAS"
FT   gene            complement(567069..567524)
FT                   /locus_tag="ELI_02630"
FT   CDS_pept        complement(567069..567524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02630"
FT                   /product="putative MutT/nudix-family hydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62618"
FT                   /db_xref="GOA:Q2NCH3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH3"
FT                   /protein_id="ABC62618.1"
FT                   /translation="MSATSPGRRVRRAARIIVLDPDDRVLLHRFVLSDRPPFWVTTGGE
FT                   CDPGESFEEAARRELKEETGIEADPGPQIAQQRPEFITVEGEPVRADERFFCVRVSDTR
FT                   ISTDGHTELEQRVMQEYRWFTRSELADWPEYIYPRDLAGLIDRDTGK"
FT   gene            complement(567521..567790)
FT                   /locus_tag="ELI_02635"
FT   CDS_pept        complement(567521..567790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02635"
FT                   /product="BolA protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62619"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH2"
FT                   /protein_id="ABC62619.1"
FT                   /translation="MASMQTEIENRLTEAFAPTRLEVINDSAKHHGHAGDDGSGESHFT
FT                   VAMESAAFEGVSRLQRQRRVIAALGDIVGERVHAVAIKASAPGE"
FT   gene            567843..568436
FT                   /locus_tag="ELI_02640"
FT   CDS_pept        567843..568436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02640"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /note="COG2214 DnaJ-class molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62620"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH1"
FT                   /protein_id="ABC62620.1"
FT                   /translation="MRTSRFHGRYEAEGRVCDHPACDEPGEFRAPGGYGNSFDGPGEWR
FT                   WMCLDHIREFNAGYDWFEGMSADEILAAQSPASGWQTETRAFKPTAGVDGMPRWADFDD
FT                   PLEAIGARAAGIKSRAQREAEMAMDGRFSQDEAKALETMGLGLKTDRRLLRRRYSELVR
FT                   RYHPDRNGGDRKYEARLNRVVEAYQLLRESKALA"
FT   gene            complement(568433..568912)
FT                   /locus_tag="ELI_02645"
FT   CDS_pept        complement(568433..568912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02645"
FT                   /product="hypothetical protein"
FT                   /note="COG3865 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62621"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCH0"
FT                   /protein_id="ABC62621.1"
FT                   /translation="MADSKLALCLWLDQGAEEAANFYCDLFPDSDITRVDRSPSDWPAG
FT                   KAGDVITIAFTLLGLPAMAMNGRPGDGPNDALSLQVFTDTQEETDRYWAALTEGGGEMA
FT                   CSWCYDRYGVRWQVVSRVLMDGLGHDDPEVRGRVFTAMQDMVKIDHAGIERAIAG"
FT   gene            complement(568905..569531)
FT                   /locus_tag="ELI_02650"
FT   CDS_pept        complement(568905..569531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02650"
FT                   /product="hypothetical protein"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62622"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG9"
FT                   /protein_id="ABC62622.1"
FT                   /translation="MADFTFYTVAMSRGQIARWALHEAGADYNTEMMTWETRPKSFRAI
FT                   NPMNKVPALVHHHNGHDHVITECAAICHYLAETHPGPELAPTFEEKADYLRWLFFAAGP
FT                   LEQAVVAKSMGWEVPEDRSGMAGFGSFDLTIDALDSWLTDRQFVCGDRFTMADVYVGSQ
FT                   VDWGLQFGTLPERDSLTAYRERINARPAKQEANAIDMAAMEPADG"
FT   gene            complement(569535..570317)
FT                   /locus_tag="ELI_02655"
FT   CDS_pept        complement(569535..570317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02655"
FT                   /product="hypothetical protein"
FT                   /note="COG3324 Predicted enzyme related to
FT                   lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62623"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG8"
FT                   /protein_id="ABC62623.1"
FT                   /translation="MADKHGDFVWYELMTPDPDAAQAFYGDMLCWQFEEAGFNGQDYRS
FT                   FSAGDAQIGGILKLTPPMIEHGGQPSWVGYIRVDDVPETVGKVRDAGGHVFMEGGEVPD
FT                   VGPFAMLADPQGAPFYVIDDRSGQPSHAFSKHEPKVGTCAWNELITADPDAADAFYTTQ
FT                   FGWTKGDAMEMGPMGTYQMYEHGDYGLGAIMQKPDEIPASLWAFYFRAPDIDEALEKAT
FT                   AGGAQIVNGPMEIPGGDHVFQGVDPQGALFSIIGSKGA"
FT   gene            complement(570330..570686)
FT                   /locus_tag="ELI_02660"
FT   CDS_pept        complement(570330..570686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02660"
FT                   /product="hypothetical protein"
FT                   /note="COG5507 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62624"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG7"
FT                   /protein_id="ABC62624.1"
FT                   /translation="MYIQGFLVPVLSGKKDAYLAMAKDAGEMFQRYGAIEIVEAFEEDI
FT                   PEGKHTDFRKAVKAEDGEHIVFSWVIWPDRATCDAAARAMEENEEMEPSEDMPFAGPRL
FT                   IYGGFTPIYTLGRD"
FT   gene            complement(570746..571600)
FT                   /locus_tag="ELI_02665"
FT   CDS_pept        complement(570746..571600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02665"
FT                   /product="hypothetical protein"
FT                   /note="COG3662 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62625"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG6"
FT                   /protein_id="ABC62625.1"
FT                   /translation="MPPRSNTPNPAEFLRQQLVGRVRAVFNDVDSGQQPVPPSDNALFE
FT                   KNSPIRMVHADVVGMMVGGIRGLLLQMLHPHALQGVLDHSNFRSDMHGRLRRTARFIAV
FT                   TTFGHRDEAMKQIERVNRIHAKVTGTLPDGTAYTATDPRTLAWVHVVEAQSFLAAYLRH
FT                   VQPDMPGHEQDEYYRQFAVIARALGADPVPLDRNEAEAIFRELRQDLRASPEAREIADL
FT                   VLTQRPEGAPAAVQAVMGSEAVALLPAFARSMLGLERPGLAALPARAATWGMGKTLRWA
FT                   FRQ"
FT   gene            571695..572684
FT                   /locus_tag="ELI_02670"
FT   CDS_pept        571695..572684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02670"
FT                   /product="MoxR-like ATPase"
FT                   /note="COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62626"
FT                   /db_xref="GOA:Q2NCG5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG5"
FT                   /protein_id="ABC62626.1"
FT                   /translation="MNDMTDKSFEPNAKTTLSEPDTTVNVRETFGIDVDWDVPAFSKAD
FT                   ERVPDFDENYVFDPDTTLAILAGFAHNRRVMVQGYHGTGKSTHIEQVAARLNWPCIRIN
FT                   LDAHISRIDLVGRDAIVLRDGLQVTEFREGLLPWALQHPVALVFDEYDAGRPDVMFVIQ
FT                   RVLETEGKLTLLDQNRVIRPDPNFRLFATANTVGLGDTSGLYHGTQQINQGQMDRWNIV
FT                   VGLNYLPADTEQEIVTAKNPDTDPEVISKMIKVADLTRQGFINGDISTVMSPRTVITWA
FT                   QNAAIFENVGMAFRLSFLNKCDEAERMLVAEYYQRVFGEDLPESVVKA"
FT   gene            572723..574852
FT                   /locus_tag="ELI_02675"
FT   CDS_pept        572723..574852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02675"
FT                   /product="penicillin-binding protein, 1A family protein"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62627"
FT                   /db_xref="GOA:Q2NCG4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG4"
FT                   /protein_id="ABC62627.1"
FT                   /translation="MNSPWFRKLTPWRRDPGRPQGAYAGYFSRADQEPLYRSGSPQPDF
FT                   DRWDNRLDRLDGAVEREERRKQRWWQPAYWRERRKRWWIVRFFAAALMAFLALIAFLAL
FT                   TTPLDKSLEPVVPPQMTLLAADGTPIARNGAIVGEPVSVETLPPHVVEAFLAIEDRRFY
FT                   DHWGVDPRGIARAAWTGVGGGSTITQQLAKFTFLSPERTLTRKAREALIAFWLETWLTK
FT                   DEILERYLSNTYFGDNVYGLRAASLHYFYRQPEKLTLEQAAMLAGLVKAPSALRPTKHY
FT                   ARAEERMKLVVASMVAAGYLTEAEAARVSAPKLDVRTRSDLPTGTYFADWALPMLRRDA
FT                   ETGYEAQTITTTLDARLQGIASRIVQRANLGGAQAALVAMRSNGEVVAMVGGKDYQESP
FT                   FNRVTQAKRQPGSTFKTFVWLAALEAGADPTDPVDNTEITQGSYRPRNYGERYSGSLTL
FT                   EQAFARSSNVAAVRLYNSVGDEAVIRTARRLGVTSPLPPGDPSMALGTSTMTLLELTAA
FT                   YAGIAANAYPVRPTPLPVQEQGWWEWLWDGPESFSGRVHDDMQQMLRAAVNSGTGRAAM
FT                   LAGPNYGKTGTSQDNRDALFVGYAGDLVVGVWIGNDDNSPLNGVTGGGLPARMWRDFMR
FT                   QAQGASSAGDTPRANPSGPVQPMDVPELEDVPLGEGVRLEDGGLNIETEIEGIPVDIRV
FT                   TPDGVEMAPGSEPDG"
FT   gene            complement(574849..575256)
FT                   /locus_tag="ELI_02680"
FT   CDS_pept        complement(574849..575256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02680"
FT                   /product="hypothetical protein"
FT                   /note="COG2050 Uncharacterized protein, possibly involved
FT                   in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62628"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG3"
FT                   /protein_id="ABC62628.1"
FT                   /translation="MANDLAVITPYAASLGIAVHGDEDGIPILHVGGEEITEGRPGFYH
FT                   GGAISGLLETAGYAALRVALDAEGRKVQIKPINMTVQFLAPAKAAPLYAKARITKLGRR
FT                   NANIAVECWQDDRERPRATAIMNVLLAESAG"
FT   gene            complement(575246..575692)
FT                   /locus_tag="ELI_02685"
FT   CDS_pept        complement(575246..575692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02685"
FT                   /product="hypothetical protein"
FT                   /note="COG2050 Uncharacterized protein, possibly involved
FT                   in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62629"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG2"
FT                   /protein_id="ABC62629.1"
FT                   /translation="MATGFDPEKAAAFVLRHGHSGWLDMQFRGIGDDWAELELPWREDL
FT                   VGEPDRHVLASGPIISLMDMASGLAIWTRMKRFQAIATLDLRVDYQRPARERHHVIGRA
FT                   ECYRLTRSAAFVRGVAHDGDPEDPVAHIAAVFMSLPGRASRDGQ"
FT   gene            complement(575722..576225)
FT                   /locus_tag="ELI_02690"
FT   CDS_pept        complement(575722..576225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02690"
FT                   /product="hypothetical protein"
FT                   /note="COG0816 Predicted endonuclease involved in
FT                   recombination (possible Holliday junction resolvase in
FT                   Mycoplasmas and B. subtilis)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62630"
FT                   /db_xref="GOA:Q2NCG1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG1"
FT                   /protein_id="ABC62630.1"
FT                   /translation="MAEPGRLITESALEYGDALPDGGVLLALDLGTKTIGTATSDAGWR
FT                   FATAGKTLPRGRFGKDKAKLQEIVSSRNVAGLVLGLPRNMDGSEGPRAQASRAYARNLA
FT                   EAFGLPVLLWDERWSTQSAESAMIGQDMSRAKRAEKIDSHAAAIFLQAALDTLAGGGLS
FT                   NDLL"
FT   gene            complement(576204..577346)
FT                   /locus_tag="ELI_02695"
FT   CDS_pept        complement(576204..577346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62631"
FT                   /db_xref="GOA:Q2NCG0"
FT                   /db_xref="InterPro:IPR021440"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCG0"
FT                   /protein_id="ABC62631.1"
FT                   /translation="MVRKFLYFVAGIAILVVAGGFVLNIWSRELTELALVPSTEFVEQD
FT                   PLADNAYQDPEMWFSRPGKGTDDPARWQPALREGERAVPLPSEGDTPDFAVFFVHPTSF
FT                   TERAAWNAPLDDEEANDRARLFIRGLASPFNRASEIWAPRYRQATVGAFLSDSEDAQSA
FT                   LDAAYADVAQSFAFFRDSVDEDTPIVIAGHSQGALHLLRLMREEIAGKPIADRVAAVYV
FT                   VGWPISVERDLPELPFPACATPDQAGCILSWSTYAEPADPSDLLEAYSGSTGFDGQPRG
FT                   ESTILCTNLLTGGIGGSAPAVRNLGTLVPEDSLENGELVPSYVPARCDSRGLLLVGPPP
FT                   EMGNYVLPGNNYHVYDIPLFWRNLQEDVVARVEAWQSPAA"
FT   gene            complement(577336..578484)
FT                   /locus_tag="ELI_02700"
FT   CDS_pept        complement(577336..578484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02700"
FT                   /product="predicted permease"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62632"
FT                   /db_xref="GOA:Q2NCF9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF9"
FT                   /protein_id="ABC62632.1"
FT                   /translation="MSERDNTDYSDPDHVEDLGASPSYIDNPQLRLEAYRAGIWVGVAG
FT                   LAFLAVYISQSLLVIFGGLVFAAMIDGGARLMGRVAPLPRPVRVIAVLLLVVVFLAWLS
FT                   AFAGSQIAQQAATLPAIIQGQATEVFEWAQANGLGVKEADLQAIAGQLASGVGTVTRAL
FT                   TGLAGGLTSAVLIVIIGLYVALDPNLYERGVEWMAPRQNRRELHVTLVKMAYTLRRLMA
FT                   GRLVGMLIEGIFTYIMLTVVAQLIGIGTVPMAALLAILTGLLAFVPNIGAIVSGVLMIT
FT                   VGFSGGYDMGIYTLVVYFLVQNVDGYIVIPMIAKKTVDLAPALVLGFQLIMGILFGILG
FT                   LFLADPLMAMIKVALERRSEQNEIKQARAREARLATQDTDGS"
FT   gene            complement(578481..579371)
FT                   /locus_tag="ELI_02705"
FT   CDS_pept        complement(578481..579371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02705"
FT                   /product="signal peptidase I"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62633"
FT                   /db_xref="GOA:Q2NCF8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF8"
FT                   /protein_id="ABC62633.1"
FT                   /translation="MTTSTPTQVTDTDIKKSEEKVNWFAELRGLGLMLFAVLMFHSFVA
FT                   KPFYIPSQSMMPNLLVGDRLVVTKYPYGYNWSSVSFHLLPRGDWRVFGSTPEYGDIVIP
FT                   VHPERNEDYIKRVVGLPGDTIEVRDGRIILNGTEVRREMEPSLDLPFDLNNDCSEMEFE
FT                   VVATQGGEEACRVPTYRETMPNGVSYLIIDAPDVLGLESYPATVIPDDHVFVMGDNRDH
FT                   SADSRAPVSPIGGGLGGPVPLANIGGRAEFITFSLDGTANWNPFSWWSALREGRAWSTL
FT                   RPAKAETTATADGET"
FT   gene            complement(579368..579769)
FT                   /locus_tag="ELI_02710"
FT   CDS_pept        complement(579368..579769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02710"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62634"
FT                   /db_xref="GOA:Q2NCF7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCF7"
FT                   /protein_id="ABC62634.1"
FT                   /translation="MIIGLGSDLCNIERIQNSLDRFGERFENRVFTEIERAKARRRPFT
FT                   IAGTYAKRFAAKEAFSKAVGTGFRRGVFMKDIGVVNARSGAPTLALTGGAAIRLAELLP
FT                   DGHEASIHLTLTDDHPWAQAFVIIEAHRI"
FT   gene            complement(579894..580610)
FT                   /locus_tag="ELI_02715"
FT   CDS_pept        complement(579894..580610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02715"
FT                   /product="pyridoxal phosphate biosynthesis protein"
FT                   /note="COG0854 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62635"
FT                   /db_xref="GOA:Q2NCF6"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF6"
FT                   /protein_id="ABC62635.1"
FT                   /translation="MNIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRH
FT                   IRDEDLARIQAATDLPLNLEMAATEEMLAIALRHQPHAACIVPEKREERTTEGGLDAAG
FT                   LHNTLVPIVDKLREADIRVSLFIEADERQLDAALRLGAPVVEFHTGEYAHAHLDGDRDK
FT                   TASELKRIADMSALAAKNGIEPHAGHGLTYENVQPIAAIPQLAELNIGHYLIGEAVFVG
FT                   LENAVRRMRELMDDAR"
FT   gene            complement(580646..581227)
FT                   /locus_tag="ELI_02720"
FT   CDS_pept        complement(580646..581227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02720"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="COG0461 Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62636"
FT                   /db_xref="GOA:Q2NCF5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCF5"
FT                   /protein_id="ABC62636.1"
FT                   /translation="MTDEEVLSEFRASEALLEGHFMLSSGRHSGHYLQCARVLMNPERA
FT                   GRLAMALAQKLPRELRGEIDVVVSPAMGGLIIGHEMGRALGKDAIFLERPDGEFHLRRG
FT                   FRLEPGAKVLMVEDVVTTGLSSREAIEAVKREGGEVVAEVSLVDRSAGEADLGVPYYAL
FT                   VEINFPTFANGEVPEGLARIPVTKPGSRAK"
FT   gene            581413..582525
FT                   /locus_tag="ELI_02725"
FT   CDS_pept        581413..582525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02725"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62637"
FT                   /db_xref="GOA:Q2NCF4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF4"
FT                   /protein_id="ABC62637.1"
FT                   /translation="MGSVEKMITATRLRETTHAIALLFAALLLAFGAQAALATIAAPTQ
FT                   PDATTPESAMPGETDPVTAEEAAAADSSIPGYEPLGPEMIKGQPTAFEDDALKSMTFQD
FT                   QYNANGEYALWMHDAILMPIITIISLFVLGLLLWVVVRYRRGANPVASKTTHNTLIEVV
FT                   WTVIPIIILLVIAVPSISLLAKQYETPPKDAITIKATGYQWYWGYTYPDQGGFEIISNM
FT                   LDEADAMDRGLPGQLAVDNRMVVPVGVPLRIQTTAADVIHSFALPSLWFKNDAVPGRIN
FT                   EKMLIIDEPGIYYGQCSELCGARHGYMPIAVEAVPMDQWRAWVIGQGGSFEDAEVAADA
FT                   REEVINAQDGDAAATDAASTEGGSDAAAAE"
FT   gene            582570..584273
FT                   /locus_tag="ELI_02730"
FT   CDS_pept        582570..584273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02730"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="COG0843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62638"
FT                   /db_xref="GOA:Q2NCF3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF3"
FT                   /protein_id="ABC62638.1"
FT                   /translation="MATTAEGFDVHTDDHAHDADHKPGFFARWFMSTNHKDIGTLYLLF
FT                   AIVAGLVGGTMSGVMRAELAEPGIQYLGWWVEFFGGEASFDTNLHMWNVFITAHGLIMV
FT                   FFMVMPAMIGGFGNWFVPLMIGAPDMAFPRMNNISFWLTVAGFLSLCFSLFVPGGTGLG
FT                   AGVGWTVYAPLSTTGSQGPAVDFAIFSLHLAGAGSILGATNFITTIFNMRAPGMTLHKM
FT                   PLFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTTFFDPAGGGDPVLYQHLFWFFGH
FT                   PEVYIMILPGFGMVSQIVATFSRKPVFGYLGMAYAMVAIGVVGFIVWAHHMYTVGLSVN
FT                   TKMYFTAATMVIAVPTGVKIFSWIATMWGGSMEFKSPMVWALGFIFLFTVGGVTGVVLA
FT                   NGGIDDNLHDTYYVVAHFHYVLSMGAVFSIFAGFYYWFPKMSGRWHSEFLSHVHFWLFF
FT                   IGVNIVFFPMHFLGMQGMPRRYPDYTAAYAYWNEIATMGYYVVFASVIVFLVNIGYALV
FT                   AGRRAEANYWGEGATTLEWSLSSPPPFHQYETLPVIEDHHDYHHQLPSKG"
FT   gene            584386..585309
FT                   /locus_tag="ELI_02735"
FT   CDS_pept        584386..585309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02735"
FT                   /product="heme O synthase"
FT                   /note="COG0109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62639"
FT                   /db_xref="GOA:Q2NCF2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCF2"
FT                   /protein_id="ABC62639.1"
FT                   /translation="MTTAASPAALPADWRDFFALTKPRVMTLVIFTGICGLLAAPGAIN
FT                   PILGFTAILCIAMGAGGSAALNQWWEADIDAGMKRTAKRPLPSGRMQATDARDFGILIS
FT                   VASVGIMGIAINWLSAIILAAAIVYYAVIYTIWLKPRTPQNIVIGGGAGAFPPMIGWVA
FT                   VTGEITLMPVLLFAIIFMWTPPHFWALALFVKTDYEKVGIPMMPVVKGEASTRRQILVY
FT                   SILLIPFAVAPWAIGATGAIYGVSALLLTGAFAALSVPVATRRQIEGDTMKPEKRLFGF
FT                   SILYLFALFAALVADRYLTPLIESAA"
FT   gene            585306..585431
FT                   /locus_tag="ELI_02740"
FT   CDS_pept        585306..585431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62640"
FT                   /db_xref="GOA:Q2NCF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF1"
FT                   /protein_id="ABC62640.1"
FT                   /translation="MTPEEQAEIERRRKTRNLALGGVLLFFVVLFYAITIVRMGD"
FT   gene            585434..586018
FT                   /locus_tag="ELI_02745"
FT   CDS_pept        585434..586018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02745"
FT                   /product="putative cytochrome c oxidase assembly
FT                   transmembrane protein"
FT                   /note="COG3175 Cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62641"
FT                   /db_xref="GOA:Q2NCF0"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCF0"
FT                   /protein_id="ABC62641.1"
FT                   /translation="MATAPQDNFVERQNLKVGLYAFLGALFMLGMGYAAVPLYDLFCRV
FT                   TGFGGTTQQASEADAAIAERMAAVAGAPEISIRFDASIARGMPWEFKPAQATDTVRIGQ
FT                   RDLAFYTAKNNSDQPITGTATFNVEPEQAGIYFNKIQCFCFTEQTLQPGEDVRMPVLYF
FT                   IDPAAMEDEDMDGVEQITLSYTFHQKKERGE"
FT   gene            586096..586959
FT                   /locus_tag="ELI_02750"
FT   CDS_pept        586096..586959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02750"
FT                   /product="cytochrome C oxidase subunit III"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62642"
FT                   /db_xref="GOA:Q2NCE9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE9"
FT                   /protein_id="ABC62642.1"
FT                   /translation="MAGAKNHDYHILEPDIWPLIGSISALTFTTGMVLFMHEMPSWQIV
FT                   LGLGIAGLIATFFSWWSNVVKEAHRGDHTPVVQLHMRYGMILFIASEVMFFVGWFWAFF
FT                   DFALFPAPIRELSDNVWENLIGQEGAAALATFPPEGIEVLDPFSLPLLNTLILLCSGTT
FT                   VTWAHHALLHGDRDGLKKGLWATVALGALFTAIQAYEYGLAPFGFGGNTYSSAFYMATG
FT                   FHGFHVLVGTIFLIVCLVRAYKGHFTPRQHFGFEAAAWYWHFVDVVWLFLFVAVYIWGG
FT                   WGAPVH"
FT   gene            587046..587627
FT                   /locus_tag="ELI_02755"
FT   CDS_pept        587046..587627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02755"
FT                   /product="hypothetical protein"
FT                   /note="COG3346 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62643"
FT                   /db_xref="GOA:Q2NCE8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE8"
FT                   /protein_id="ABC62643.1"
FT                   /translation="MPKFPLIPTVLVLAAVATMMALGVWQLGRADEKEALIARYQSVAS
FT                   DAPRVAWPKTDLAVTERLYQPSSFSCTDVIARRTTAATSAAGAKGLAQIATCRIDGGGE
FT                   AEVVLGFTRQPDEGSWVGGEVTGVIAPGPRLVASPPLAGLEPIARPDPSDLPNNHLAYA
FT                   GQWFFFALTALVIYVLALRRQQAGARREGD"
FT   gene            587821..589224
FT                   /locus_tag="ELI_02760"
FT   CDS_pept        587821..589224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02760"
FT                   /product="threonine synthase"
FT                   /note="COG0498 Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62644"
FT                   /db_xref="GOA:Q2NCE7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE7"
FT                   /protein_id="ABC62644.1"
FT                   /translation="MRYISTRGSAPTLSFEEVTLTGLASDGGLYLPQGWPSFSADDIRA
FT                   MRGQPYAEIAARVMAPFVGDSLSFEELRGLTEEAYGRFSHAAVVPLVQLDHQHWLMELF
FT                   HGPTLAFKDVALQMLGLLFETFLARRGEQLTLVGATSGDTGSAAIDAVAGRDGVEIFML
FT                   HPQGRISDVQRRQMTTVRAPNIHNIAISGSFDDGQAAVKRMFTDTEIAGKIRLGAVNSI
FT                   NWARLMAQVVYYFTTAVQLGAPERSVAFSVPTGNFGDVFAGYVASKMGLPVEQLIVATN
FT                   VNDILHRALSDGDYSAGTVTPTAAPSMDIQVSSNFERLLFDVGGRDGAVMAEQMRGFET
FT                   SKAMQLTNSQREGAATRFTSVRVDQDAMAHSMRRAFENSGEVIDPHTAIGLYAAYQADI
FT                   APDVPIVTLATAHPAKFRDAVERATGTRPPLPTRVGDLFAREEACTELSGDYDELTDFI
FT                   LTNAAQAHG"
FT   gene            589202..590101
FT                   /locus_tag="ELI_02765"
FT   CDS_pept        589202..590101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02765"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG1092 Predicted SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62645"
FT                   /db_xref="GOA:Q2NCE6"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE6"
FT                   /protein_id="ABC62645.1"
FT                   /translation="MPRRLMAELVRAPQLMVGEGWEDYALLDSGEGRKLERFGPYRFIR
FT                   PEPQAMWTPQDTDWQADGEFIPGADEDGGGRWHLSGDVPEEGWPLSWREAQFSASCTPF
FT                   RHLGFFPDMAPVWDWMREQLAGKPEAQNMNLFGYTGVGTQALSQCGPVTHVDASKKSVA
FT                   QARENAELAGMQDRPIRWLTDDAAKFTAREVRRGNRYDGIILDPPKFGRGPKNETWRIE
FT                   EGLSPLVRDCRALLDADSRFLFLTVYAVRMSSLSLAGLLDEVFAGLPGTVEHGDLAVQE
FT                   QGSGRLLPTAIFARWSNA"
FT   gene            590218..590589
FT                   /locus_tag="ELI_02770"
FT   CDS_pept        590218..590589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02770"
FT                   /product="hypothetical protein"
FT                   /note="COG1539 Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62646"
FT                   /db_xref="GOA:Q2NCE5"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE5"
FT                   /protein_id="ABC62646.1"
FT                   /translation="MADALTLEFDDIEHDVLTGIYSEETGRPQPLRISIAVDYKVADRY
FT                   DPDTPLEASKNYMDLKFAATEALPEGLHFKLIESLADHICETLFLQDEQVLAVTVKIVK
FT                   LAIAEKNEKIGITLRRERR"
FT   gene            590591..590941
FT                   /locus_tag="ELI_02775"
FT   CDS_pept        590591..590941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62647"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE4"
FT                   /protein_id="ABC62647.1"
FT                   /translation="MAQAVLRVDSLPASAVEAANTFHTEYLPQAVDLLEGDADNLVIVM
FT                   PAAFYDHADWRRALARDLARAHTPIRVNVIGSDDPDAVTAALAYCDKARGVTGHYLPLN
FT                   SLGAGDPLASSG"
FT   gene            590951..591949
FT                   /locus_tag="ELI_02780"
FT   CDS_pept        590951..591949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02780"
FT                   /product="probable molybdenum cofactor biosynthesis
FT                   protein"
FT                   /note="COG2896 Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62648"
FT                   /db_xref="GOA:Q2NCE3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCE3"
FT                   /protein_id="ABC62648.1"
FT                   /translation="MAASELIDTFGRRISYLRLSVTDRCDLRCTYCMPERMQFLPRAEV
FT                   LTLEELRDLAVGFMRRGITKIRLTGGEPLVRRDVVDLIRALGRHVGDGLEELTLTTNGT
FT                   QLAGHAQAIADAGVKRINISLDTLDRATFQRLSRRDALASVLGGIAAAKAAGLKIKINT
FT                   VAMKGVNGHEIPALIEWAHGEGHDVTLIETMPLGEVDEDRTDQFLPLVAVRESLEARWT
FT                   LTDSDHRTGGPSRYVEVAETGGRLGFITPLTNNFCAGCNRVRVTATGQLYPCLGGGERV
FT                   DLRAALRSDDPDSNLSTALDTAMKIKPERHDFRIGEGEEPALARHMSMTGG"
FT   gene            591951..592193
FT                   /locus_tag="ELI_02785"
FT   CDS_pept        591951..592193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02785"
FT                   /product="hypothetical protein"
FT                   /note="COG1977 Molybdopterin converting factor, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62649"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE2"
FT                   /protein_id="ABC62649.1"
FT                   /translation="MAITILFLGPLRDLAGEQEREVAAPLDWQGLLESVGPQVADQLQQ
FT                   DRVNVACAGTVLADKTALAALDGDEVALLPPVSGG"
FT   gene            592186..592656
FT                   /locus_tag="ELI_02790"
FT   CDS_pept        592186..592656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02790"
FT                   /product="molybdopterin converting factor, subunit 2"
FT                   /note="COG0314 Molybdopterin converting factor, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62650"
FT                   /db_xref="GOA:Q2NCE1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE1"
FT                   /protein_id="ABC62650.1"
FT                   /translation="MARLTLKTPADVRLLDKGLSAGEALAAFNASNPEAGAIATFAGKV
FT                   RPDGGVQALELSHYELLTLPGMKKLAADALTRFECAGLLIWHRVGVMTPGETIVLVAAA
FT                   APHRRAAFEAVDFCMDYLKSASWFWKREKRGGEWHWIEPRPEDYADRKRWER"
FT   gene            592736..593179
FT                   /locus_tag="ELI_02795"
FT   CDS_pept        592736..593179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62651"
FT                   /db_xref="GOA:Q2NCE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCE0"
FT                   /protein_id="ABC62651.1"
FT                   /translation="MSELLTRDLIADKAIIYDTHPVDPRTNAPRGFFDQTFELPARLFA
FT                   ASLALFVAFLAVMTVGFGNPELILPMAIFGIFFAGFYGIPVLFVRQAPNESNTGQSWRE
FT                   FKAQGVQTLTGRLPASEAAIQMLILPVLILAWGIACVTIAALV"
FT   gene            complement(593176..593871)
FT                   /locus_tag="ELI_02800"
FT   CDS_pept        complement(593176..593871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02800"
FT                   /product="transcriptional activator protein FnrL"
FT                   /note="COG0664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62652"
FT                   /db_xref="GOA:Q2NCD9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD9"
FT                   /protein_id="ABC62652.1"
FT                   /translation="MNLACASCPVRERAACAVLTEAERGELARAGRTVKLKRGEMLFAA
FT                   GDEDHACATLLRGALKVSAVDREGEERILALIHPAGFVGELFQPFAHHDVVALTDCELC
FT                   VFARREMEAALERHPALARAMLRRSQDDLHAARELLELTGKQDAATRLAGLIMAMARAA
FT                   SDSPCHPSQAFDLPLTRGEMAQMLGLTIETVSRRMSKFEKDGLIAKKGARGIELVDPAR
FT                   LEALVGVGL"
FT   gene            complement(593868..594383)
FT                   /locus_tag="ELI_02805"
FT   CDS_pept        complement(593868..594383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD8"
FT                   /protein_id="ABC62653.1"
FT                   /translation="MPISRTALPLFAALGLGACASAGEDYPSLAIRDAERQSGSFTPAE
FT                   SEAAAPVEPDPPAPELLDRLVQLQSQAQSAHRAFVALAPAASRRVEAARGAGLASDRWA
FT                   EAQIAISELDSQRSLTAVPMADLDELLVRRAIELEQRAEIVEAQAQVQALLEEEDAVLR
FT                   RLKGALAR"
FT   gene            594577..595128
FT                   /locus_tag="ELI_02810"
FT   CDS_pept        594577..595128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02810"
FT                   /product="ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62654"
FT                   /db_xref="GOA:Q2NCD7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD7"
FT                   /protein_id="ABC62654.1"
FT                   /translation="MEVKPMFAVVRTGGKQYRVAAGDKIAVEKLAGEAGETVVLDDVLL
FT                   AGEGDEMADASKVTVSAEVIAQAKSEKVVVFKKRRRHNYRRKAGHRQQMTLLRITDIGE
FT                   GSKKKAAPKKETAKKADTGDGAAVETKKTAKEGKKAATKTASDKPVAKKAAPKKTAATK
FT                   KAPAKKPAAKKAAPKAADKK"
FT   gene            595141..595410
FT                   /locus_tag="ELI_02815"
FT   CDS_pept        595141..595410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02815"
FT                   /product="ribosomal protein L27"
FT                   /note="COG0211 Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62655"
FT                   /db_xref="GOA:Q2NCD6"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCD6"
FT                   /protein_id="ABC62655.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGRRLGVKKFGSEAVVAGNIIVRQRGTKF
FT                   YPGSNVGMGKDHTLFALEDGVVRFHTGKQARKYVSVDAMAEAAE"
FT   gene            595608..596141
FT                   /locus_tag="ELI_02820"
FT   CDS_pept        595608..596141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02820"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="COG1670 acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62656"
FT                   /db_xref="GOA:Q2NCD5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD5"
FT                   /protein_id="ABC62656.1"
FT                   /translation="MFHRSERLFLRPPFAEDWKAVLGGIADEGVVRNLSRAPWPYAATD
FT                   AQSFVAMDIAPKHPRFLITRARDAALIGCIGIDAQGVDTELGYWIARPFWGQGFATEAG
FT                   RAVLEIAQALGHTRIVASHFLDNPASGKVLSKLGFQPTGRIVERHSCGRGEPAATAEYA
FT                   LDLREMPTVTRVAA"
FT   gene            complement(596318..597193)
FT                   /locus_tag="ELI_02825"
FT   CDS_pept        complement(596318..597193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02825"
FT                   /product="FF domain protein"
FT                   /note="COG3687 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62657"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD4"
FT                   /protein_id="ABC62657.1"
FT                   /translation="MNAHTTIAADGATPTPDDLEITVRDRRFARGIKARRWWLNNDPVA
FT                   SAWFNALSATFPRGEAFFIESVKAFRDGADPKLTAEIRAFVRQEINHTREHVAFNRLAE
FT                   DQGYDIKAIDKRVEEMLAQLKDRPQILNLAATMALEHFTAMLGHELLKNPAHLEGADGD
FT                   LGDLWRWHSAEEVEHKGVAYDTWLHATHDWSRFKRWKVKTLMMLLVTVRFIKHRSEDTM
FT                   ELLAQDGLTGWKWRFKLAHYLLVKPGFLRRIIPGWLAYFMPGFHPWNEDDRALINLYEG
FT                   DFEDALLPAE"
FT   gene            597337..597942
FT                   /locus_tag="ELI_02830"
FT   CDS_pept        597337..597942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02830"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62658"
FT                   /db_xref="GOA:Q2NCD3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD3"
FT                   /protein_id="ABC62658.1"
FT                   /translation="MATRKRLSPEESRATAIQAARALLIEAGPQAVTLKAVGARVGRTH
FT                   ANLLHHFGSAAGLQRDLAAHLAQTVCESVAEAVLATRAGLGSPREIVDIAFDAFEREGG
FT                   GALVSWMLATGHEDAIEPFVETIHSMVDDLNPEEDGHEDAMIAHRVTHTVVLLALGQSL
FT                   IGEPLAKSLRLPDSVARDMAERIIDEDLVGRHQLAEGN"
FT   gene            complement(598102..598842)
FT                   /locus_tag="ELI_02835"
FT   CDS_pept        complement(598102..598842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02835"
FT                   /product="predicted aminomethyltransferase"
FT                   /note="COG0354 Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62659"
FT                   /db_xref="GOA:Q2NCD2"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD2"
FT                   /protein_id="ABC62659.1"
FT                   /translation="MPEATTPTRLFDRAVIRLSPSDASGDVADFLQGLVTNDVKGTLPA
FT                   YAGLLTPQGKALFDFIVWPSGKGELLVDCEADLADEFAKRLSLYRLRRKIEIARDDSVA
FT                   VHWQPHIGDGAANDPRLADLGQRWLAPVSDADESADEAWRKHRLSLGVPEGRAEMGDIL
FT                   WLETNAVELNGVSFGKGCYVGQENTARMNWRQKINRRLVVVPLDTADEKRIKARHEDLG
FT                   LAISHLRIDDIPPQHVPDWVTLEE"
FT   gene            598878..599693
FT                   /locus_tag="ELI_02840"
FT   CDS_pept        598878..599693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02840"
FT                   /product="Patatin-like phospholipase family protein"
FT                   /note="COG1752 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62660"
FT                   /db_xref="GOA:Q2NCD1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD1"
FT                   /protein_id="ABC62660.1"
FT                   /translation="MRFDFEQVVFSGGGIRCFWHGGFLSVAGDVLQLAPQRISGVSGGV
FT                   LSGAAWVAGRENRLLDVMGEAFKRNDENFDADKSNFTPHQEMYRQVVSDTLDGDAVDAI
FT                   CEGPDFQAMLAVPPQWLPPRFFVLLSGSAYGAEKKLRSRPHLKWARRIGLQPLRVDVRE
FT                   AAREGKLVDLICAAATIPPVFDVPEWEGLRVLDGGMIDKAPPPEPDEGRTLFLMTTRYR
FT                   NLPQTGRCLYLQPSAEVAADKIDFSDRTKLDRTWRQGALDGTAWVKENG"
FT   gene            complement(599690..600571)
FT                   /locus_tag="ELI_02845"
FT   CDS_pept        complement(599690..600571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02845"
FT                   /product="hypothetical protein"
FT                   /note="COG0189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62661"
FT                   /db_xref="GOA:Q2NCD0"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCD0"
FT                   /protein_id="ABC62661.1"
FT                   /translation="MHIGFLTCPGTHPGSPDRRSDAYEHDLQVDAIRPELEVRGHSLVE
FT                   IDWRSPVEAFADLPLILIGTPWDYQDSEAQFLARLDALEAAGHRVCNSAATVRWNACKI
FT                   YLRDLAGSGVATIPTLWVAEPRAADIERAFDAFATDSVVAKRQIGAGAEGQSLHRKSGL
FT                   NPDWQMAQPAMLQSYIPQIRSDGEYSFLFVEGTFSHALRKRPAHGDYRVQSVYGGTEEA
FT                   IDPGALDLAAAQAAVDAIPFATPLYARIDMVRGDGGGLLLMEAELIEPYLYPMQGPKLG
FT                   AMLAEAIDRRLA"
FT   gene            600639..601673
FT                   /locus_tag="ELI_02850"
FT   CDS_pept        600639..601673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02850"
FT                   /product="Dihydroorotase"
FT                   /note="COG0418 Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62662"
FT                   /db_xref="GOA:Q2NCC9"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCC9"
FT                   /protein_id="ABC62662.1"
FT                   /translation="MTETLTIRRPDDWHLHFRDGAMMRGVVPYTARQFARAIVMPNLTP
FT                   PVTTTALGAAYRERILAAVPEGVDFRPLMTAYLTDETDADDLIDGYTHGVFTAAKLYPA
FT                   NATTNSASGVTDVEALYPVFERMAAAGMVLCIHGEVTDADVDVFDREKEFIERTMAPLH
FT                   AAIPALKIAFEHITTSDAVDFVVGANDNIGATITPQHLHINRNAMLVGGIQPHNYCLPV
FT                   AKRETHRLALRQAATSGPPKFFLGTDSAPHEKHTKESACGCAGIFGAPYALESYLAVFE
FT                   EEDALDKFEAFASLNGPAFYGLPVNDETITLERVPHNVPDSLETEGGKVVPFHAGQELN
FT                   WRLK"
FT   gene            complement(601713..602627)
FT                   /locus_tag="ELI_02855"
FT   CDS_pept        complement(601713..602627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02855"
FT                   /product="rarD protein"
FT                   /note="COG2962 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62663"
FT                   /db_xref="GOA:Q2NCC8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC8"
FT                   /protein_id="ABC62663.1"
FT                   /translation="MNPTPIPQPSGLPAALGAYIIWGFLPLYLIIVSAVPPFELVGWRI
FT                   IWTLPVCVLIVLVRRQWPELRAALGNRRVLLVLLGSSALIATNWFVYTWAIYEKQVYAA
FT                   SLGYYINPLLNVLLGTLVLREKLSRAQWLAVGLAAIGVAVLATGALTTLWISLTLAFSF
FT                   GTYGLLRKQVPVGSLPGLTIESALLLLPACGIAAWYAGTPGGSSFGVTPWLSFWIMMGG
FT                   VFTAIPLLMFAVAAKRMDYSQLGFIQFLAPSIVFVLGLTVFRQELLLAQAICFAFIWTA
FT                   LAIFVWDMWAKSRAPAKAGASGR"
FT   gene            602833..603321
FT                   /locus_tag="ELI_02860"
FT   CDS_pept        602833..603321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62664"
FT                   /db_xref="GOA:Q2NCC7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC7"
FT                   /protein_id="ABC62664.1"
FT                   /translation="MQMKIKAAALAIAASGMAATTPVVAAPASHGAPTTYSAFAAETGV
FT                   NETAQHHRRWHRGGHGNRGYDDRGRYDDRRYYDDRRYRNNAYYDEPVYRDTRIWRDRRD
FT                   GQYYCRKKDGTTGLLIGGAVGALAGREIARDRTLGAIVGGAAGALLGRSIDRGNARCR"
FT   gene            603513..604244
FT                   /locus_tag="ELI_02865"
FT   CDS_pept        603513..604244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62665"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC6"
FT                   /protein_id="ABC62665.1"
FT                   /translation="MRKATPLAVLTILAACSGETEEPPIVRERDPATVQALNHQIMTDP
FT                   DLAGLNEANAALTGGFDHSLPPIVDTPEAIDAARREAAEIVGGSSNLADLGQPEASDAN
FT                   LPEVARFVVTELARVTVGTEVCAAQASYTASWAARMPQQFPIYPRGNVIEAAGSDDAAC
FT                   SLRAIRFLTPVPREDLFAFYAARAKAAGLPARYSETGDFHRMEGAKGARKFAVVARQRA
FT                   SGISEVGLVTTGFGKAATSLP"
FT   gene            complement(604231..605646)
FT                   /locus_tag="ELI_02870"
FT   CDS_pept        complement(604231..605646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02870"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62666"
FT                   /db_xref="GOA:Q2NCC5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC5"
FT                   /protein_id="ABC62666.1"
FT                   /translation="MSQNEIISFDPATGEELWRRKVGDVDAAVEIARKAWPAWAAKPLA
FT                   TRIELCRRFANEVRAASDKLAELISKETGKPLWESRTEVEAVINKVDISVTAYAERTGQ
FT                   KKLDSALGGTAAVRHKPHGVMAVLGPYNFPAHLPNGHIVPALIAGNVVIFKPSEKTPAT
FT                   GELLMECFHKAGISAAVAQFLPGGPEEGKALVAHRDVDGVLFTGSAQAGIAINKKLATN
FT                   PGKIVALEMGGNNPIVVTDTPLVTDAAILIVRSAFTTAGQRCTAARRLIVTESMYQPIV
FT                   EEVKRLADRLIVGEPFAEPAPFMGCVIDNDAADQLVESFLYFLSNGGKAIKHMTRADDD
FT                   LPFLSPAIIDTTAMDDRPDVELFGPLLQVIKVPDLEAGIAEANNTRFGLSASLIGGSPQ
FT                   DYNRFWASVRAGIVNWNQPTNGASSKAPFGGLGLSGNHRPAAYYAADYCAYPVASSELD
FT                   QPRASVGVGFKEG"
FT   gene            complement(605758..607161)
FT                   /locus_tag="ELI_02875"
FT   CDS_pept        complement(605758..607161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02875"
FT                   /product="hypothetical protein"
FT                   /note="COG0397 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62667"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC4"
FT                   /protein_id="ABC62667.1"
FT                   /translation="MRSEPQASAYRPERAIESIAVWLASPVAAADFPRATLRFRNDRWA
FT                   QTVGLASLSDDEWVQHFARFEPLPDNLPEPLALKYHGHQFRVYNPEIGDGRGFLFAQLR
FT                   DGEGRLLDLGTKGSGVTPYSRTADGRLTLKGAVREILATEMLEALGANTSKTFSVVETG
FT                   EELERGDEPSPARSAVMVRLSHSHIRIGSFQRLLVEEEPTHMAALVDYCLQHFPGPPPP
FT                   VDAPGRDEPAVRLMHQVVERMADLAASYMVAGFVHGVLNTDNMNITGESFDYGPWRWLP
FT                   AWDPGFTAAYFDHAGLYAFGRQPEALHWNCGQFAVALRALVEAEPLLAAINRFGELYMA
FT                   AIGRRWCWRLGLQSRGPDADAALVAACEKALREEQCEPSAFFHRHRGGREAEGELGEAM
FT                   AGYTPVEGALDHDYWRENAPESMLIDEVETLWSAIEQRDDWAPLYDKIARLRRMGAAHG
FT                   EPPVPAGHT"
FT   gene            607259..608137
FT                   /locus_tag="ELI_02880"
FT   CDS_pept        607259..608137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02880"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62668"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC3"
FT                   /protein_id="ABC62668.1"
FT                   /translation="MTSTATETAWADRFWESEDGLTLHYRDYPGDDTRLPALCLHGLTR
FT                   NARDSGELAARIAPQRRVLVPDMRGRGDSDYAKDSASYNPPQYVADLERLLAGQGIARF
FT                   IAIGTSLGGLMTMLMAAENATRIAGAVLNDIGPVIEADGIEKIRTYVGQGRSFDTWVQA
FT                   ARALKDVHGEAHPTFQLEDWLAMAKRVMVLGQGGRISFDYDMAVADPFNAADSNAAPPD
FT                   MWPAFEALAQAPLLLVRGDRSNLLSAASVAEMQKRAADMQVVTIADTGHAPLLTEPPAL
FT                   AAIDAFLERLP"
FT   gene            608134..609285
FT                   /locus_tag="ELI_02885"
FT   CDS_pept        608134..609285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02885"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62669"
FT                   /db_xref="GOA:Q2NCC2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC2"
FT                   /protein_id="ABC62669.1"
FT                   /translation="MSRPANAPPRILHLHSTFAPGGKELRCVQLINAFGPALHHAIVSA
FT                   EPNEMGAAQHLSQRAKVSYPQDFPSLTGKPLPGRLNRLAQAMKPYDMVLTYNWGAMDAV
FT                   MAHTLFKDALGLPPLIHHEDGFNEDEQKKLKWSRNLYRKLALGKANGLVVPSETLEQIA
FT                   LETWEQPIGRVRLIPNGIDTKAFAKKPKRDALRRIIKRPDEKWVGTLAGLRPVKNLPAL
FT                   VRAFAALPEPWQLVIVGDGPEADAIREEAERLDLSPRVHLPGFAPDPARYIGLFDIFAL
FT                   SSHSEQFPISVVEAMAAGLPVAAPAVGDIAHMVAEENAGLITRPGSDAELGEALRELAQ
FT                   DEAKRKIIGAANQAKAREHFDQKAMIATYRRLYSSALGQEIAG"
FT   gene            609407..610219
FT                   /locus_tag="ELI_02890"
FT   CDS_pept        609407..610219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62670"
FT                   /db_xref="GOA:Q2NCC1"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC1"
FT                   /protein_id="ABC62670.1"
FT                   /translation="MALPPANTPPATPKPEDEKKARLKAAQDEAALREIDEAVRQDQYA
FT                   EFGRTYGRPLLVLLVVGLAAFGGYLWWDGQREAALEQDSEVLVSALDQIEAGNLQTGTE
FT                   TLEPLTTSDNAGAQAAALMLQAGIAAQQGDLARAATLFGQVANNSDAPPAYRDLATVRQ
FT                   VALQFDRLEPAEVIQRLSAIAVPDNAFFGSAGELVAMAHLEKGDRAAAGKLFGEIAKSD
FT                   DAPQSLRSRARQMAGMLGVDAIEDVDEVLEEAGADTSATSVQGTGVAQ"
FT   gene            610234..611640
FT                   /locus_tag="ELI_02895"
FT   CDS_pept        610234..611640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02895"
FT                   /product="hypothetical protein"
FT                   /note="COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62671"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCC0"
FT                   /protein_id="ABC62671.1"
FT                   /translation="MGTTGLDRKNSMMATKRGFAQDFAHRLMLKAGAAAMLALSVGACS
FT                   GGLFGGGDDDTTPTLGNRVPVLSRIETGAQVDPSLAGTAVVLPPAQVNSEWTMAGGNAA
FT                   KSYGHLAISDNPTRAWSAEIAGASNRLRFGAAPVVGGGSLFAVDTDGVVHAFDATSGAR
FT                   RWQHRLDVDKDARKSAFGGGAAYAGGRVYATNGVGEVVALNAENGAELWKVKPAGPLRG
FT                   SPTLAFNLVIVMTQDNQVIALDANDGAIEWQESGSQAQSGLFGVASPAAAQGSVIAGYS
FT                   SGELSAYRYENGRTLWADALARTSISTSVGSLTDIDADPIIDGGRVYALGQGGRMAAYE
FT                   LVTGQRVWELNLAGVSTPAIAGEWIFTLTDDARMLAIARGTGRVRWITQLARFKDEEDR
FT                   DGPIFWTGPVLAGNSLYVASSEGEIWRLSTGEGSAQLFQDIKEPVSVPPIVANRTLYIL
FT                   DDSGTIHAYR"
FT   gene            611802..613088
FT                   /locus_tag="ELI_02900"
FT   CDS_pept        611802..613088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02900"
FT                   /product="putative membrane protein"
FT                   /note="COG2020 Putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62672"
FT                   /db_xref="GOA:Q2NCB9"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB9"
FT                   /protein_id="ABC62672.1"
FT                   /translation="MLGLALWILFCRNYVPIADALGIPGPRGPLSGPYASLAAMLFTSV
FT                   PMVVWSLLVDKVHLRPSTGIDWSNPKPASEIMHISTVKIAGIWATWAIIAGLYCLGRWY
FT                   WNGQYLFAMEVLIQALVPMLMLSVPYIVWLDRRMVEPRDHAWHFGAMLLGREAYDPDEV
FT                   KKHWRAWIIKGFFGAFMISILPGGFQQIVEADLSALAANPAAFALFLITLLFVVDVQIG
FT                   TVGYLVTFRPLDAHIRSGNPFLGGWVAALLCYPPFVFGFMGGDGILAYEVNTPGWQHWF
FT                   AGNTFLLSLWGGWLVFLTAVYAWATVVFGIRFSNLTYRGVLTNGPYRFTRHPAYLSKNL
FT                   FWWSATLPFLVSADGSLVDMIRNIFFLGVVSAIYYWRAKTEEAHLLGEDPKYRAYFDWM
FT                   GEHGLITEPLTRLKRKLRPRGPVLQHPAE"
FT   gene            complement(613206..614075)
FT                   /locus_tag="ELI_02905"
FT   CDS_pept        complement(613206..614075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62673"
FT                   /db_xref="InterPro:IPR021655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB8"
FT                   /protein_id="ABC62673.1"
FT                   /translation="MPQVDPKTQIRVPVKPVPRVQARPSATAQKQVATANTNVLRPGIR
FT                   IMDFDNTRQGDYRVRFIVPDIAGQPASEIIVERKGKCGWTETSFDGSRAPRTDDRHAKC
FT                   RIDFAKYSAAVAALANAAPASRHFYELRVDKYDRAKEGYAQFISQPVMVVVRGPGSRVT
FT                   RHRLDVLANAAAAPAAAKVDSDGDGFSPYSAGGTDCDDNDASRYPGNTEIPNQADEDCD
FT                   PRTIGTLDRDGDGFIDWTISNPAFGNRSSPMKGRDCNDSDPEIRPTKPEDFTDGIDNNC
FT                   DGAVDHYP"
FT   gene            complement(614367..614675)
FT                   /locus_tag="ELI_02910"
FT   CDS_pept        complement(614367..614675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02910"
FT                   /product="hypothetical protein"
FT                   /note="COG1359 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62674"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB7"
FT                   /protein_id="ABC62674.1"
FT                   /translation="MIQINGTIQLAPGTVADNPDTVEAIKTMVAASRAEDGCLTYTFAQ
FT                   DLSDPDSLVIYERWRDQEALAAHGQSAHMAEFQKVMAANPPVTRDLRVYETDEGQPL"
FT   gene            complement(614707..616077)
FT                   /locus_tag="ELI_02915"
FT   CDS_pept        complement(614707..616077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02915"
FT                   /product="glutamate-cysteine ligase precursor"
FT                   /note="COG3572 Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62675"
FT                   /db_xref="GOA:Q2NCB6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB6"
FT                   /protein_id="ABC62675.1"
FT                   /translation="MSTREDSGADEPIIESRDQLVAPMQAGEKPKDRWRIGTEHEKLVY
FT                   KRDGFRAPSYDEDGGIRDILLEMQQFGWQPVEEDGKVIALKGEDGAVSLEPAGQLELSG
FT                   APLENLHQTCNETGRHLTQVKAIGEKCGVGFLGLGMWPDKTREELPVMPKGRYDIMMRH
FT                   MPRVGSLGLDMMLRTCTIQVNLDYSSEADMAKKFRTSLALQPLATALFANSPFTEGKPN
FT                   DFLSYRSHIWSDTDPHRTGMLPFVFEDGFGYERWTDYMLDVPMYFVYRDGKYIDAAGHS
FT                   FRDFLDGKLSVLPGEKPRPSDWWDHLSTAFPEVRLKSFLEMRGADGGPWSRICALPALW
FT                   VGLLYDDSALDAAWDLVKDWSMEEREALRNAVPRLALDAPIPGGHRLQDLARDVLKIAR
FT                   QGLTARARLGESGDNETGFLSTLDEIVETGKVPAQRLLDMYHGEWGGDIKRVYKYSF"
FT   gene            complement(616276..617058)
FT                   /locus_tag="ELI_02920"
FT   CDS_pept        complement(616276..617058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02920"
FT                   /product="hypothetical protein"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62676"
FT                   /db_xref="GOA:Q2NCB5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB5"
FT                   /protein_id="ABC62676.1"
FT                   /translation="MPEPIAAGTAVTVDGNAAHYLGKVMRVSAGDAVILCDDATGEWAC
FT                   KVTDVEKRIVTLEPVEKLREREQVPDFWLCPALLKKDRFDLVLEKATELGVRAIRPVVT
FT                   RRCVADKLNAERARAIVTEAAEQCARTALPELAEPVKLDSLLRDWPEDRALFFADELGG
FT                   APAGEAFVTYSESLRRQGPQAGKDPHLDDQAARGPRLRGGAALLIGPEGGFDDAERKAI
FT                   RAHPQARAITLGPRILRGETAAIAATALWMGTVGDWDA"
FT   gene            617220..618140
FT                   /locus_tag="ELI_02925"
FT   CDS_pept        617220..618140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02925"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /note="COG0382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62677"
FT                   /db_xref="GOA:Q2NCB4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB4"
FT                   /protein_id="ABC62677.1"
FT                   /translation="MRTMSDIAPNIVPDTEHRGLVARLPQVPRDLAQLARFDRPIGWWL
FT                   LFWPCVWGVWLTGAGWQLAMLGWLLLGSIAMRGAGCVYNDIVDADLDRKVARTASRPVA
FT                   SGRVSKKLAWGWLLALCAIGLLVLLQLRLEAQVVALASLALVAAYPFMKRITWWPQAWL
FT                   GMVFTWGLLVGWTQFRTDNLDALAALYAGAALWVIGYDTIYALQDREDDAMVGIKSSAL
FT                   RLGSSVKTGVALFYGGTVALWALGFWLLRADWIALLTLVPVAAHLAWQVATLDADDPVN
FT                   PLERFRSNRWAGALMAAACFVVGTA"
FT   gene            618289..621039
FT                   /locus_tag="ELI_02930"
FT   CDS_pept        618289..621039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02930"
FT                   /product="DNA helicase"
FT                   /note="COG1199 Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62678"
FT                   /db_xref="GOA:Q2NCB3"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB3"
FT                   /protein_id="ABC62678.1"
FT                   /translation="MPAIPLPALHASHAGTWLREANRDTQSCSKGEAINAAADTPVLML
FT                   NAPLVATRLGYPDLSGLDLLELFAFVHPAKFCVPTPKGLAHALDLEEPAGDDAVPELLQ
FT                   RAAGKLLETCESSEWAEREGAWSVLQSLARLRWPWAGVLAPHVAKPERAEKWLFSRLPE
FT                   WEEVPERPQPAQVNLAEAEVEAQLARLTGEGAEKRDGQRAYAKDVGGVFAPREKRKQPH
FT                   VLLAQAGTGIGKTLGYLAPASLWADKAQGTVWVSTYTKNLQRQLRGESRRAWPSRRADG
FT                   SRPVVVRKGRENYLCLLNLEDALQGGFAGRPAVLAQLVARWAAYSADGDMIGGDLPGWL
FT                   GTLFRKRGITALTDQRGECIYAGCPHYRKCFIERATRASAQADLVIANHALVMINAARG
FT                   RHHGQPPTRILFDEGHHVFDAADSTFAAALTGQEAIELRRWIIGPEKGNRGRRRGLAAR
FT                   LADVASYDDAGGEAVEAAVEAAQNLPSDGWIARLVEGTPFGPVEALLGQVRALTYARDE
FT                   SGAQDAGYGIETEVASLPGPLIEAAQDAQVALAAIRSPLMTLGGRLEAVLEDAPDWLDG
FT                   QGRARIEGARHSLRWRIDLLAAWESLLARLGGPADPDFVDWFAVDRNEAREFDIGIHRH
FT                   WLDPMKPFAHVVLEPAHGVMLTSATLTDRGETGEDWQGAIAASGAPHIELQPKTSSAQS
FT                   PFDYASRAEVLIVTDIKRGDLAALAGGYARIVEAAGGGVLGLFTAIKRLRAVYGRIADR
FT                   LARAGLPLYAQHVDPIDTGTLTDIFRDDRKASLLGTDALRDGVDVPGESLRCVVLEAVP
FT                   WPRPTILHRARRAANGGGAYDDRLIRARLAQAFGRLIRSREDAGHFIVLSSAFPSRLLS
FT                   AFPPGTPVTRLTLDGALERVAAGPPNADRAKEVAGTLPREETPDI"
FT   gene            621050..621577
FT                   /locus_tag="ELI_02935"
FT   CDS_pept        621050..621577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02935"
FT                   /product="hypothetical protein"
FT                   /note="COG2062 Phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62679"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB2"
FT                   /protein_id="ABC62679.1"
FT                   /translation="MKTLGLLRHAKSDWDDMSKRDFDRGLNARGRRGAALMGAHIREGE
FT                   QSWDVVLASPAERVKRTLESAELGVSPQFDQRLYLSSAETMIDVVQEKAGDADSVLIVA
FT                   HNPGMQEMLLKLIAPSNENALFDEASVKFPTAAYAVIELDIESWKELGGEDGTLTLFTR
FT                   PRDLDAELGPEH"
FT   gene            complement(621585..622097)
FT                   /locus_tag="ELI_02940"
FT   CDS_pept        complement(621585..622097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62680"
FT                   /db_xref="InterPro:IPR025514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB1"
FT                   /protein_id="ABC62680.1"
FT                   /translation="MGLVLATAMSAAPALAQDASTQGSASVAIAEPLSITKVRDLDFGQ
FT                   IIPNGTGIARVRINSSNGNRSANANATLIGTRGDRATFTVVGEPRTQVNLSVAGPVISL
FT                   SGPGATITVDRLRASRNNGGQRSLPRTFRIPRSGSMTIGFGGRLNAAPDQAPGIYSGDF
FT                   ELTVVYQ"
FT   gene            complement(622234..622782)
FT                   /locus_tag="ELI_02945"
FT   CDS_pept        complement(622234..622782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62681"
FT                   /db_xref="InterPro:IPR025514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCB0"
FT                   /protein_id="ABC62681.1"
FT                   /translation="MKNRIASLLRRSALVLILAMGFAMPAQANSDDALGSANVTIASPL
FT                   QITNTQGLDFGQLIPTGGGVAVATINARNGARSANANMTLHGAQGDRATFTVVGEPLST
FT                   FQVLVAGPVIFLSGPGLTMTVDRLRVSANGGPQQLFASSFVVPLSGTMELGVGGRLTAS
FT                   PTQARGVYSGNFTVIAVHN"
FT   gene            complement(622928..623371)
FT                   /locus_tag="ELI_02950"
FT   CDS_pept        complement(622928..623371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02950"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62682"
FT                   /db_xref="GOA:Q2NCA9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA9"
FT                   /protein_id="ABC62682.1"
FT                   /translation="MKANDLLPIGELARRTGLSVSAIRYYEDKGLVEALRTGGNQRRFL
FT                   RGDIRRLSFILIAQRLGLSLAEIEDQLARLPQGRNPTARDWKRISTAIRGQLDARIAEL
FT                   ERARDRLDGCIGCGCLSLKHCALYNPDDALAAEGAGPRHVLDP"
FT   gene            623515..623886
FT                   /locus_tag="ELI_02955"
FT   CDS_pept        623515..623886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02955"
FT                   /product="glyoxalase family protein"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62683"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA8"
FT                   /protein_id="ABC62683.1"
FT                   /translation="MPTGTLEHANVTVSDPDRSSQLMQDLCGWHERWRGKSQFGGNTIH
FT                   VGDDAHYIAFYTSGAVAERYAKGQPLNHLAVVVDDLDGAEKVVADAGLEPFGHDDYDPG
FT                   RRFYFFDWDGIEFEVVSYR"
FT   gene            complement(624057..624857)
FT                   /locus_tag="ELI_02960"
FT   CDS_pept        complement(624057..624857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02960"
FT                   /product="putative membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62684"
FT                   /db_xref="GOA:Q2NCA7"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA7"
FT                   /protein_id="ABC62684.1"
FT                   /translation="MDTNLTAVLCLAFVINLIGALAYAARIAGVRTGRIAMSFALFNVL
FT                   LLVSRLSNGFLAPLVAKRVENSLTGRIATNLESDFRLILLSAFIGVLAGLVMVPTAQRV
FT                   FVRAIEAVQPRQSLAKTLLRGVSPGGLRILRTSLSMPARASVGKEKPRELTWGILAANG
FT                   VAQALLVVGVFAAIYAGYLNPEYRVTASQLSAVVNGFATILLFLFIDPHLSVLTDDVVD
FT                   GKQSEPSFRRAVAWISLSRLGGTLLAQALFLPAAIAIVWVADLI"
FT   gene            complement(624903..625679)
FT                   /locus_tag="ELI_02965"
FT   CDS_pept        complement(624903..625679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02965"
FT                   /product="hypothetical protein"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62685"
FT                   /db_xref="GOA:Q2NCA6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA6"
FT                   /protein_id="ABC62685.1"
FT                   /translation="MFDAIAPLAADLLPFILVGFAAQIIDGALGMAFGVITQTMLVSAL
FT                   GVPPATASASVHLVEVFTTGTSGASHLWRKNINWPLFWRLVPAGVIAGVLGAYVLSNVD
FT                   ASAAKPVVMLYLAAIGVFLFYKAIFFGRWPRFQDPRFTRPLAFIGGFLDSAGGGGWGPV
FT                   VTSNLLVQGGDPRTTIGTVNSAEFLLTLAVSITFLATLGVSAFSHAVIGLIIGGVAAAP
FT                   IGAILTSRINARLLLFMVATVLTATSLFTVARSWIL"
FT   gene            625996..626643
FT                   /locus_tag="ELI_02970"
FT   CDS_pept        625996..626643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62686"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA5"
FT                   /protein_id="ABC62686.1"
FT                   /translation="MSKHPDPHSFDPAGDTAGDASPNLSSLELTPAHAKGWTPRRQAVF
FT                   LRELAATHNVSAAARAVGMSRQSAYRVRARLQGQPFDLAWQAAFRTRFDALAEKALQLA
FT                   MEGTEVPHFHQGELIHTSRRHDTRLMLGLLALKDRLRRSPPSSREPAFAYDGDDLGELI
FT                   ARVEEGPERWRDGLDEEYAAKRERAPREGEEENEFLLEVVDYEEEFGSGGEP"
FT   gene            626831..628471
FT                   /locus_tag="ELI_02975"
FT   CDS_pept        626831..628471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02975"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COG1384 Lysyl-tRNA synthetase (class I)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62687"
FT                   /db_xref="GOA:Q2NCA4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA4"
FT                   /protein_id="ABC62687.1"
FT                   /translation="MSMQDLMNAARVSKAWPFQEAQRLLKRYPDGKPGGEPVLFETGYG
FT                   PSGLPHIGTFQEVLRTTLVRRAYEAIIGARPEDGKTRLVAFSDDMDGLRKVPDNIDRKD
FT                   VLEANLHKPLSRIPSPFSNEHDSYAAHNNAKLREFLDRFCFDYDFVASSDMYNSGQFDE
FT                   ALKQVLRKNQDILDIMLPTLRAERAATYSPVLPISPETGRVLQVPVEVVDAETGIVRFT
FT                   DEDGTVVEQSALGGMAKLQWKVDWAMRWYALGVDYEMYGKDLTDSGVQSGRIVKVLGGR
FT                   KPEGLIYELFLDEKGEKISKSKGNGLTIEEWLTYGTEESLGFYIFPNPKSAKQLHVGVI
FT                   PRAVDDYWQFRERIPEQELEKQLGNPAWNLLRVNGDWPEGDRVAEAPGAGDSLPVTYGL
FT                   LLNLASVLGAEATEQNLADYLDTYLDGAERGPELDALIACAVAYTRDYIVPTLNKRAPA
FT                   PNEAAALHELDTFLAEADPAMSAEDLQTQVYEIGKKEEYGFESLRDWFKALYQTLLGTD
FT                   QGPRMGSFIKLYGMTNTRRIVGEALARSD"
FT   gene            628517..629599
FT                   /locus_tag="ELI_02980"
FT   CDS_pept        628517..629599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02980"
FT                   /product="sensory box histidine kinase"
FT                   /note="COG2202 FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62688"
FT                   /db_xref="GOA:Q2NCA3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NCA3"
FT                   /protein_id="ABC62688.1"
FT                   /translation="MPLKGEISAQAGREFDTSRLDLRAIIDPRDLRVDPTRLFLETTQQ
FT                   TRLAICISDPHQPDCPVVYVNQAFLDLTGYAREEIVGRNCRFLQGADTDPEQVRKLREG
FT                   IAAERYTVVDLLNYRKDGIPFWNAVHVGPIYGEDGTLQYFYGSQWDITDIVAERRKAET
FT                   QRRIAAELRHRTGNIFAVLNAIIGLTSRRERDVSEFADKLSERVSALASAHRMTIMDEP
FT                   DQEAVAIDDLVTGVMKPYRNRFAERVTTSGPKIELGPRSVTALGLALHELATNAVKYGA
FT                   LSVDAGRVEISWSREDGDVTLVWQEQGGPTVSQEQSEPVKGNGTMLIDGMIASLTGSIE
FT                   RDFAAAGLQAKITLPVHQPE"
FT   gene            complement(629615..630283)
FT                   /locus_tag="ELI_02985"
FT   CDS_pept        complement(629615..630283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62689"
FT                   /db_xref="GOA:Q2NCA2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA2"
FT                   /protein_id="ABC62689.1"
FT                   /translation="MTTTTTVPDKDALARVGKMVRKRLEADPKAYKVPTDKAEIFAIGE
FT                   FLTASECKKLMMMIDIVAQPSTLYEGTYKDGFRTSYSGNFDGRDPFIQAISRRIDDALG
FT                   LPTKLGETMQGQRYMTGQQFKPHHDFFYPTEDYWKAERKRGGQRSWTAMLFLNKVEKGG
FT                   ATNFTNVGINIEPKPGVLLCWNNATPEGIPNEDTLHAGTPVEQGVKYVITRWYRTRKWG
FT                   "
FT   gene            631602..632213
FT                   /locus_tag="ELI_02990"
FT   CDS_pept        631602..632213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02990"
FT                   /product="Flavin Mononucleotide Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62690"
FT                   /db_xref="GOA:Q2NCA1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA1"
FT                   /protein_id="ABC62690.1"
FT                   /translation="MTPKAGAMLEPPKSLEDVRLDIATRLNRAVKDRRSPMHTPAVATA
FT                   DADIRIMVLRAYDRETQSLRFHTDIRAPKSRVIGDGAPVGVLFYDKGAKIQIRCRGEGR
FT                   IEQDSEIADAAWASSTNFARRCYLGDGPGAPSEAATSGLPPELEGVQPEDDQILPAREN
FT                   FAVLLVKVEQFDWLFLAHTGHMRAQFQGPLDGATARWVAP"
FT   gene            632268..632681
FT                   /locus_tag="ELI_02995"
FT   CDS_pept        632268..632681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_02995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NCA0"
FT                   /protein_id="ABC62691.1"
FT                   /translation="MVIPAAVAIQLAPAQTAELPRTRLEQRVRRTPSERVIEMQRPRPN
FT                   ADRDALLQARAELDAAYRARRIDSRAYAEANFRNAVALRLLEDSLRSADDGEKLGNFDI
FT                   QNLMNVYNRSNTTASTVTKKVDDTANAVIGKVG"
FT   gene            complement(632878..633327)
FT                   /locus_tag="ELI_03000"
FT   CDS_pept        complement(632878..633327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62692"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC99"
FT                   /protein_id="ABC62692.1"
FT                   /translation="MDRMPRTPSRLDRSVSDWLEAEGIVAPSSPGNIADTARVRALLIA
FT                   AAREERVVSYSEMLGLLGHRFTRPKMRALCATLDAIDETARAHCEPGLAVLVVRESDGL
FT                   PGQGWWTGNAGRHEHNGPWKGAEAKRLVEWIQAEVFAYWRQRPSP"
FT   gene            complement(633411..633821)
FT                   /locus_tag="ELI_03005"
FT   CDS_pept        complement(633411..633821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03005"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases 2"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62693"
FT                   /db_xref="GOA:Q2NC98"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC98"
FT                   /protein_id="ABC62693.1"
FT                   /translation="MTIDYVLKRGDGEIVGDTAQTGPQDVQLGSGQIFPQIESALTGME
FT                   VGDEKSVDIACEDAFGQRQEQLVIDIPRANLPPEPAPQPGMQLNAQTPEGQPMVLTILE
FT                   VGDEAVKADGNHPLAGEDVTFDVTLRDIKQAA"
FT   gene            complement(634050..634175)
FT                   /locus_tag="ELI_03010"
FT   CDS_pept        complement(634050..634175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC97"
FT                   /protein_id="ABC62694.1"
FT                   /translation="MGIAAPNIDGERQEDQEIGRWVRNQGERAVAPKTPQRRAIA"
FT   gene            634188..635924
FT                   /locus_tag="ELI_03015"
FT   CDS_pept        634188..635924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03015"
FT                   /product="cold-shock dead-box protein A"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62695"
FT                   /db_xref="GOA:Q2NC96"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC96"
FT                   /protein_id="ABC62695.1"
FT                   /translation="MSFENLPPVLGESLAERGYSAPTPVQAAVTAPDAKGRDLIVSAQT
FT                   GSGKTVAFGLALADELLAEIGGTPLAEKPLALVVAPTRELALQVSRELGWLYAKAGLRI
FT                   ATCVGGMDASKERRALRSGPAIVVGTPGRLRDHLERGALDLSGLVGVVLDEADEMLDMG
FT                   FRDDLEEILDAAPDGRRTLLFSATLPQQIVRLAQRYQTDALRLSLAGENRGHGDIAYQA
FT                   ISVAPSEIENAVVNLLRFHEAETAICFCATRDSVRRLHATLQNRGFGVVALSGEHSQSE
FT                   RNQALQALRDRRARVCVATDVAARGLDLPTLSLVIHVEIPRDAETLQHRSGRTGRAGKK
FT                   GTAAIIVPYNRRKRVESMLRGAKIAAQWMDAPSAKDIRQQDQARLMEKLTTPTEYDEDD
FT                   RALASKVMDRMAPEDIAAALVQAHRAKLPQPEELLANTPEARAKSKAEKHRPGFEDTVW
FT                   FRMGIGRRQNAEPRWLLPLICRRGHITRNEIGAIRIGQHESWFQIPRAVAPRFADAVSR
FT                   TASGDDEQDAIVIEESAEGPRMEARQNRKHGGPAARAKPFRKGPGGKGGKRKPSSPPRK
FT                   RG"
FT   gene            635974..636321
FT                   /locus_tag="ELI_03020"
FT   CDS_pept        635974..636321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62696"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC95"
FT                   /protein_id="ABC62696.1"
FT                   /translation="MPYPTLFDEPLGFCPFPCALVAEPLAVGAAGLVDGIQRLAQRPHL
FT                   VPGKAMAEQAQHLGIAHRPLLPRRRDQQRTDAGGVSDIAGGGGRDQPFGFEPFGEGVIE
FT                   GWWQLLTFFDP"
FT   gene            complement(636301..637137)
FT                   /locus_tag="ELI_03025"
FT   CDS_pept        complement(636301..637137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62697"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC94"
FT                   /protein_id="ABC62697.1"
FT                   /translation="MAKKTGYRDSVVSFVDVLGFRSLLLEKSDPNEISDIIRKVRGNLH
FT                   PDEDDRRLTRGGDRKFSKPYGFSLSDAVVRIRPYDTVFRDGALFYEILDLMYAQAAMVW
FT                   EGIMLRGAVTVGKAYSHKTNDMAFGPAVVEAYEWESTRAVYPRIVVTDHAIDEYHADPR
FT                   LKGDSEISETLKLLKRGDDGLYFIDYLGGMQGEFDEFESYLELLRRHKALIDRGLSAAA
FT                   NGTAVRQKYRWSAIYHNRQVTEHAEAVSDPERAAMFYSQTGFDGPDYFNSLRIKEG"
FT   gene            complement(637147..638820)
FT                   /locus_tag="ELI_03030"
FT   CDS_pept        complement(637147..638820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03030"
FT                   /product="ABC transporter"
FT                   /note="COG0488 ATPase component of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62698"
FT                   /db_xref="GOA:Q2NC93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC93"
FT                   /protein_id="ABC62698.1"
FT                   /translation="MSAQYAYVMKNMTKSFPGAQKPVLTNINLQFYQGAKIGIVGPNGA
FT                   GKSTLMKIMAGIDTDFSGEAWPGENITVGYLPQEPQLDESKTVLENVKDGARHIADKVD
FT                   EYNSIAAQMAEPDADFEVLGEKMAELQTEIDAVDGWTLDNQLEIAMEALRCPPGDWPVN
FT                   DLSGGEKRRVALTRLLIQKPSILLLDEPTNHLDAESVEWLENHLKEYAGAVLMITHDRY
FT                   FLDNVVGWILELDRGTYYPYEGNYSTYLEKKAKRLEQESREESGKQKALARELEWIRQT
FT                   PAARQTKSKARIRKFDQLQEAQSDRKPGKAQIVIQVPERLGGKVIEAKNLTKAYGDKLL
FT                   FEDLSFTLPPGGIVGVIGPNGAGKSTLFRIITGQEEPDSGKLEIGDTVRLGYVDQSRDD
FT                   LTASNNVWEEISDGLDYMKVNGHDMSTRAYVGAFNFKGADQQKNVGKLSGGERNRVHMA
FT                   KMLKEGGNVLLLDEPTNDLDVETLGALEEAIENFAGCAVVISHDRFFLDRLATHILAFE
FT                   GNSHVEWFEGNFEAYEEDKRRRLGDAADRPTRLAYKKLTR"
FT   gene            639023..640234
FT                   /locus_tag="ELI_03035"
FT   CDS_pept        639023..640234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03035"
FT                   /product="putative diguanylate cyclase (GGDEF)"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62699"
FT                   /db_xref="GOA:Q2NC92"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC92"
FT                   /protein_id="ABC62699.1"
FT                   /translation="MQTQILGLLTPLMALVFAATFALFWHLGRMNRHVLGFAVSYALFA
FT                   CGFLSTHFLPPEALYVFHATQAFYSLGCIVLLGALCERAGQRLHIGSLAFVYVVSALTL
FT                   ALTTSLSNDVGPRLVIVNIGYGVMFAMGVTTLLTARRRDIISVAIIAIMAFQAVDFLVR
FT                   PTLTLLFERSIPAEVYRDSIYYSLIGLVLGVKTVSTAMVLLGATIAEWAKDLRESGERD
FT                   PLTGLLNRGAFEDSMRDLIPRAQTERRPLSLVVADIDHFKQVNDIWGHQAGDEAISGFG
FT                   ELVQRTVRGCDIGGRIGGEEFCIAVWNCENEPAERLADRIREAFGSLEHAGLSDNIRLT
FT                   ASFGVATAREGETYRALFARADAALYAAKAKGRNRVENAERELPGEATQEPAVGARALR
FT                   KASA"
FT   gene            complement(640432..640653)
FT                   /locus_tag="ELI_03040"
FT   CDS_pept        complement(640432..640653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC91"
FT                   /protein_id="ABC62700.1"
FT                   /translation="MTLYKLLLPADDTGTAHSFEIEARTPWLAVEKSRGRIGPDGAEIY
FT                   QGKKCLGRVRRVTSGRSPTWMIDMPEAT"
FT   gene            640792..642171
FT                   /locus_tag="ELI_03045"
FT   CDS_pept        640792..642171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03045"
FT                   /product="peptidase, M28 family protein"
FT                   /note="COG2234 Predicted aminopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62701"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC90"
FT                   /protein_id="ABC62701.1"
FT                   /translation="MKKLVTALACVAFTCPAVANPGPPPTLEARADLALEADTMAWGFV
FT                   EGITTEVGPRQAGTEAEKRGRDWAMQWLRNAGFENVADEPFDMQTWVPGSVHKAEVVNP
FT                   YPQPLVVQPLGGSASTGPEGVTAEVIYFPSIADLQAAPDGSLAGKIAFVSHAMTPTQDG
FT                   SHYGYFGAARFVGPGLAAQKGAVAIVIKSIGTDYHRNPHTGVIRFPEGVAPIPAGALSL
FT                   PDAANLERMFQRASGAPITLKLTLTPRSLGTTTSGNVVGEIVGRDPSLPPVLVACHIDS
FT                   WWNAPGAFDDGAGCGIVAAAARLAGLGDQRLRTIRVLMAGAEEVGLFGSVAYSEAHIDE
FT                   PIAVALESDFGADRIWRFESNFRESNPDLHNRLAASVARFGVSNSTIVASGGADINIAR
FT                   DQGTAIIDLQQDGTRYFDLHHTPDDTLDKIDKAQLRQNVAVWTQVVGILANEPKNIQTG
FT                   Q"
FT   gene            642277..642621
FT                   /locus_tag="ELI_03050"
FT   CDS_pept        642277..642621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62702"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC89"
FT                   /protein_id="ABC62702.1"
FT                   /translation="MKLTKTTIAMGALALAATAQAAVPMLYEEALARSEEEKIITAPIA
FT                   GIENSLWFDYRIDITEAQKELRSDLNRASDTEDLRDAWEEYAFELRDEREDYVKKMAKK
FT                   GYRQGIVTVF"
FT   gene            complement(642710..643441)
FT                   /locus_tag="ELI_03055"
FT   CDS_pept        complement(642710..643441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03055"
FT                   /product="hypothetical protein"
FT                   /note="COG5662 Predicted transmembrane transcriptional
FT                   regulator (anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62703"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC88"
FT                   /protein_id="ABC62703.1"
FT                   /translation="MSVTDQQIAAYADGELTGDAKAQVEAAVAADPTLAAKVESHRALK
FT                   NKLGAHFAPILDQTVPSQMTDLLAGAKDTAGDGISDSSSAEVVSFAAERQKRGLAPMMR
FT                   TWGPIATGAIAASLVLAVFQPWQSGPALEGYADTQLAEALDTQLVATQERDAATRVLLS
FT                   FEAGDGSLCRAYRSGETGGIACRDDTGWKIERELGLGDAQSTEFRQAGSEADLLSAAQE
FT                   MSFGGALDAEAEEAARERGWR"
FT   gene            complement(643438..644073)
FT                   /locus_tag="ELI_03060"
FT   CDS_pept        complement(643438..644073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03060"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62704"
FT                   /db_xref="GOA:Q2NC87"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC87"
FT                   /protein_id="ABC62704.1"
FT                   /translation="MRSKRSGQEGEQGHGGGQNSAHHCLVSIFCLKHGLNAPRRSFNPW
FT                   KAQILTEGFEQQVLVLLPRLRRFAIGLAGSPADGDDLCQMTLERALTRRDQWQEGTRLD
FT                   SWMYRIMRNIFVDEKRSGARRAQTFVDAEAGLLVGSDGAQESVVELSNVDRAMQQLPED
FT                   QREAVLLVMVEGYAYKEAAEIVGCPVGTLNSRLVRGRDALLTLLEDAA"
FT   gene            644032..645255
FT                   /locus_tag="ELI_03065"
FT   CDS_pept        644032..645255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03065"
FT                   /product="extracellular protease"
FT                   /note="COG1404 Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62705"
FT                   /db_xref="GOA:Q2NC86"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC86"
FT                   /protein_id="ABC62705.1"
FT                   /translation="MALLALLAAPLAAQVALPGVQVPDPGGVLGGVTDTARDALRDVEA
FT                   SARREAAALLRARERDLSRLLRRNRDTIERDARGDLARRGELLATGLDMALVPTLNKAG
FT                   FTVLSSERIEGLDLSVVRLGVPPELPLADAEALARRLAPGADISADNLHFQSGAAESAG
FT                   GLAGTAALQAASSIGVDVGVIDGAPGPSVRVLQTKGFAKGAPVASNHGSAVASLLKSAG
FT                   ATRIRVADVYGTDPAGGNALAMAKGLGYLVAAGSRVITISLVGPRNAVLEKAIAATQRK
FT                   GVVVVAAVGNDGPAAPPAYPASYPGVVAVTGVDKHGRALIEAGRALHLDYAAPGADVYG
FT                   LDARGKPTKLRGTSFAAPLAAARLAAALQAGGNWRRTLDAETRDLGRKGPDPVFGRGLL
FT                   CGGCAQKK"
FT   gene            645365..646228
FT                   /locus_tag="ELI_03070"
FT   CDS_pept        645365..646228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62706"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC85"
FT                   /protein_id="ABC62706.1"
FT                   /translation="MKKIILTASAIALIPVAAQAQLLGGLGGGAGGSIGGTVDSTVGTS
FT                   IGSTIDRTTRTVRGTVDGSASTSGDQSVDARNGRVSTNRNANGSVVASTASLADLPVPS
FT                   MASANGSGSASGQGSANAQLIGTDAVTGAVAPVAGQARNLAGSAAGRARSTARGVANSA
FT                   PMPGLPAVGGSASGEGSAQGSGSASLIGSPLAVAGSAASAGQDTASVTPGMPVIAPNGA
FT                   SLGTVRQVVADSRGQVQEVVVQQGRVTRTLPAGMFSASGNALVAGSAEGQASSGERAPA
FT                   EGGEAN"
FT   gene            complement(646431..646504)
FT                   /locus_tag="ELI_t15143"
FT   tRNA            complement(646431..646504)
FT                   /locus_tag="ELI_t15143"
FT                   /product="tRNA-Pro"
FT   gene            complement(646533..646606)
FT                   /locus_tag="ELI_t15141"
FT   tRNA            complement(646533..646606)
FT                   /locus_tag="ELI_t15141"
FT                   /product="tRNA-Met"
FT   gene            complement(646683..647669)
FT                   /locus_tag="ELI_03075"
FT   CDS_pept        complement(646683..647669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03075"
FT                   /product="WalW protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62707"
FT                   /db_xref="GOA:Q2NC84"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC84"
FT                   /protein_id="ABC62707.1"
FT                   /translation="MQRLPPIGNFAAFEPGFAPRYLLTVDTEEEFDWESEFSATRHGLD
FT                   HVRHIARFQEFCENLGISPVYLVDWPIAQSELAQEIIGGACARGTAEVGIQLHPWVNPP
FT                   FEEEVNAYNSYAGNLPPDLEREKFLNLRDAIEANFNVVPQIYRAGRYGTGPSTAKMLAQ
FT                   AGIAIDTSVRSKFNYAKGAGPDYGLHPLKPWWVGEDHKLLELPVTSVFWGLLRRSADRL
FT                   YPLATKIEPMAGLLSKLSLLERIALTPEGVSVEEALRGVDIAVDDGLPIIVLSFHSPSL
FT                   APGYTPYVKNDADVDALYDWFRQVCGYLGQRGVRPTTVAEIIKNVHA"
FT   gene            complement(647697..649478)
FT                   /locus_tag="ELI_03080"
FT   CDS_pept        complement(647697..649478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03080"
FT                   /product="two-component signal transduction histidine
FT                   kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62708"
FT                   /db_xref="GOA:Q2NC83"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC83"
FT                   /protein_id="ABC62708.1"
FT                   /translation="MHFDDRLATVLRHRASGERAARTQFRQLLDLLGRARHGRDEKLLA
FT                   AAWLRLGALGETIPAADRARMIAEPSWRFENAELAAHFAEDEPAVAAAALQRAQLDEDD
FT                   WEALIPRLPVRARGFLRLRRDLPARAERILDRLGIRDRALPLPQQSEPLVLSNEDAVDE
FT                   DELTEDFPEVKEPATPVPANDAGPDQDADRPESVQRADEPTPIAALVERIEAFQKNRNE
FT                   AKARLEEASPSQLDPPLPFVELQDAERAPLEDSVTFTTDGEGRIDWADNDVSAMLRYLK
FT                   LPDVLCDADRIAMRRHALLSTVPISLDGAPAIAGEWYLDAAPRFDPIGGRFTGYAGRLR
FT                   RAEPNQPDPEAEESDRIRQLLHELRTPVNAIQGFAEVIQQQLFGPTPNEYRALAATIAG
FT                   DAARILAGFDELDRLAKLEAGAREIEVGDADLSTIVAGQIAQLGEILATRNAGLKPAIA
FT                   TGCRIAIDTAEAEAMSWRLLAALAASLAPGEEAQVALTQRDDQLTLDCHLPKALAGKDD
FT                   IFAAEARKQASAGRLSAGAFGSGFALRLARAEARSAGGSLARVDDRLVLTLPALTVAEA
FT                   EPSPETGSYGAAQPEAS"
FT   gene            649698..650162
FT                   /locus_tag="ELI_03085"
FT   CDS_pept        649698..650162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03085"
FT                   /product="transcriptional regulator"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62709"
FT                   /db_xref="GOA:Q2NC82"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC82"
FT                   /protein_id="ABC62709.1"
FT                   /translation="MANLDEIDRRLLAELQSEGRITNVELAQRVGLTAPPCLRRVRALE
FT                   ESGVIRGYHAELEPSKLGFAITVFAMVSLKSQAEDALREFEEHMRDLPEVREVHMLNGE
FT                   IDFILKIVSEDLQSFQEFLTSKLTPAPNVASVKTSLTIRTAKHEPGVPLG"
FT   gene            650176..650379
FT                   /locus_tag="ELI_03090"
FT   CDS_pept        650176..650379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03090"
FT                   /product="hypothetical protein"
FT                   /note="COG1288 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62710"
FT                   /db_xref="GOA:Q2NC81"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC81"
FT                   /protein_id="ABC62710.1"
FT                   /translation="MTKSNIVHNEQTKLVASIVQTLATALFIGAAGIYWTEGWVENVLW
FT                   FSLGSVVMWIISYAMLLMLRGS"
FT   gene            650381..650659
FT                   /locus_tag="ELI_03095"
FT   CDS_pept        650381..650659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62711"
FT                   /db_xref="GOA:Q2NC80"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC80"
FT                   /protein_id="ABC62711.1"
FT                   /translation="MSIEGAIPAIAGVAVSLAGLLVTFLNTRKYDAEVAQAKQDIHKNL
FT                   HDIDVVVEVDDIRRALSSKGLSEEQVSELIGEIRTKDISVQAKVAES"
FT   gene            complement(650656..652005)
FT                   /locus_tag="ELI_03100"
FT   CDS_pept        complement(650656..652005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03100"
FT                   /product="AccC, acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62712"
FT                   /db_xref="GOA:Q2NC79"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC79"
FT                   /protein_id="ABC62712.1"
FT                   /translation="MGIQRILIANRGEIALRIHRAAHEMGIETVAVHSTADSDAMHVRL
FT                   ADHAVCIGPPPATDSYLNQAAIISAAEVSGCDAIHPGYGFLSENAKFAEIVEAHDIKWI
FT                   GPKPEHIRTMGDKVAAKQTAGELGLPLVPGSEGAVSDYDEARKIAAEIGYPVIIKAASG
FT                   GGGRGMKVCDSAEKLEGLMKQAGSEAKAAFGDATVYIEKYLGNPRHIEFQVFGDGNGSA
FT                   IHLGERDCSLQRRHQKVLEEAPSPVLDSAERHRMGEICADAMRKMAYRGAGTIEFLWEG
FT                   GEFYFIEMNTRLQVEHPVTEAITGVDLVREQIRIADGKPLSVNQEEIAFTGHAIECRIN
FT                   AEDPFTFAPSPGKVSHYHPAGGMHVRVDSGLYAGYSIPPYYDSMIAKLIVYGRNREGCI
FT                   MRLRRALEEMVVEGVKTSIPLHQELLRQDDVLNGDYSIKWLEEWLATREA"
FT   gene            complement(652015..652473)
FT                   /locus_tag="ELI_03105"
FT   CDS_pept        complement(652015..652473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03105"
FT                   /product="acetyl-CoA carboxylase"
FT                   /note="COG0511 Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62713"
FT                   /db_xref="GOA:Q2NC78"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC78"
FT                   /protein_id="ABC62713.1"
FT                   /translation="MDVDTALVRELAELLGETGLTEIEVEDGERKIKVSRGGVAAAAPA
FT                   PMMAAPAAAPAPAPSAAAPATPDAGGGEDHADALKSPMVGTCYLAPEPGADNFIKVGDS
FT                   VSEGDTLLIVEAMKVMNPITANTSGTIKAILVENAQPIEFDQPLVVIA"
FT   gene            complement(652602..653033)
FT                   /locus_tag="ELI_03110"
FT   CDS_pept        complement(652602..653033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03110"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /note="COG0757 3-dehydroquinate dehydratase II"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62714"
FT                   /db_xref="GOA:Q2NC77"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC77"
FT                   /protein_id="ABC62714.1"
FT                   /translation="MDTVFILNGPNLNLLGTREPDIYGRQSLNDIEAMCAETAGALGLQ
FT                   TVFRQSNHEGQLVDWLHEARERGAKAVLLNAAAYTHTSIALLDAIKAIEMPVIEVHLSD
FT                   PETREDFRHISYVGMAAAATVQGLGAQSYVVALEKAAAL"
FT   gene            complement(653142..653555)
FT                   /locus_tag="ELI_03115"
FT   CDS_pept        complement(653142..653555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62715"
FT                   /db_xref="GOA:Q2NC76"
FT                   /db_xref="InterPro:IPR021497"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC76"
FT                   /protein_id="ABC62715.1"
FT                   /translation="MAILESLIGPVASIIDKVIPDKQARAQAKLQLLELEGTQELKAIE
FT                   ARLSAIVAEAQSPDPWTSRARPSFLYVMYVILLFALPMGLIAAVSPASATAIATGINAY
FT                   LNGLPEPLYALFGTGYLGYTAARQWGKVKGVER"
FT   gene            653681..654139
FT                   /locus_tag="ELI_03120"
FT   CDS_pept        653681..654139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03120"
FT                   /product="possible dehydratase, MaoC family protein"
FT                   /note="COG2030 Acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62716"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC75"
FT                   /protein_id="ABC62716.1"
FT                   /translation="MAGIWFDEMEVGQVIQHPIRRTVTETDNVMFTCMTHNPAQLHLDE
FT                   EYMKGTDYGTRIVNSCFTLTLMVGISVNDTTLGTAVANLGWDEVRFPAPVFHGDTLRIE
FT                   TEIVGLRESKSRPNAGIVTFEHRAYNQKDEVVATCKRSGLQLKRPVEG"
FT   gene            654141..654281
FT                   /locus_tag="ELI_03125"
FT   CDS_pept        654141..654281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62717"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC74"
FT                   /protein_id="ABC62717.1"
FT                   /translation="MRLSIFEGATLIGTAEVMHLDPPMGVAMASFEPTEFYVEARKLHQ
FT                   R"
FT   gene            654313..654477
FT                   /locus_tag="ELI_03130"
FT   CDS_pept        654313..654477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC73"
FT                   /protein_id="ABC62718.1"
FT                   /translation="MLMDDGRVLRCQAISIQDWPDLNEREVHLLGVVEPSFEALFSEHP
FT                   DYLAYWAKK"
FT   gene            654544..654828
FT                   /locus_tag="ELI_03135"
FT   CDS_pept        654544..654828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03135"
FT                   /product="hypothetical protein"
FT                   /note="COG2827 Predicted endonuclease containing a URI
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62719"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC72"
FT                   /protein_id="ABC62719.1"
FT                   /translation="MGGWVYIMTNKRDGVLYVGVTADIAARVTQHRSGEGAAFCRRYGL
FT                   KRLVYAEPHDDIRDAIAREKAMKAWKREWKVELIEKANAEWSDLYGTLV"
FT   gene            complement(654869..655765)
FT                   /locus_tag="ELI_03140"
FT   CDS_pept        complement(654869..655765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03140"
FT                   /product="putative citrate lyase beta chain"
FT                   /note="COG2301 Citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62720"
FT                   /db_xref="GOA:Q2NC71"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC71"
FT                   /protein_id="ABC62720.1"
FT                   /translation="MTDHQPHVTSARSWLFAPGDSEKKMDKAAASEADIAIFDLEDAVA
FT                   PEAKPEARTLVHDRIARGDDDARRRLWVRINPLDTDMAAQDLAAIMPARPGGLLLPKSR
FT                   GRGDLERLDDFLTALEAANGIALGTTPVLVLATETAGAVFHCGDYSGAPRLAGLTWGAE
FT                   DLSDALGASDNRGPDGTYDHPYILARSLCLLGARHAGVQPVETIHADFRDLDGLEARAR
FT                   DVKRQGYTGMLAIHPAQVEVINRVFTPSEEELAAAQEIVDIFAANPGAGTIGHNGKMLD
FT                   RPHLDRAKGLLRAAGRI"
FT   gene            complement(655809..657212)
FT                   /locus_tag="ELI_03145"
FT   CDS_pept        complement(655809..657212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03145"
FT                   /product="alpha-amylase, putative"
FT                   /note="COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62721"
FT                   /db_xref="GOA:Q2NC70"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC70"
FT                   /protein_id="ABC62721.1"
FT                   /translation="MRKYALPALAALLVGGAAFAMTEGVYEPEANAWEPQQYVELTNPE
FT                   WSKDAVLYQINTRHFTPEGTFAAAQEELPRLKELGVDILWLMPIHPIGEVNRKGTLGSP
FT                   YSVKDYYGVNPEFGTEEEFRTFVDAAHEQGFKVILDLVANHTAWDHPLAEEHPDWYEKT
FT                   WDGDFRPTPWWDWSDIIDLDWSKPGVREHVGRAMEMWVRDYGIDGFRADVAGYVPVDFW
FT                   ETMRARLDAIRPVFMLGEVQQSAWHRAAFDATYAWDWHNTTKRVAKGDGNATSFYGYYA
FT                   ENESLWPREAMRMTYIENHDANAWEGTLYENYGDALQIMTALSFTGEGLPLIHNGMEAC
FT                   NAKRLEFFERDPIDWDQNPDCTYGDLLKDLIAFRDANPALHNGKWGARMHRVENSAPEQ
FT                   LFGWVREQDGNKVVGLFNMSTRPVNATLSDGIAAGTYTAFREEGEATLAEGDTVTLPAW
FT                   GFRLLSAKK"
FT   gene            complement(657205..658755)
FT                   /locus_tag="ELI_03150"
FT   CDS_pept        complement(657205..658755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03150"
FT                   /product="transporter, putative"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62722"
FT                   /db_xref="GOA:Q2NC69"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC69"
FT                   /protein_id="ABC62722.1"
FT                   /translation="MATSTAQPRLKPRQSFWGLWNISFGFFGIQIGFALQNSNMSRVFQ
FT                   TLGASMDDLPALWVAAPLTGLIVQPIIGHLSDKTWNRLGRRRPYFLVGAIFAALSLFVM
FT                   PLAPLIAAPLVFAAAMLWVLDASLNVSMEPFRAFVGDMLGTDQHSAGYAVQTAFIGTGA
FT                   VVGSIFPFFLEQWGVSNVAADGGIPDTVKWSFWFGAFALFAAVLWTVVTTKEYSPEEMA
FT                   AFDGPPAQESQQPIRALAAKSYLSSVVWMGFGLVVILSVDALGLEKEVLLLGALLAVYG
FT                   LLSAFAISMAKSGQRANMLSSIVGDFSGMPEVMKRLALVQFFSWSALFIMWINTTPVVT
FT                   QYVFGSTDTTTTAYNDGANWVNVLFTVYNGVAAIAALALLPWLSRTFGQVKTHSICLTL
FT                   GALGFLMFFFVRDANALLVAEVGIGIAWASILAMPYAILASNLPQQKLGIFMGLFNVFI
FT                   VVPQLLVATVMGSIMQAFFPGEPIWTMLFAAASWLIAAAAMLRVQAALPSTSPETADA"
FT   gene            complement(658875..659909)
FT                   /locus_tag="ELI_03155"
FT   CDS_pept        complement(658875..659909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03155"
FT                   /product="maltose transport gene repressor"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62723"
FT                   /db_xref="GOA:Q2NC68"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC68"
FT                   /protein_id="ABC62723.1"
FT                   /translation="MGRAPTGKPTSFDIAYLAGVSQPTVSRALRGDKSVSDATRQKIEK
FT                   IARELKYTVDKNASSLRTQRSNTIALLFFEDPTPDESMINPFFLAMLGSITRAASKRGL
FT                   DLLISFQQMENDWHTQYQDSHRADGLILLGYGDYTLYEERLQQLARQGTHFVRWGSVRD
FT                   DNIGATIGSDNFGAGRTAGEHLVEIGCKRVAFLGQADEHYPEFADRYAGLGAALEAAGL
FT                   DVDDTLQADALTSEEEGYAAARSLLDANRTFDGLFAASDLIATGALRALAEAGKSVPGD
FT                   VAVIGFDNIPAAALTAPPLTTVMQDMRGAGEALLASLVEQIDGADATSRTLPTTLVKRA
FT                   STGD"
FT   gene            660222..662921
FT                   /locus_tag="ELI_03160"
FT   CDS_pept        660222..662921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03160"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62724"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC67"
FT                   /protein_id="ABC62724.1"
FT                   /translation="MAMALTLAPQAAFAQDTDAEEQASAPDEDENMIIVSGFRESLESS
FT                   VAEKRFSDQILESVTAEDIGKLPDDSIGESIARLPGVTSQRLNGRANVIAIRGLGPDFS
FT                   QTLLNGREQTSTGDNRAVEFDQYPSEVVNQVVVYKTPTASLVGQGLVGTIDVRTIRPLE
FT                   AGEQILAIGAKGSYADLGALNAGSKEFGYRVNATFVDQFADDTMGVAISAAYTDEPYQL
FT                   QEFNAWGYAGDGSAANPFVIGGSKSFVTSTQLKRFGVTGTFQAELTPTLMLTADGFYSN
FT                   FDDDSIKRGIELPLGFGAFGTTFDPSTATTTTTEFGEFATSGTFENVEGVVRNDIFQRK
FT                   ADQYSGGLNLAYEGDDGWSAFFDFGYSRTDRNELSIESYSGTGYNAGVGATDTIGFMSD
FT                   TTGTSFSPTLNYSDPNLIRLTDPLGWGGSRIQAGYFNDRIIEDELRQYRVGVAKELDGF
FT                   FSKLHLGLSYTNRDKSLTPDEFFVIPAGGATEVPIPSNLLLRSTDLGYLGLGPIVSYDA
FT                   REVIASGVLVLDRNTSNDIPAKAYRISEDLMTLYAQLDIDQELGAGVLTGNIGVQAINT
FT                   SQQSSGIAFPGGVQTPISLGDDFWDVLPSANLSVRLDSGWVFRLAASRQIQRPQLDDLR
FT                   AAIGYGVVTTIDGQSPTGQYPYINGGGGNPLLRPYRANAVDFNVEKYFANGAGVIALQL
FT                   FYKDLVSYIDGANTVFDYAGLPLPAGPTPATTIGILNSEVNTGGGDFYGAELSATIPFD
FT                   AIIPALEGFGATGGVGWTETKVEDANGNVDVIPGYSEWVANGTLYFEKGGFNARGSVRY
FT                   RSEFLADFTGFGGNITRRLARAETIVDAQIGYDFESGPLEGLSIYLQGQNLTNQPFVSQ
FT                   FDVPVREAVIDNQEYGRRFLAGFTYRFR"
FT   gene            663037..664566
FT                   /locus_tag="ELI_03165"
FT   CDS_pept        663037..664566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03165"
FT                   /product="tryptophan halogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62725"
FT                   /db_xref="GOA:Q2NC66"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC66"
FT                   /protein_id="ABC62725.1"
FT                   /translation="MNPTDLPPIVIAGGGTAGWMAAATLGRFAGRKVLLVESEAIGTVG
FT                   VGEATIPQIRLFNAALGLDEAEFLRETQGTFKLAIEFAGWGGEGERYLHAFGTVGHGAG
FT                   VLPFQHYWLRARQAGKAGPLSDYALNDVASRAGKMQMWQAEPGKPVPDMPWAYHFDAGL
FT                   YAAYLRRYAEAHGVERVEGTIASVERDGESGDIAALVLDGERRIEGGVFVDCTGFRSLL
FT                   LGGALGVEFMDWTQWLPCDRAVAVPCETKGEFTPYTRSTARKAGWQWRIPLQHRIGNGH
FT                   VFCSDFMGEDEATKTLLANLDGAPTADPRVLKFTTGMRAQQWSHNCMALGLAGGFMEPL
FT                   ESTSIHLIQASIARLLQMLPGAEVAPAMRAEFNRQAEFEWTRIRDFLILHYWANGREGE
FT                   PFWDRCRAMDVPDTLSTKVETFRASGFVHREHEELFTEPGWLQVLIGQGVVPENYNPIA
FT                   DAMPEVELTAMLARIAETNQRLVAAMPDHAPFLRAHIDPRKQAPTQQRIPA"
FT   gene            664593..666407
FT                   /locus_tag="ELI_03170"
FT   CDS_pept        664593..666407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03170"
FT                   /product="alpha-amylase family protein"
FT                   /note="COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62726"
FT                   /db_xref="GOA:Q2NC65"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC65"
FT                   /protein_id="ABC62726.1"
FT                   /translation="MALAASTTSPTLAQEPSAETLASVRDRAPTDEVIYFVLPDRFANG
FT                   DASNDLGGYEADRLKSGYDPTHKGFYHGGDLKGLTEKLDYIQGMGVTAIWFAPIFKNKP
FT                   VQGDFSKPETVSAGYHGYWVTDFTQIDPHFGTNAEFEAFVDAAHARGMKVYMDIITNHT
FT                   ADVINYAEGEYAYRSKGAYPYSTRYGPDGERINPGFNGDQDSSEANWARLVNPDYAYSP
FT                   VVSEAERDIKVPIWLNDPIYYHNRGDSEWWGESALYGDFAGLDDLFTEHPRVVEGMIEI
FT                   FGSWIDRFGIDGFRIDTVKHVNPQFWQAFVPAMLERAEAAGIPNFHIFGEVYWAGPQPG
FT                   GLHQYTIRDRMPAVLDFTFQAAVQEVVAKSASPEVLYEMLRGDILYAQGEETALQNPTF
FT                   LGNHDMGRFSMFVKQANPDADNDELLKRVMLGNAMMLTLRGVPTIYYGDEQGFVSDGND
FT                   QLARENMFPSRVDAYNDNDLLGTDATTAGDNYDTQHPLYRLIKGLSAVRLANPALKTGR
FT                   HTLGTFDREPGLFSLTRTDPESGQRVLLAFNTSREEITRDIEIAYDVTGVQALVGPCAA
FT                   GIAAPGSVTMTLPAFGYAACELTDGEDD"
FT   gene            666413..668026
FT                   /locus_tag="ELI_03175"
FT   CDS_pept        666413..668026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03175"
FT                   /product="alpha-amylase family protein"
FT                   /note="COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62727"
FT                   /db_xref="GOA:Q2NC64"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC64"
FT                   /protein_id="ABC62727.1"
FT                   /translation="MATASNPSAEAAGALPWWRGATIYQIYPRSFMDANGDGVGDLPGI
FT                   TQRLDHVASLGVDAIWISPFFKSPMKDFGYDVSDYCDVDPLFGTLQDFDVLIAKAHSLG
FT                   LRVLIDQVYSHTSDEHPWFAKSRSSKESDKADWYVWADAKPDGSPPNNWQSVFGGPAWT
FT                   WDARRGQYYLHNFLSSQPNINGHNPRVQEALLDVARFWLDRGVDGFRIDALNFLMCDPE
FT                   LRDNPPAPPSNKPRTRPFDFQIKQHNMSHPAIPDFVARIREVTDGYDAIFTVAEVGGDE
FT                   AEGEMKAFTEGEKHLNSAYGFNFLYADKLTPGLVCGALAQWPDEDGVGWPSWAFENHDA
FT                   PRALSRWCAPEHREAFARLKMALLMSLRGNAILYYGEELGLTQVDIPFDQLHDPEAIAN
FT                   WPLTLSRDGARTPMPWEATQECAGFGSDDTWLPVGVENFGKAVDRQDGDDRSLLAFTRR
FT                   MIALRKANPALHHGAVENCGPYGSLLDLTRTADGQRLRCLFNLGPQTRELTDVPGVVLL
FT                   SVNQATPETLPPYGALILEI"
FT   gene            668031..670076
FT                   /locus_tag="ELI_03180"
FT   CDS_pept        668031..670076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03180"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62728"
FT                   /db_xref="GOA:Q2NC63"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019563"
FT                   /db_xref="InterPro:IPR029483"
FT                   /db_xref="InterPro:IPR029486"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC63"
FT                   /protein_id="ABC62728.1"
FT                   /translation="MRLLLAAASSLALATPLTAAEVSSPDGRITVEVDVDGDGVPFYRV
FT                   ERDGKELIAESDLGFLFTDEEPMRRNFVVTGESMTGSESTWEQPWGERRFVRDRHNELF
FT                   VTLQETRETSNRVLSVRMRVFDDGIGFRYEFAAPEEGSTTNIADELTEFVIAGEGTAWW
FT                   INAGAFNRYEYIYQETPITGVSTAHTPMTVRLEDGTHLSFHEAALVDYSGMWLKRIEGQ
FT                   RFRATLAPSSRGAKVVRKGAFTTPWRTIRISDDAAGLVESDLELNLNEPNKLGDVSWFT
FT                   PNKYIGIWWGMISNRWTWAQGPRHGATTERAKEYIDFAAEHGFRGVLIEGWNVGWDGNW
FT                   FGNGRDYSFTEAYPDFNFKEVTDYAREMGVHIVGHHETGGNINVYEAQLADAMKLYGES
FT                   GVDVVKTGYVADAGGIISCNADISDPCEPDGGEVFEWHDGQRMVQHHLRVLEEAAKNRV
FT                   AVNPHEPVKATGLRRTYPNWVAREGARGQEYNAWGPFNNGPEHDPTLVYTRMLSGPMDY
FT                   TPGVLSLKGDNDVPIASTLAKQLGLYLAIYSPIQMAADFIESLEQYPRELEFIKMVPAD
FT                   WAESKLIAGEVADYAIFARKDRNSEDWYVGGINDATERTLTLDFDFLEEGQSYTARVWK
FT                   DGPEATYLTEKRHDIAYDTLTVRKGDSYTVRLAPGGGLAMQLKPKD"
FT   gene            670114..671616
FT                   /locus_tag="ELI_03185"
FT   CDS_pept        670114..671616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03185"
FT                   /product="tryptophan halogenase, putative"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62729"
FT                   /db_xref="GOA:Q2NC62"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC62"
FT                   /protein_id="ABC62729.1"
FT                   /translation="MSDSKAPNVVVLGGGSAGWITACLLHRQWSEKGGSVTVVESPEIG
FT                   IIGVGEGSTPQLKAFFDQLGIAESEWMPACNATYKLGIRFNGWSERAGFESYYHPFPGP
FT                   IDLHSEPGFIGNCMLARHQIDVAAHPDDWFLATHLSEAGKSPIAAENFPFAPSYGYHFD
FT                   AYALGAFLRDWAVKRGVVHRPLKVTAVERADDGDIAALLCEGGERIEGDLFVDCSGFRA
FT                   MLAEQELGATFLPFAENLFNDSAVVLPTGHGAPFKPQTEATAMRAGWRWSIPLTTRVGN
FT                   GYVYSSKYISNEDAEAELRGALGLAGDGPEARFLKMKVGRLENSWTRNCLAVGLSQGFL
FT                   EPLEATALHIVIVTALEFAQAYEQGGYGPQHRDAFNASIAARYEGIRDYIVAHYRVNQR
FT                   SDTQYWRDNAANDRLSNGLKTMMTAWFRHQDIHAANDEAYGGKRYYANASWHCLFAGYG
FT                   TFPPQERMEAVPEGIRPADPAEARAMLEACAQNFPSYDPIAS"
FT   gene            671683..672699
FT                   /locus_tag="ELI_03190"
FT   CDS_pept        671683..672699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03190"
FT                   /product="maltose transport gene repressor"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62730"
FT                   /db_xref="GOA:Q2NC61"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC61"
FT                   /protein_id="ABC62730.1"
FT                   /translation="MSRDERRLTSFDVAAKAGVSQSTVSRALSGSPTITEATRTRVIEA
FT                   ARELGYVVDERAARLRSGKSKTIAVVVIGRAGQGAASVNPFYYSLLGSVCTAAAQRGYQ
FT                   ALVSIQSEPEHFFGQFIERGQADAVVVLGTATNREAWRYFDDYRETQARMAFWGSPFDG
FT                   PGYVRSDNKAGARLAVERLVQGGYKRIGFIGETDGAQRQFRERYEGYCETLEAAGLPCF
FT                   DAVTASGETREAQGAGAVKALLAQKTGYDAVFSACDAMALGALTALREADKSVPGDFGV
FT                   IGFDGLGVGAHSSPPLTTIEPDFAEAGLNLVEAALGGADEDRDRRVSVHLVERASAR"
FT   gene            complement(672770..675484)
FT                   /locus_tag="ELI_03195"
FT   CDS_pept        complement(672770..675484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03195"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62731"
FT                   /db_xref="GOA:Q2NC60"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC60"
FT                   /protein_id="ABC62731.1"
FT                   /translation="MSIGKQLAGWLLFTTALTFPAAALAQDTGAQDTGEEPDTPPADTQ
FT                   EGAQDDPRQDPVEDEAPEVSIPGGGNVITVTGRRGPRDITRSSTQVVSVLSSEDIARTG
FT                   DGDIASAISRVTGLSDNGDGRVFVRGLGDRYSLALLNGLPLPSPNPLSRVVPLDIFPTD
FT                   IIASSLVQKTYSANFPGEFGGGVINLTTQAVPDEGFVKINFGVSGDSITTFEDSIQYYG
FT                   TRLDKFGFTTDRRDPPPELQRFLNGDTQLSDLTLAEQQRIAVQLNEPNLNVVQRIGKTR
FT                   PNFSGGITMGGAVDIEDARLGAIATFNLSNSYRTRSIISQTPDDLDLNLRTDFRDFVTD
FT                   NRILANGLVGFGLEVGKHRFRWTNVYIRDVLKQAVISEGENIQDGDTERQQKTGWFERQ
FT                   LIDSQLIAELEFGELEFDLRGGYAQTDRESPYEYEFQYVRTNNPGDPTGEIFVNPLNRI
FT                   RGDLATIAFSDLTEKLWYGGVDVTYPVIPDILSVTVGGAYSDTSRTSSFREFLFDSDSD
FT                   FPAGVGALRPDLLLGNAIIEFFDVGLFETSQVFPVFAADLETKAGYIKGNLTPLEGLTI
FT                   DIGVRYEDATQSVAPVQVFANQQNLDAVTQIANDYFLPAGTITYDFGNGFQVRASASKT
FT                   IARPQFRELIFQPYTDPESNRTFVGNPALQDSELINAELRAEYYFGSGSRAAIAGFWKK
FT                   IDNPIEPFSAFTDNDQITQFANAPEATLFGGEVELQWNYDLIDFGGWFESKRAVVVANY
FT                   TYTQSELKVDAADETFIFSPGVGSVPRPASGFFFDGRPLTGQSDHIGNLQLGMEDLDKL
FT                   QQATFIMSYASERVTSRGAGGLPDIVEDPGFRLDFVVRQGITVAGVPLELKAEARNITG
FT                   RDNFDFISSGANRIEVNTYEVGRSFSFSISAEF"
FT   gene            complement(675614..677215)
FT                   /locus_tag="ELI_03200"
FT   CDS_pept        complement(675614..677215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62732"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC59"
FT                   /protein_id="ABC62732.1"
FT                   /translation="MITFHRSLILGCSAIALAGCGADEIVSPGTGGDVIINNPTPSPTP
FT                   TPTPTPTSTLVTPAAGCPTIADPAGLTDAGTISGPTGEYRVCRLPAAFSTSSTLPRIAG
FT                   LLYQIDGQVDVGTDGGPAPDASDGASDSNVVLTIEPGVILFASGSSFLNVNRGNDIAAN
FT                   GTAARPIIFTSRDNVLGLNNANSSGQWGGVILNGRAPVTDCSATGATPGTVNCERLVEG
FT                   ATTPPRYGGATPGDSSGSMTFVQIRYSGFILSNGDELQSLTTGGVGSGTTFNNVMSYNS
FT                   SDDGMEFFGGVINGRRIVVVGAEDDSLDTDTGVKANFQEVIVVQRASAGDTIIEADSAN
FT                   TLEENTPRQNTRISNATFIGNSATGDQLIRIRGKADFTIVNSILFDQKTAAPTPCLRID
FT                   GSDTLNRAASTALDEAGPVVFNSFVLDCGTDFRDSSGGVAAAQIQARYDTGSNNNSGFT
FT                   NSLTGLGGAPFINGANENGVTVFDPTALSSFFTSLGYIGAVQNAAGNWAETWTCNSPTV
FT                   TLGTANTGACSSLPTT"
FT   gene            677443..677763
FT                   /locus_tag="ELI_03205"
FT   CDS_pept        677443..677763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC58"
FT                   /protein_id="ABC62733.1"
FT                   /translation="MFMTAATIAALSLSVQTAPVVVTGERDGQDTAAQQTAFAPMLNRA
FT                   AALAVDGEFDKARSLYATVERMHAEYKLETTDGRWMYPAEIARRGMLAIDRRQAPVNLA
FT                   VR"
FT   gene            677920..678561
FT                   /locus_tag="ELI_03210"
FT   CDS_pept        677920..678561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03210"
FT                   /product="hypothetical protein"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62734"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC57"
FT                   /protein_id="ABC62734.1"
FT                   /translation="MEGSMILVRSGRLAFFAMLASISAPAWADVMEIGDDGARWVAGGV
FT                   AAAPGSTELSAGYAIVPESVAGLPVTVTTDPRLTARGVPVAYQAKVQELSHRFDLSPSL
FT                   IEALVWQESRWREKAVSHAGARGLAQLMPGTARYLGVDPDDPFANLEGGARYLREQLDR
FT                   FDGDLEKALAAYNAGPGRVLAARGIPNIRETKHYVAAIMGRLSNHSRKDQ"
FT   gene            678565..678870
FT                   /locus_tag="ELI_03215"
FT   CDS_pept        678565..678870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03215"
FT                   /product="hypothetical protein"
FT                   /note="COG3838 Type IV secretory pathway, VirB2 components
FT                   (pilins)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62735"
FT                   /db_xref="GOA:Q2NC56"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC56"
FT                   /protein_id="ABC62735.1"
FT                   /translation="MGSLSRLAALAALVTPTALLAQTQQAADPAGSGPIVNALAWMQST
FT                   LLGSVATAVAVMAVAAVGFMMLTGRINWRFGATVIIGVFILFGATTIVAGIQSAAG"
FT   gene            678878..679162
FT                   /locus_tag="ELI_03220"
FT   CDS_pept        678878..679162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03220"
FT                   /product="type IV secretion system protein B3, putative"
FT                   /note="COG3702 Type IV secretory pathway, VirB3 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62736"
FT                   /db_xref="GOA:Q2NC55"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC55"
FT                   /protein_id="ABC62736.1"
FT                   /translation="MTDLVRHPVHRALTRPQMFAGVTMNFFIINLMVTTIAFLILKSFW
FT                   IIPVPIITHAIGYFVSLREPRVFDLWITKVSMCPRVKNYKTWGCNSYAP"
FT   gene            679193..681631
FT                   /locus_tag="ELI_03225"
FT   CDS_pept        679193..681631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03225"
FT                   /product="type IV secretion system protein B4, putative"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62737"
FT                   /db_xref="GOA:Q2NC54"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC54"
FT                   /protein_id="ABC62737.1"
FT                   /translation="MSKWIGPAAMSAKEASAGDRLPYARLVDANTLQLRDGSLMMAIQV
FT                   PGLLFETEDSDALNAHAATREVVLRSTLDSRFVLYHHVIRRRVAVELDAEFPDPLSRHI
FT                   DARWKERLGSGSLFINDQFVTLVRRPARGKAGLADRASRWFSRRKEELEADPRELRSLQ
FT                   AAATGLIASLQAYGASLLGEYQGPSGGTNSEILELLSALYNGEMKPVRRPAEDVDIGQM
FT                   LPYRRASFGLDAMEQRGAGDPDFSAILSLKDYPEATSPGLLDSLLRLPYEMIVTETYAP
FT                   QERTTARERIDLSLRRLRSVDEEATAERADMQNARDALGNGAVGFGDHHLSVLVRETTL
FT                   PRLDDASAACAAALADTGAVVVREDTNLEPAFWAQLPGNEAYIVRRAMISSANMASFGS
FT                   LHGFALGQAAGNHWGDAVTLLETTSATPFFFNFHNGDLGNFSVIGPSGSGKTVVMNFLA
FT                   AQAQKFAPRTILFDKDRGAELFVRGIGGRYDRIYAGEPTGFNPLALPDSAANRAFLRDW
FT                   LGVLLKAEGPEELQTIAHAVDAAYENDASLRQLRNFRELLSGSRRPEPGDLPDRLSAWI
FT                   HSGEHAWLFDNQRDELDLDNRTLGFDMTALLENPKLRTPTMMYLFHRIEERLDGNPAMI
FT                   LIDEGWKALDDEVFAARIRDWLKTLRKRNALVGFATQSAADALESRISTALVEQTATMV
FT                   FMPNSRARAEDYCDGFGLTSHELALIRSLPAHSRCFLVRQPDASVVVRLDLSNAPEVLT
FT                   VLSGRESSVRRLDLLREAVGDNPADWFPALTGHAWPGDPSEETEAGADVTAISFKQAAE
FT                   "
FT   gene            681628..682803
FT                   /locus_tag="ELI_03230"
FT   CDS_pept        681628..682803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03230"
FT                   /product="hypothetical protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62738"
FT                   /db_xref="GOA:Q2NC53"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC53"
FT                   /protein_id="ABC62738.1"
FT                   /translation="MSAQCDLVLSQAAGGIAAALQAVDCVAAEVTGTAFGRLFAPGGAL
FT                   GTVLTILLTLYVAFFAFALITGRSNLSIRSLTPRMLTVGLVLTFATSWVAYQSVVWNLA
FT                   LGAPDWLAGVLTGDSGSATMTFASKVDIVFLAVEQASAGQTDIEAFSPPGMLWMGALLF
FT                   MLGTVGVLVTARIGLALPVALGPIFVVMALFNGTRGLFTGWLKGVVMLAMTPLFAVLAG
FT                   SVMLELSVPILSALTANPGEIPARPAMAFLMVGAVHVALMVMVLKVAGTMVAGWRVFGM
FT                   ADKTEERSENAAARQSAQSVTVQGDQAAQAANTTAAAASARRTAVAASIPAVAANDSGG
FT                   SAGPTTVRETRVVAAASGAGQATPASDPTARTRGLGTRFKSAPPRSMEKMK"
FT   gene            682800..683573
FT                   /locus_tag="ELI_03235"
FT   CDS_pept        682800..683573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03235"
FT                   /product="type IV secretion system protein B9, putative"
FT                   /note="COG3504 Type IV secretory pathway, VirB9 components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62739"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC52"
FT                   /protein_id="ABC62739.1"
FT                   /translation="MIRAGLPALSLVLMATPLAAQDSRLVEVLYDPSRVVTIEGRTKVQ
FT                   ATIKFGDNESIENVAIGDSTAWQVTPNKRANLLFVKPLEATAKTNMTVVTNKHTYLFDL
FT                   IASPRANPLYVLSFTYPEEPEDEQDAQLAATGEANPLEVAAATDPYAVIDPATLNWSWA
FT                   KDGDPALFPLRAFDDGEATFLEWDTRTPVPAILVKNVEGEEGPVNFTVRGNTIVVDGVP
FT                   REIILRSGDEVATLVNTGPVGKPASPQQAQLAGGR"
FT   gene            683605..684711
FT                   /locus_tag="ELI_03240"
FT   CDS_pept        683605..684711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03240"
FT                   /product="type IV secretion system protein B10, putative"
FT                   /note="COG2948 Type IV secretory pathway, VirB10
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62740"
FT                   /db_xref="GOA:Q2NC51"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC51"
FT                   /protein_id="ABC62740.1"
FT                   /translation="MRLPDKDSGSFGANDVDPRETQDADVTDLASRTSYPAVANKGGKS
FT                   DAMGLVAGIAIVAALGAVTFWSMNAAQVPPPEGVGSAQVEQAPVQAQAPQQAVAPAPVA
FT                   APRPDPAPAPVYAQSPDAVTVPRANPNASPSLVFDASARAAGPEAAVAPGTASALPGGG
FT                   NASGNSANDFASRVGGVGGGPAQAARMVNPATTVTQGTLIPAILETAIDTDVPGFVRAV
FT                   VSQDVRSFDGKNVLVPRSSRLVGQYQSGVQGGQKRAYVIWTRLIRPDGVSVPLQSPAIG
FT                   FDGTTGLRGDVNSRFFQRFGSAMLLSVVGGLGAIASGGASVVIGGAGQSAAAAAVQQDS
FT                   QVGPVIRVRQGEPIRVFTARDLDFSTVM"
FT   gene            684727..685740
FT                   /locus_tag="ELI_03245"
FT   CDS_pept        684727..685740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03245"
FT                   /product="type IV secretion system protein B11, putative"
FT                   /note="COG0630 Type IV secretory pathway, VirB11
FT                   components, and related ATPases involved in archaeal
FT                   flagella biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62741"
FT                   /db_xref="GOA:Q2NC50"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC50"
FT                   /protein_id="ABC62741.1"
FT                   /translation="MSADVHPFAKQAEAAETPLPGDRSVYLEAYLKPFREWLDRDTVTE
FT                   ILVNRPGEVWIEDAASPGMQRVDTPHIDDRLVQRLAEQVARVSHQGINREHPLLGATLP
FT                   DGARVQFCGPPASRKHWCMAIRRHRRLDLPLDAYDSGPLSPPQEQAMPDAQAEPIAFLR
FT                   EAIRQRRTILISGGTSTGKTTFLNAMLGEIPKEQRVVLVEDTPELRLPGENGVGLVAVK
FT                   GELGEAKVTANELLQAALRLRPDRIVLGELRGAESVSFLRAINTGHPGSFSTIHANSIT
FT                   GALEQLSLMVMQTGIGLSRSDTIAYASNVIDVIVQLGRSGEGKRGISEIALAKDLV"
FT   gene            685795..687942
FT                   /locus_tag="ELI_03250"
FT   CDS_pept        685795..687942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03250"
FT                   /product="polyphosphate kinase"
FT                   /note="COG0855 Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62742"
FT                   /db_xref="GOA:Q2NC49"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NC49"
FT                   /protein_id="ABC62742.1"
FT                   /translation="MGSHPITQDNDLDPPTEPGERYFNRELSWLAFNDRVLAEACNDSY
FT                   PLLERLRFLSISGSNLDEFVMIRVAGLVGQVQRGIDEVSDDGRSPREQLNAVVARLEEL
FT                   SERQQDIWRNLRVQLADAGVHVADEERVNAEAYGWLKQHFFESILPLLTPQALDPAHPF
FT                   PFISNEGLGLLFTLRRGGEELVEMVLIPSALPRFIRVPGEDALYISIESLITRFAKELF
FT                   PGFEIVGDGTFRVLRDSDIEIQEEAEDLVRTFRSAIQRRRRGQVIQLEIEEEFDPTAEA
FT                   LLREKLDTPGATFVKTDGMLGIAGLADIVDEDRPDLKFDSYSPRYPERVLEHDGDIFAA
FT                   IREKDIVIHHPYESFNVVVDFIRRAAIDPDVVAIKQALYRAGTQSEVVDALVEAAENGK
FT                   SVTAVVELKARFDEEQNLYWANKLERAGVQVIYGFVDWKTHAKVAMVVRREEEGFRTYC
FT                   HFGTGNYHPITAKIYTDLSYFTADPRLGRDAAKLFNFVTGYVEPRELEMLAVSPIDLRE
FT                   TIYAAIDNEMVNAQAGKPAAIWMKMNQITDVDMIDRLYEASQAGVEIQLVVRGICNLRP
FT                   GVPGMSDNIRVKSIIGRFLEHSRIYAFANGEPMPGTSSTVYISSADLMVRNLDRRVEQL
FT                   VPIDNQTVHDQVLQQVLLANLLDNEQSWELQPDGSYFRVEVGEKSFNCHRYFMTNPSLS
FT                   GRGGALEAGAVPKLALRKGAV"
FT   gene            687943..689487
FT                   /locus_tag="ELI_03255"
FT   CDS_pept        687943..689487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03255"
FT                   /product="exopolyphosphatase"
FT                   /note="COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62743"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC48"
FT                   /protein_id="ABC62743.1"
FT                   /translation="MAIGGRRRDRDGLFMGNVPHRAIIDVGSNTVRLVVYGGSPRAPTV
FT                   LLNEKVAARLGRDITTTGALAEEAIDLAMRGLERYALLLRDLDIQEVDMVATAAARDAS
FT                   NGPEFLRKVEALGFSPHLLSGEEEGNISAWGVLGAFPKARGVVADLGGGSLELVHIGDG
FT                   SPDTAISLPLGTLRLTELDEASPGKLHKVIQSRLKDAKAHRSIDGDLYLVGGTWRAMAV
FT                   YAIEKLGFPLTDPHGLSLPAEEALAMAKELAESDPEDLRSMERISTMRSDTMPLAAVLL
FT                   QVLIKKLRPDRVIASSWGIREGVLYQSLAPHARAQDPLIAGVSTFAASRGASPTMATRI
FT                   ASWTVDAAPAHGRGTERIRLAATMLSLAAMQIEPNLRLRVGIEWALHKRWIAIEPEGRA
FT                   MIAAAICANRNHCDLPDEVKQLASKKSLDQAIGWGLAVRLCRRIGGKSRQSLQRTRLLV
FT                   EDKQLVLSLDESHAALFGIPNEKDLNLLADWLGLEPAMRVEASPWVESPADAVAEG"
FT   gene            689636..690148
FT                   /locus_tag="ELI_03260"
FT   CDS_pept        689636..690148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03260"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62744"
FT                   /db_xref="GOA:Q2NC47"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC47"
FT                   /protein_id="ABC62744.1"
FT                   /translation="MAGICAGAIAVPAYAQDADTPDTDPGTSSPVIVVTAQRQAQSLQE
FT                   VPIAVSAFSAETLEAQQIENASDLQLTLPNVSFTKSNFTASSFTIRGIGDLCVGVSCDS
FT                   ATAIHQNGSPLFGTRLFETEYFDLERIEVLRGPQGTLFGRNATSGVVNVVTAKPDLSGF
FT                   GAAGSFE"
FT   gene            690179..692500
FT                   /locus_tag="ELI_03265"
FT   CDS_pept        690179..692500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03265"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62745"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC46"
FT                   /protein_id="ABC62745.1"
FT                   /translation="MVNVPIGNVIGARVAGFYLKRDGYTDNIFNGDDIDGRDMYAVRGS
FT                   LRVEPGPDTTIDIVGYYFRENDDRLRIQKQQCQRDPTGILGCLNNRRDFDKTNANSTFT
FT                   GTLASSEFFALNGIPRSFGLNSLYGPDAYANFNEPQDVRVVNTEFTPEYFADELIIQAD
FT                   ISHDFGAINVSLNGTYQETSVDSRQDYNLGVGQIPNAAIAFPTLQAFAAGAAGPGTGAY
FT                   FTPITEALFDGGDLCVSDTRLDNRGAFEGFSVCTPNGTQFDRSNQENESFSVEGIISSD
FT                   LDGPFNFLVGGIYAESKVLENSYYVNAFAIDYIAGVLGSFTSLGGGLPPSYLATSFFRN
FT                   NTQDFKLKSFGIFGEVYVDVTDRLKITAGLRYNDDSKRITARSTLASFLNPYSNDGDPF
FT                   DSPFVGSFDADPGTPGNQLSQQREVGFDEITGRFVVDYEITPDNLLYFSYSRGYKSGGI
FT                   NPPLQPIFNVSESFGPESIDAFEIGSKNTFANGALQVNATAFYYKYSDLQLSRIIARTS
FT                   VNDTIDAKVFGFELETVIAPSPNWLINANFSYLNAEVDGQQLFSNPRDPGGGDPNAVII
FT                   KDITNGALCAVTGGNPNAFVNAINPGLGLQGTTSFPSDSGIASNGAFSICGVLEAQAAA
FT                   IGPAFGGIQVLSPGVQVNLEGNKLPQAPEMKASAGVQYTADFDNGMSLVPRFDIAFTGE
FT                   QFGNVFNGRVNRIEPFVQANAQIQLNGPDRRWFVRGFVQNIFDSDSVTGLYVTDASSGL
FT                   FTNIFTLDPRRYGIAAGFNF"
FT   gene            complement(692564..693283)
FT                   /locus_tag="ELI_03270"
FT   CDS_pept        complement(692564..693283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03270"
FT                   /product="hypothetical protein"
FT                   /note="COG1738 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62746"
FT                   /db_xref="GOA:Q2NC45"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC45"
FT                   /protein_id="ABC62746.1"
FT                   /translation="MENPSPQRVSGTAPTHFRYYDLVMAAFVAILLLSNLIGAAKLSTV
FT                   AGFTFGAGILFFPVSYVIGDVLTEVYGYARARRVIWTGFAALVFMAFMSWAVVAMPPSE
FT                   VWVGQDAYEQVFGLVPRIVLASIVAFWAGEFVNSFVMAKMKIWTQGKALWTRTIGSTVV
FT                   GQGVDSLLFYPIAFFGVWETEAVITVMITNWMLKVLWEAVLTPVTYVAVGALKKREGVD
FT                   VYDTETDFSPFSTTKDA"
FT   gene            693343..693416
FT                   /locus_tag="ELI_t15075"
FT   tRNA            693343..693416
FT                   /locus_tag="ELI_t15075"
FT                   /product="tRNA-Arg"
FT   gene            complement(693546..694325)
FT                   /locus_tag="ELI_03275"
FT   CDS_pept        complement(693546..694325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03275"
FT                   /product="hypothetical protein"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62747"
FT                   /db_xref="GOA:Q2NC44"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC44"
FT                   /protein_id="ABC62747.1"
FT                   /translation="MADTEPSPEGIPAATVVIFRNARDGGAPEILMTVRSRNMVFAGGM
FT                   AVFPGGRVDPADFELGTRLSSGIDPEEAAHQIAVVRETLEETGLAIGLQGDIDADKARA
FT                   ARELLLETEALAPVLDEFNWSLNLAQLTPFARWFPKNERIPRVYDTRFYLADLGTGAVE
FT                   IEVDATENTHLFWVSAAGALEMAEQGEIKLIFPTRRNLERLALFNTFEEAKAQAEAIPV
FT                   KTIVPQVDTSGEKPMLKIMEDAGYPITEELLDSVMRG"
FT   gene            complement(694611..694940)
FT                   /locus_tag="ELI_03280"
FT   CDS_pept        complement(694611..694940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03280"
FT                   /product="glutaredoxin-related protein"
FT                   /note="COG0278 glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62748"
FT                   /db_xref="GOA:Q2NC43"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC43"
FT                   /protein_id="ABC62748.1"
FT                   /translation="MSDTNAKISGIVGENDVVLFMKGTPLFPQCGFSSRAVSILDHCGV
FT                   KYESVDVLQDMEIRQGIKTYSDWPTIPQLFVKGEFLGGSDIMMEMFEAGELQELLDEKD
FT                   VARAE"
FT   gene            complement(694978..695211)
FT                   /locus_tag="ELI_03285"
FT   CDS_pept        complement(694978..695211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03285"
FT                   /product="hypothetical protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62749"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC42"
FT                   /protein_id="ABC62749.1"
FT                   /translation="MPMSADEITEAITAALPGAQVEMTDLAGDNDHWAARVTAPQFAGK
FT                   NRVQQHKMVYEALGGRMGGVLHALQLTTAVPK"
FT   gene            complement(695221..695544)
FT                   /locus_tag="ELI_03290"
FT   CDS_pept        complement(695221..695544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03290"
FT                   /product="hypothetical protein"
FT                   /note="COG2058 Ribosomal protein L12E/L44/L45/RPP1/RPP2"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62750"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC41"
FT                   /protein_id="ABC62750.1"
FT                   /translation="MTDFKDRERAEEAKYAMDEETAFKVAARRNKLLGHWAAEKMGLND
FT                   EETKSYATAVVQADFEEAGDEDVIRKVLGDLTTAGVDVDEAAVRAALADMTIEAKRQFM
FT                   SEN"
FT   gene            complement(695609..696607)
FT                   /locus_tag="ELI_03295"
FT   CDS_pept        complement(695609..696607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03295"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62751"
FT                   /db_xref="GOA:Q2NC40"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC40"
FT                   /protein_id="ABC62751.1"
FT                   /translation="MKVLRTHAVGGPETLTLDEVEVPTPGKGEVLVDVKACAINYPDTL
FT                   MIRDLYQFKPERPYAPGGEIAGVVEAVGEGVDGVSVGDRVMAGIGNGGLTEKVIVPAGR
FT                   MFPVPEGVPFEKAASLLMTYGTTIHGLKDRGHIKKGDTVLVLGAAGGVGLSAVELAKAF
FT                   GARVVAAVSSEEKGEVARKAGADEVVIYPKDEMDKAASKELASAFKAACGPEGANIVYD
FT                   IVGGQYSEPALRSIAWEGRFLVVGFPAGIAKMPLNLTLLKSCDIAGVFWGAFTAREPVK
FT                   FREQVEELFQMMKDGKIDPLVSETFPLEKGGDAIAKLENRQAVGKLVVLMD"
FT   gene            complement(696604..697206)
FT                   /locus_tag="ELI_03300"
FT   CDS_pept        complement(696604..697206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03300"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="COG0066 3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62752"
FT                   /db_xref="GOA:Q2NC39"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2NC39"
FT                   /protein_id="ABC62752.1"
FT                   /translation="MEALSQIEGRAIPYGAKNVDTDVIVPAHWLKTITREGLGRGAFET
FT                   LREVPDNIFDSEEFAGAPILIAGDNFGCGSSREHAAWALLDLGIRAVIAPSFSDIFSSN
FT                   AFKNGIVTVVLSQYEVDRLMEVAQSDPIAVDLETQTVVTPFQDRFPFEIDPFRKHCLLN
FT                   GLDEVGLTLTRDAAIADYESRQKTQTPWLTTGTERAA"
FT   gene            complement(697206..697394)
FT                   /locus_tag="ELI_03305"
FT   CDS_pept        complement(697206..697394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62753"
FT                   /db_xref="GOA:Q2NC38"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC38"
FT                   /protein_id="ABC62753.1"
FT                   /translation="MRGAQHITKAESMTKKLHAKTIAGAIGSAAIAAALLYAGKRKKRN
FT                   EPTQPGPIPSGENPETD"
FT   gene            complement(697401..698864)
FT                   /locus_tag="ELI_03310"
FT   CDS_pept        complement(697401..698864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03310"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /note="COG0065 3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62754"
FT                   /db_xref="GOA:Q2NC37"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC37"
FT                   /protein_id="ABC62754.1"
FT                   /translation="MLRKGRKAAAMESTPRTLYEKIWDAHVVEQRDDGTALIYIDRHLV
FT                   HEVTSPQAFEALRVSGRTVRRPDLTLAVPDHNLPTTARRTSSGSRIPIADPQSAAQLDA
FT                   LARNAAEFGIRYIGDADAEQGIVHVVGPEQGFSLPGATIVCGDSHTACHGGLGALAFGI
FT                   GTSEVEHVLATQTLLLKQSKTMEIRVEGELGAGVTSKDLIMHIIGVIGAAGGTGYVFEY
FT                   RGKVFERMSIESRLTVCNMSIEAGARAGLIAPDETTFAYLKGRPYAPDGEEWDAAVAWW
FT                   RSLATDDGATFDRSVTIDAAEVAPSVTWGTSPEDVLPITGEVPSPASFDDTGKQAAAAK
FT                   SLEYMGLTPGQKLTEISVENIFIGSCTNSRIEDLRAAAKVLRGRRKASNVNWAIVVPGS
FT                   GLVKRQAEEEGLDRIFTEAGFEWREPGCSACLGMNPDKVPPGQRCASTSNRNFVGRQGP
FT                   GARTHLLSPAMAAAAAVNGRLTDVRELSD"
FT   gene            698936..699349
FT                   /locus_tag="ELI_03315"
FT   CDS_pept        698936..699349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03315"
FT                   /product="hypothetical protein"
FT                   /note="COG0824 Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62755"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC36"
FT                   /protein_id="ABC62755.1"
FT                   /translation="MSASSPAKPFAFPIKVLPDDIDFMGHVNNARYLNWVQDAVLAHWN
FT                   KLAPAEEVASKAWVALKHEITYRKPAFLEDDVMAQTVLEHFQGARAFYHTVISRGEEVL
FT                   AEVKSSWCCIDAETLRPARIGDHLREFFFPEAD"
FT   gene            699427..700194
FT                   /locus_tag="ELI_03320"
FT   CDS_pept        699427..700194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03320"
FT                   /product="beta-carotene ketolase"
FT                   /note="COG3239 Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62756"
FT                   /db_xref="GOA:Q2NC35"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC35"
FT                   /protein_id="ABC62756.1"
FT                   /translation="MSDGPAFSLPARSRQQAIGLTLAVLIAGAWLGIHAYAMFVFELSW
FT                   QNLPFALLLATVQTWLSVGVFIVSHDAMHGSLAPGRPTLNSAIGAFLLALYAGFGWRRM
FT                   RDAHFTHHKLAGHAGDPDFDEHNPRSFWRWYGTFFRRYFSWQSILFVHVVVGIYWLVLD
FT                   IPMVQIVLLYGAPALLSSLQLFYFGTFRPHRRSEEGFADRHNARSDGFGTLASLATCFH
FT                   FGYHLEHHRRPDVPWWALPGAREAGIGMEAQNA"
FT   gene            700191..700691
FT                   /locus_tag="ELI_03325"
FT   CDS_pept        700191..700691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03325"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="COG1230 Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62757"
FT                   /db_xref="GOA:Q2NC34"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC34"
FT                   /protein_id="ABC62757.1"
FT                   /translation="MSWWAIALIVFGAVVGMEFFAWFAHKYIMHGWGWSWHRDHHEPHD
FT                   NTLEKNDLFAVVFGSVAALLFVIGALWSDPLWWAAVGITLYGVIYTLVHDGLVHQRYWR
FT                   WTPKRGYAKRLVQAHRLHHATVGKEGGVSFGFVFARDPAKLKAELKQQREQGLAVVRDS
FT                   MGA"
FT   gene            complement(700747..700905)
FT                   /locus_tag="ELI_03330"
FT   CDS_pept        complement(700747..700905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03330"
FT                   /product="hypothetical protein"
FT                   /note="COG0401 Uncharacterized homolog of Blt101"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62758"
FT                   /db_xref="GOA:Q2NC33"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC33"
FT                   /protein_id="ABC62758.1"
FT                   /translation="MAIIVLIATILLPPLGVAMKHGLGATTLLNLVLTLLGFIPGLIHG
FT                   LYVNYAR"
FT   gene            complement(700980..701327)
FT                   /locus_tag="ELI_03335"
FT   CDS_pept        complement(700980..701327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03335"
FT                   /product="hypothetical protein"
FT                   /note="COG2832 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62759"
FT                   /db_xref="GOA:Q2NC32"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC32"
FT                   /protein_id="ABC62759.1"
FT                   /translation="MRPLYLAGGILSVAFGAIGAVLPIMPTVPFLLLAVFCFARSNPEW
FT                   ERKILEHPQWGPQIADWRDHRIIRRPAKLAAVAAMSAGVLFTWATLGAPWVYVSLSVLI
FT                   IAGGWIVTRNE"
FT   gene            complement(701329..701739)
FT                   /locus_tag="ELI_03340"
FT   CDS_pept        complement(701329..701739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03340"
FT                   /product="Fe-S center assembly protein"
FT                   /note="COG2166 SufE protein probably involved in Fe-S
FT                   center assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62760"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC31"
FT                   /protein_id="ABC62760.1"
FT                   /translation="MRSLSDIQEEYEFLEGDERYRLLIELGRELDPMPDALKTDATLVR
FT                   GCSASVWVYPTGEGNTLHFLADSNAAITKGIVALVIAAVQDKPADEVAQMDVAGALEPF
FT                   DLKNQLSSNRTQGVPNMIALVKEHAARLAAAA"
FT   gene            complement(701879..702130)
FT                   /locus_tag="ELI_03345"
FT   CDS_pept        complement(701879..702130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62761"
FT                   /db_xref="GOA:Q2NC30"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC30"
FT                   /protein_id="ABC62761.1"
FT                   /translation="MQMSDPTFVIAITALVGLSVVVAALLRGWHSWLALKRQELENRRT
FT                   RGPIEIEGGAGEGAARIEIADLKERIRKLEAIANGVDL"
FT   gene            complement(702170..702424)
FT                   /locus_tag="ELI_03350"
FT   CDS_pept        complement(702170..702424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03350"
FT                   /product="hypothetical protein"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC29"
FT                   /protein_id="ABC62762.1"
FT                   /translation="MSMWTGIVLIVLIASVAQILRARYRARSGIIADKQGNETYVGRDD
FT                   GEKDREIAELRERVKVLERIATDPARRTADEIEKLRDER"
FT   gene            complement(702421..702717)
FT                   /locus_tag="ELI_03355"
FT   CDS_pept        complement(702421..702717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ELI_03355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ELI_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC62763"
FT                   /db_xref="GOA:Q2NC28"
FT                   /db_xref="UniProtKB/TrEMBL:Q2NC28"
FT                   /protein_id="ABC62763.1"
FT                   /translation="MDSDLILIFGFILTVVVIITLGINGIIAQQMRQKRWLEEHREKKR