(data stored in SCRATCH zone)

EMBL: CP000227

ID   CP000227; SV 1; circular; genomic DNA; STD; PRO; 5214195 BP.
AC   CP000227;
PR   Project:PRJNA16220;
DT   26-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
DE   Bacillus cereus Q1, complete genome.
KW   .
OS   Bacillus cereus Q1
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
RN   [1]
RP   1-5214195
RX   DOI; 10.1128/JB.01629-08.
RX   PUBMED; 19060151.
RA   Xiong Z., Jiang Y., Qi D., Lu H., Yang F., Yang J., Chen L., Sun L., Xu X.,
RA   Xue Y., Zhu Y., Jin Q.;
RT   "Complete genome sequence of the extremophilic Bacillus cereus strain Q1
RT   with industrial applications";
RL   J. Bacteriol. 191(3):1120-1121(2009).
RN   [2]
RP   1-5214195
RA   Jiang Y., Jin Q., Qi D.H., Lu H.B., Yang F., Yang J., Chen L.H., Sun L.L.,
RA   Xu X.Y., Xue Y., Zhu Y.F.;
RT   ;
RL   Submitted (06-DEC-2005) to the INSDC.
RL   State Key Laboratory for Moleclular Virology and Genetic Engineering,
RL   Microbial Genome Center of Chinese Ministry of Public Health, 100 YingXin
RL   Street, XuanWu, Beijing, Beijing 100052, P. R. China
DR   MD5; 4b27634cf04802357f540c6094286c54.
DR   BioSample; SAMN02603603.
DR   EnsemblGenomes-Gn; BCQ_0007.
DR   EnsemblGenomes-Gn; BCQ_0008.
DR   EnsemblGenomes-Gn; BCQ_0009.
DR   EnsemblGenomes-Gn; BCQ_0010.
DR   EnsemblGenomes-Gn; BCQ_0012.
DR   EnsemblGenomes-Gn; BCQ_0019.
DR   EnsemblGenomes-Gn; BCQ_0031.
DR   EnsemblGenomes-Gn; BCQ_0032.
DR   EnsemblGenomes-Gn; BCQ_0034.
DR   EnsemblGenomes-Gn; BCQ_0069.
DR   EnsemblGenomes-Gn; BCQ_0070.
DR   EnsemblGenomes-Gn; BCQ_0088.
DR   EnsemblGenomes-Gn; BCQ_0089.
DR   EnsemblGenomes-Gn; BCQ_0091.
DR   EnsemblGenomes-Gn; BCQ_0165.
DR   EnsemblGenomes-Gn; BCQ_0166.
DR   EnsemblGenomes-Gn; BCQ_0168.
DR   EnsemblGenomes-Gn; BCQ_0169.
DR   EnsemblGenomes-Gn; BCQ_0170.
DR   EnsemblGenomes-Gn; BCQ_0171.
DR   EnsemblGenomes-Gn; BCQ_0172.
DR   EnsemblGenomes-Gn; BCQ_0173.
DR   EnsemblGenomes-Gn; BCQ_0174.
DR   EnsemblGenomes-Gn; BCQ_0175.
DR   EnsemblGenomes-Gn; BCQ_0176.
DR   EnsemblGenomes-Gn; BCQ_0177.
DR   EnsemblGenomes-Gn; BCQ_0273.
DR   EnsemblGenomes-Gn; BCQ_0274.
DR   EnsemblGenomes-Gn; BCQ_0275.
DR   EnsemblGenomes-Gn; BCQ_0276.
DR   EnsemblGenomes-Gn; BCQ_0277.
DR   EnsemblGenomes-Gn; BCQ_0278.
DR   EnsemblGenomes-Gn; BCQ_0279.
DR   EnsemblGenomes-Gn; BCQ_0280.
DR   EnsemblGenomes-Gn; BCQ_0281.
DR   EnsemblGenomes-Gn; BCQ_0282.
DR   EnsemblGenomes-Gn; BCQ_0283.
DR   EnsemblGenomes-Gn; BCQ_0284.
DR   EnsemblGenomes-Gn; BCQ_0285.
DR   EnsemblGenomes-Gn; BCQ_0287.
DR   EnsemblGenomes-Gn; BCQ_0288.
DR   EnsemblGenomes-Gn; BCQ_0289.
DR   EnsemblGenomes-Gn; BCQ_0303.
DR   EnsemblGenomes-Gn; BCQ_0304.
DR   EnsemblGenomes-Gn; BCQ_0306.
DR   EnsemblGenomes-Gn; BCQ_0309.
DR   EnsemblGenomes-Gn; BCQ_0310.
DR   EnsemblGenomes-Gn; BCQ_0312.
DR   EnsemblGenomes-Gn; BCQ_0320.
DR   EnsemblGenomes-Gn; BCQ_0321.
DR   EnsemblGenomes-Gn; BCQ_0323.
DR   EnsemblGenomes-Gn; BCQ_0326.
DR   EnsemblGenomes-Gn; BCQ_0327.
DR   EnsemblGenomes-Gn; BCQ_0329.
DR   EnsemblGenomes-Gn; BCQ_0336.
DR   EnsemblGenomes-Gn; BCQ_0337.
DR   EnsemblGenomes-Gn; BCQ_0339.
DR   EnsemblGenomes-Gn; BCQ_0567.
DR   EnsemblGenomes-Gn; BCQ_0568.
DR   EnsemblGenomes-Gn; BCQ_0571.
DR   EnsemblGenomes-Gn; BCQ_0572.
DR   EnsemblGenomes-Gn; BCQ_0573.
DR   EnsemblGenomes-Gn; BCQ_0574.
DR   EnsemblGenomes-Gn; BCQ_0575.
DR   EnsemblGenomes-Gn; BCQ_0576.
DR   EnsemblGenomes-Gn; BCQ_0577.
DR   EnsemblGenomes-Gn; BCQ_0578.
DR   EnsemblGenomes-Gn; BCQ_0579.
DR   EnsemblGenomes-Gn; BCQ_0580.
DR   EnsemblGenomes-Gn; BCQ_0581.
DR   EnsemblGenomes-Gn; BCQ_0582.
DR   EnsemblGenomes-Gn; BCQ_0583.
DR   EnsemblGenomes-Gn; BCQ_0584.
DR   EnsemblGenomes-Gn; BCQ_0585.
DR   EnsemblGenomes-Gn; BCQ_0586.
DR   EnsemblGenomes-Gn; BCQ_0609.
DR   EnsemblGenomes-Gn; BCQ_0789.
DR   EnsemblGenomes-Gn; BCQ_0790.
DR   EnsemblGenomes-Gn; BCQ_0792.
DR   EnsemblGenomes-Gn; BCQ_0793.
DR   EnsemblGenomes-Gn; BCQ_0794.
DR   EnsemblGenomes-Gn; BCQ_0795.
DR   EnsemblGenomes-Gn; BCQ_0796.
DR   EnsemblGenomes-Gn; BCQ_0797.
DR   EnsemblGenomes-Gn; BCQ_0798.
DR   EnsemblGenomes-Gn; BCQ_0799.
DR   EnsemblGenomes-Gn; BCQ_0800.
DR   EnsemblGenomes-Gn; BCQ_0801.
DR   EnsemblGenomes-Gn; BCQ_0802.
DR   EnsemblGenomes-Gn; BCQ_0803.
DR   EnsemblGenomes-Gn; BCQ_0804.
DR   EnsemblGenomes-Gn; BCQ_0805.
DR   EnsemblGenomes-Gn; BCQ_0806.
DR   EnsemblGenomes-Gn; BCQ_0807.
DR   EnsemblGenomes-Gn; BCQ_0808.
DR   EnsemblGenomes-Gn; BCQ_0809.
DR   EnsemblGenomes-Gn; BCQ_0810.
DR   EnsemblGenomes-Gn; BCQ_0811.
DR   EnsemblGenomes-Gn; BCQ_0812.
DR   EnsemblGenomes-Gn; BCQ_1333.
DR   EnsemblGenomes-Gn; BCQ_1346.
DR   EnsemblGenomes-Gn; BCQ_4061.
DR   EnsemblGenomes-Gn; BCQ_4282.
DR   EnsemblGenomes-Gn; BCQ_4690.
DR   EnsemblGenomes-Gn; BCQ_4691.
DR   EnsemblGenomes-Gn; BCQ_4692.
DR   EnsemblGenomes-Gn; BCQ_4693.
DR   EnsemblGenomes-Gn; BCQ_4694.
DR   EnsemblGenomes-Gn; BCQ_4695.
DR   EnsemblGenomes-Gn; BCQ_4696.
DR   EnsemblGenomes-Gn; BCQ_4697.
DR   EnsemblGenomes-Gn; BCQ_4698.
DR   EnsemblGenomes-Gn; BCQ_4699.
DR   EnsemblGenomes-Gn; BCQ_4700.
DR   EnsemblGenomes-Gn; BCQ_4701.
DR   EnsemblGenomes-Gn; BCQ_4702.
DR   EnsemblGenomes-Gn; BCQ_4703.
DR   EnsemblGenomes-Gn; BCQ_4704.
DR   EnsemblGenomes-Gn; BCQ_4705.
DR   EnsemblGenomes-Gn; BCQ_4706.
DR   EnsemblGenomes-Gn; BCQ_4707.
DR   EnsemblGenomes-Gn; BCQ_4708.
DR   EnsemblGenomes-Gn; BCQ_4709.
DR   EnsemblGenomes-Gn; BCQ_4710.
DR   EnsemblGenomes-Gn; BCQ_4711.
DR   EnsemblGenomes-Gn; BCQ_4712.
DR   EnsemblGenomes-Gn; BCQ_4714.
DR   EnsemblGenomes-Gn; BCQ_4715.
DR   EnsemblGenomes-Gn; BCQ_4964.
DR   EnsemblGenomes-Gn; BCQ_5313.
DR   EnsemblGenomes-Gn; BCQ_5314.
DR   EnsemblGenomes-Gn; BCQ_5315.
DR   EnsemblGenomes-Gn; BCQ_5316.
DR   EnsemblGenomes-Gn; EBG00001015505.
DR   EnsemblGenomes-Gn; EBG00001015507.
DR   EnsemblGenomes-Gn; EBG00001015509.
DR   EnsemblGenomes-Gn; EBG00001015511.
DR   EnsemblGenomes-Gn; EBG00001015513.
DR   EnsemblGenomes-Gn; EBG00001015516.
DR   EnsemblGenomes-Gn; EBG00001015518.
DR   EnsemblGenomes-Gn; EBG00001015520.
DR   EnsemblGenomes-Gn; EBG00001015522.
DR   EnsemblGenomes-Gn; EBG00001015524.
DR   EnsemblGenomes-Gn; EBG00001015525.
DR   EnsemblGenomes-Gn; EBG00001015527.
DR   EnsemblGenomes-Gn; EBG00001015529.
DR   EnsemblGenomes-Gn; EBG00001015531.
DR   EnsemblGenomes-Gn; EBG00001015533.
DR   EnsemblGenomes-Gn; EBG00001015535.
DR   EnsemblGenomes-Gn; EBG00001015537.
DR   EnsemblGenomes-Gn; EBG00001015539.
DR   EnsemblGenomes-Gn; EBG00001015541.
DR   EnsemblGenomes-Gn; EBG00001015543.
DR   EnsemblGenomes-Gn; EBG00001015545.
DR   EnsemblGenomes-Gn; EBG00001015547.
DR   EnsemblGenomes-Gn; EBG00001015549.
DR   EnsemblGenomes-Gn; EBG00001015551.
DR   EnsemblGenomes-Gn; EBG00001015553.
DR   EnsemblGenomes-Gn; EBG00001015555.
DR   EnsemblGenomes-Gn; EBG00001015557.
DR   EnsemblGenomes-Gn; EBG00001015559.
DR   EnsemblGenomes-Gn; EBG00001015561.
DR   EnsemblGenomes-Gn; EBG00001015563.
DR   EnsemblGenomes-Gn; EBG00001015566.
DR   EnsemblGenomes-Gn; EBG00001015569.
DR   EnsemblGenomes-Gn; EBG00001015572.
DR   EnsemblGenomes-Gn; EBG00001015574.
DR   EnsemblGenomes-Gn; EBG00001015576.
DR   EnsemblGenomes-Gn; EBG00001015578.
DR   EnsemblGenomes-Gn; EBG00001015580.
DR   EnsemblGenomes-Gn; EBG00001015582.
DR   EnsemblGenomes-Gn; EBG00001015583.
DR   EnsemblGenomes-Gn; EBG00001015584.
DR   EnsemblGenomes-Gn; EBG00001015585.
DR   EnsemblGenomes-Gn; EBG00001015586.
DR   EnsemblGenomes-Gn; EBG00001015587.
DR   EnsemblGenomes-Gn; EBG00001015588.
DR   EnsemblGenomes-Gn; EBG00001015589.
DR   EnsemblGenomes-Gn; EBG00001015590.
DR   EnsemblGenomes-Gn; EBG00001015591.
DR   EnsemblGenomes-Gn; EBG00001015592.
DR   EnsemblGenomes-Gn; EBG00001015593.
DR   EnsemblGenomes-Gn; EBG00001015594.
DR   EnsemblGenomes-Gn; EBG00001015595.
DR   EnsemblGenomes-Gn; EBG00001015596.
DR   EnsemblGenomes-Gn; EBG00001015597.
DR   EnsemblGenomes-Gn; EBG00001015598.
DR   EnsemblGenomes-Gn; EBG00001015599.
DR   EnsemblGenomes-Gn; EBG00001015600.
DR   EnsemblGenomes-Gn; EBG00001015601.
DR   EnsemblGenomes-Gn; EBG00001015602.
DR   EnsemblGenomes-Gn; EBG00001015603.
DR   EnsemblGenomes-Gn; EBG00001015604.
DR   EnsemblGenomes-Gn; EBG00001015605.
DR   EnsemblGenomes-Gn; EBG00001015606.
DR   EnsemblGenomes-Gn; EBG00001015607.
DR   EnsemblGenomes-Gn; EBG00001015608.
DR   EnsemblGenomes-Gn; EBG00001015609.
DR   EnsemblGenomes-Gn; EBG00001015610.
DR   EnsemblGenomes-Gn; EBG00001015611.
DR   EnsemblGenomes-Gn; EBG00001015612.
DR   EnsemblGenomes-Gn; EBG00001015613.
DR   EnsemblGenomes-Gn; EBG00001015614.
DR   EnsemblGenomes-Gn; EBG00001015615.
DR   EnsemblGenomes-Gn; EBG00001015616.
DR   EnsemblGenomes-Gn; EBG00001015617.
DR   EnsemblGenomes-Gn; EBG00001015618.
DR   EnsemblGenomes-Gn; EBG00001015619.
DR   EnsemblGenomes-Gn; EBG00001015620.
DR   EnsemblGenomes-Gn; EBG00001015621.
DR   EnsemblGenomes-Gn; EBG00001015622.
DR   EnsemblGenomes-Gn; EBG00001015623.
DR   EnsemblGenomes-Gn; EBG00001015624.
DR   EnsemblGenomes-Gn; EBG00001015625.
DR   EnsemblGenomes-Gn; EBG00001015626.
DR   EnsemblGenomes-Gn; EBG00001015627.
DR   EnsemblGenomes-Gn; EBG00001015628.
DR   EnsemblGenomes-Gn; EBG00001015629.
DR   EnsemblGenomes-Gn; EBG00001015630.
DR   EnsemblGenomes-Gn; EBG00001015631.
DR   EnsemblGenomes-Gn; EBG00001015632.
DR   EnsemblGenomes-Gn; EBG00001015633.
DR   EnsemblGenomes-Gn; EBG00001015634.
DR   EnsemblGenomes-Gn; EBG00001015635.
DR   EnsemblGenomes-Gn; EBG00001015636.
DR   EnsemblGenomes-Gn; EBG00001015637.
DR   EnsemblGenomes-Gn; EBG00001015638.
DR   EnsemblGenomes-Gn; EBG00001015639.
DR   EnsemblGenomes-Gn; EBG00001015640.
DR   EnsemblGenomes-Gn; EBG00001015641.
DR   EnsemblGenomes-Gn; EBG00001015642.
DR   EnsemblGenomes-Gn; EBG00001015643.
DR   EnsemblGenomes-Gn; EBG00001015644.
DR   EnsemblGenomes-Gn; EBG00001015645.
DR   EnsemblGenomes-Gn; EBG00001015646.
DR   EnsemblGenomes-Gn; EBG00001015647.
DR   EnsemblGenomes-Gn; EBG00001015648.
DR   EnsemblGenomes-Gn; EBG00001015649.
DR   EnsemblGenomes-Gn; EBG00001015650.
DR   EnsemblGenomes-Gn; EBG00001015651.
DR   EnsemblGenomes-Gn; EBG00001015652.
DR   EnsemblGenomes-Gn; EBG00001015653.
DR   EnsemblGenomes-Gn; EBG00001015654.
DR   EnsemblGenomes-Gn; EBG00001015655.
DR   EnsemblGenomes-Gn; EBG00001015656.
DR   EnsemblGenomes-Gn; EBG00001015657.
DR   EnsemblGenomes-Gn; EBG00001015658.
DR   EnsemblGenomes-Gn; EBG00001015659.
DR   EnsemblGenomes-Gn; EBG00001015660.
DR   EnsemblGenomes-Gn; EBG00001015661.
DR   EnsemblGenomes-Gn; EBG00001015662.
DR   EnsemblGenomes-Gn; EBG00001015663.
DR   EnsemblGenomes-Gn; EBG00001015664.
DR   EnsemblGenomes-Gn; EBG00001015665.
DR   EnsemblGenomes-Gn; EBG00001015666.
DR   EnsemblGenomes-Gn; EBG00001015667.
DR   EnsemblGenomes-Gn; EBG00001015668.
DR   EnsemblGenomes-Gn; EBG00001015669.
DR   EnsemblGenomes-Gn; EBG00001015670.
DR   EnsemblGenomes-Gn; EBG00001015671.
DR   EnsemblGenomes-Gn; EBG00001015672.
DR   EnsemblGenomes-Gn; EBG00001015673.
DR   EnsemblGenomes-Gn; EBG00001015674.
DR   EnsemblGenomes-Gn; EBG00001015675.
DR   EnsemblGenomes-Gn; EBG00001015676.
DR   EnsemblGenomes-Gn; EBG00001015677.
DR   EnsemblGenomes-Gn; EBG00001015678.
DR   EnsemblGenomes-Gn; EBG00001015679.
DR   EnsemblGenomes-Gn; EBG00001015680.
DR   EnsemblGenomes-Gn; EBG00001015681.
DR   EnsemblGenomes-Gn; EBG00001015682.
DR   EnsemblGenomes-Gn; EBG00001015683.
DR   EnsemblGenomes-Gn; EBG00001015684.
DR   EnsemblGenomes-Gn; EBG00001015685.
DR   EnsemblGenomes-Gn; EBG00001015686.
DR   EnsemblGenomes-Gn; EBG00001015687.
DR   EnsemblGenomes-Gn; EBG00001015688.
DR   EnsemblGenomes-Gn; EBG00001015689.
DR   EnsemblGenomes-Gn; EBG00001015690.
DR   EnsemblGenomes-Gn; EBG00001015691.
DR   EnsemblGenomes-Gn; EBG00001015692.
DR   EnsemblGenomes-Gn; EBG00001015693.
DR   EnsemblGenomes-Gn; EBG00001015694.
DR   EnsemblGenomes-Gn; EBG00001015695.
DR   EnsemblGenomes-Gn; EBG00001015696.
DR   EnsemblGenomes-Gn; EBG00001015697.
DR   EnsemblGenomes-Gn; EBG00001015698.
DR   EnsemblGenomes-Gn; EBG00001015699.
DR   EnsemblGenomes-Gn; EBG00001015700.
DR   EnsemblGenomes-Gn; EBG00001015701.
DR   EnsemblGenomes-Gn; EBG00001015702.
DR   EnsemblGenomes-Gn; EBG00001015703.
DR   EnsemblGenomes-Gn; EBG00001015704.
DR   EnsemblGenomes-Gn; EBG00001015705.
DR   EnsemblGenomes-Gn; EBG00001015706.
DR   EnsemblGenomes-Gn; EBG00001015707.
DR   EnsemblGenomes-Gn; EBG00001015708.
DR   EnsemblGenomes-Gn; EBG00001015709.
DR   EnsemblGenomes-Gn; EBG00001015710.
DR   EnsemblGenomes-Gn; EBG00001015711.
DR   EnsemblGenomes-Gn; EBG00001015712.
DR   EnsemblGenomes-Gn; EBG00001015713.
DR   EnsemblGenomes-Gn; EBG00001015714.
DR   EnsemblGenomes-Gn; EBG00001015715.
DR   EnsemblGenomes-Gn; EBG00001015716.
DR   EnsemblGenomes-Gn; EBG00001015717.
DR   EnsemblGenomes-Gn; EBG00001015718.
DR   EnsemblGenomes-Gn; EBG00001015719.
DR   EnsemblGenomes-Gn; EBG00001015720.
DR   EnsemblGenomes-Gn; EBG00001015721.
DR   EnsemblGenomes-Tr; BCQ_0007-1.
DR   EnsemblGenomes-Tr; BCQ_0008-1.
DR   EnsemblGenomes-Tr; BCQ_0009-1.
DR   EnsemblGenomes-Tr; BCQ_0010-1.
DR   EnsemblGenomes-Tr; BCQ_0012-1.
DR   EnsemblGenomes-Tr; BCQ_0019-1.
DR   EnsemblGenomes-Tr; BCQ_0031-1.
DR   EnsemblGenomes-Tr; BCQ_0032-1.
DR   EnsemblGenomes-Tr; BCQ_0034-1.
DR   EnsemblGenomes-Tr; BCQ_0069-1.
DR   EnsemblGenomes-Tr; BCQ_0070-1.
DR   EnsemblGenomes-Tr; BCQ_0088-1.
DR   EnsemblGenomes-Tr; BCQ_0089-1.
DR   EnsemblGenomes-Tr; BCQ_0091-1.
DR   EnsemblGenomes-Tr; BCQ_0165-1.
DR   EnsemblGenomes-Tr; BCQ_0166-1.
DR   EnsemblGenomes-Tr; BCQ_0168-1.
DR   EnsemblGenomes-Tr; BCQ_0169-1.
DR   EnsemblGenomes-Tr; BCQ_0170-1.
DR   EnsemblGenomes-Tr; BCQ_0171-1.
DR   EnsemblGenomes-Tr; BCQ_0172-1.
DR   EnsemblGenomes-Tr; BCQ_0173-1.
DR   EnsemblGenomes-Tr; BCQ_0174-1.
DR   EnsemblGenomes-Tr; BCQ_0175-1.
DR   EnsemblGenomes-Tr; BCQ_0176-1.
DR   EnsemblGenomes-Tr; BCQ_0177-1.
DR   EnsemblGenomes-Tr; BCQ_0273-1.
DR   EnsemblGenomes-Tr; BCQ_0274-1.
DR   EnsemblGenomes-Tr; BCQ_0275-1.
DR   EnsemblGenomes-Tr; BCQ_0276-1.
DR   EnsemblGenomes-Tr; BCQ_0277-1.
DR   EnsemblGenomes-Tr; BCQ_0278-1.
DR   EnsemblGenomes-Tr; BCQ_0279-1.
DR   EnsemblGenomes-Tr; BCQ_0280-1.
DR   EnsemblGenomes-Tr; BCQ_0281-1.
DR   EnsemblGenomes-Tr; BCQ_0282-1.
DR   EnsemblGenomes-Tr; BCQ_0283-1.
DR   EnsemblGenomes-Tr; BCQ_0284-1.
DR   EnsemblGenomes-Tr; BCQ_0285-1.
DR   EnsemblGenomes-Tr; BCQ_0287-1.
DR   EnsemblGenomes-Tr; BCQ_0288-1.
DR   EnsemblGenomes-Tr; BCQ_0289-1.
DR   EnsemblGenomes-Tr; BCQ_0303-1.
DR   EnsemblGenomes-Tr; BCQ_0304-1.
DR   EnsemblGenomes-Tr; BCQ_0306-1.
DR   EnsemblGenomes-Tr; BCQ_0309-1.
DR   EnsemblGenomes-Tr; BCQ_0310-1.
DR   EnsemblGenomes-Tr; BCQ_0312-1.
DR   EnsemblGenomes-Tr; BCQ_0320-1.
DR   EnsemblGenomes-Tr; BCQ_0321-1.
DR   EnsemblGenomes-Tr; BCQ_0323-1.
DR   EnsemblGenomes-Tr; BCQ_0326-1.
DR   EnsemblGenomes-Tr; BCQ_0327-1.
DR   EnsemblGenomes-Tr; BCQ_0329-1.
DR   EnsemblGenomes-Tr; BCQ_0336-1.
DR   EnsemblGenomes-Tr; BCQ_0337-1.
DR   EnsemblGenomes-Tr; BCQ_0339-1.
DR   EnsemblGenomes-Tr; BCQ_0567-1.
DR   EnsemblGenomes-Tr; BCQ_0568-1.
DR   EnsemblGenomes-Tr; BCQ_0571-1.
DR   EnsemblGenomes-Tr; BCQ_0572-1.
DR   EnsemblGenomes-Tr; BCQ_0573-1.
DR   EnsemblGenomes-Tr; BCQ_0574-1.
DR   EnsemblGenomes-Tr; BCQ_0575-1.
DR   EnsemblGenomes-Tr; BCQ_0576-1.
DR   EnsemblGenomes-Tr; BCQ_0577-1.
DR   EnsemblGenomes-Tr; BCQ_0578-1.
DR   EnsemblGenomes-Tr; BCQ_0579-1.
DR   EnsemblGenomes-Tr; BCQ_0580-1.
DR   EnsemblGenomes-Tr; BCQ_0581-1.
DR   EnsemblGenomes-Tr; BCQ_0582-1.
DR   EnsemblGenomes-Tr; BCQ_0583-1.
DR   EnsemblGenomes-Tr; BCQ_0584-1.
DR   EnsemblGenomes-Tr; BCQ_0585-1.
DR   EnsemblGenomes-Tr; BCQ_0586-1.
DR   EnsemblGenomes-Tr; BCQ_0609-1.
DR   EnsemblGenomes-Tr; BCQ_0789-1.
DR   EnsemblGenomes-Tr; BCQ_0790-1.
DR   EnsemblGenomes-Tr; BCQ_0792-1.
DR   EnsemblGenomes-Tr; BCQ_0793-1.
DR   EnsemblGenomes-Tr; BCQ_0794-1.
DR   EnsemblGenomes-Tr; BCQ_0795-1.
DR   EnsemblGenomes-Tr; BCQ_0796-1.
DR   EnsemblGenomes-Tr; BCQ_0797-1.
DR   EnsemblGenomes-Tr; BCQ_0798-1.
DR   EnsemblGenomes-Tr; BCQ_0799-1.
DR   EnsemblGenomes-Tr; BCQ_0800-1.
DR   EnsemblGenomes-Tr; BCQ_0801-1.
DR   EnsemblGenomes-Tr; BCQ_0802-1.
DR   EnsemblGenomes-Tr; BCQ_0803-1.
DR   EnsemblGenomes-Tr; BCQ_0804-1.
DR   EnsemblGenomes-Tr; BCQ_0805-1.
DR   EnsemblGenomes-Tr; BCQ_0806-1.
DR   EnsemblGenomes-Tr; BCQ_0807-1.
DR   EnsemblGenomes-Tr; BCQ_0808-1.
DR   EnsemblGenomes-Tr; BCQ_0809-1.
DR   EnsemblGenomes-Tr; BCQ_0810-1.
DR   EnsemblGenomes-Tr; BCQ_0811-1.
DR   EnsemblGenomes-Tr; BCQ_0812-1.
DR   EnsemblGenomes-Tr; BCQ_1333-1.
DR   EnsemblGenomes-Tr; BCQ_1346-1.
DR   EnsemblGenomes-Tr; BCQ_4061-1.
DR   EnsemblGenomes-Tr; BCQ_4282-1.
DR   EnsemblGenomes-Tr; BCQ_4690-1.
DR   EnsemblGenomes-Tr; BCQ_4691-1.
DR   EnsemblGenomes-Tr; BCQ_4692-1.
DR   EnsemblGenomes-Tr; BCQ_4693-1.
DR   EnsemblGenomes-Tr; BCQ_4694-1.
DR   EnsemblGenomes-Tr; BCQ_4695-1.
DR   EnsemblGenomes-Tr; BCQ_4696-1.
DR   EnsemblGenomes-Tr; BCQ_4697-1.
DR   EnsemblGenomes-Tr; BCQ_4698-1.
DR   EnsemblGenomes-Tr; BCQ_4699-1.
DR   EnsemblGenomes-Tr; BCQ_4700-1.
DR   EnsemblGenomes-Tr; BCQ_4701-1.
DR   EnsemblGenomes-Tr; BCQ_4702-1.
DR   EnsemblGenomes-Tr; BCQ_4703-1.
DR   EnsemblGenomes-Tr; BCQ_4704-1.
DR   EnsemblGenomes-Tr; BCQ_4705-1.
DR   EnsemblGenomes-Tr; BCQ_4706-1.
DR   EnsemblGenomes-Tr; BCQ_4707-1.
DR   EnsemblGenomes-Tr; BCQ_4708-1.
DR   EnsemblGenomes-Tr; BCQ_4709-1.
DR   EnsemblGenomes-Tr; BCQ_4710-1.
DR   EnsemblGenomes-Tr; BCQ_4711-1.
DR   EnsemblGenomes-Tr; BCQ_4712-1.
DR   EnsemblGenomes-Tr; BCQ_4714-1.
DR   EnsemblGenomes-Tr; BCQ_4715-1.
DR   EnsemblGenomes-Tr; BCQ_4964-1.
DR   EnsemblGenomes-Tr; BCQ_5313-1.
DR   EnsemblGenomes-Tr; BCQ_5314-1.
DR   EnsemblGenomes-Tr; BCQ_5315-1.
DR   EnsemblGenomes-Tr; BCQ_5316-1.
DR   EnsemblGenomes-Tr; EBT00001541695.
DR   EnsemblGenomes-Tr; EBT00001541696.
DR   EnsemblGenomes-Tr; EBT00001541697.
DR   EnsemblGenomes-Tr; EBT00001541698.
DR   EnsemblGenomes-Tr; EBT00001541699.
DR   EnsemblGenomes-Tr; EBT00001541700.
DR   EnsemblGenomes-Tr; EBT00001541702.
DR   EnsemblGenomes-Tr; EBT00001541704.
DR   EnsemblGenomes-Tr; EBT00001541705.
DR   EnsemblGenomes-Tr; EBT00001541706.
DR   EnsemblGenomes-Tr; EBT00001541707.
DR   EnsemblGenomes-Tr; EBT00001541710.
DR   EnsemblGenomes-Tr; EBT00001541712.
DR   EnsemblGenomes-Tr; EBT00001541713.
DR   EnsemblGenomes-Tr; EBT00001541714.
DR   EnsemblGenomes-Tr; EBT00001541715.
DR   EnsemblGenomes-Tr; EBT00001541717.
DR   EnsemblGenomes-Tr; EBT00001541718.
DR   EnsemblGenomes-Tr; EBT00001541719.
DR   EnsemblGenomes-Tr; EBT00001541720.
DR   EnsemblGenomes-Tr; EBT00001541721.
DR   EnsemblGenomes-Tr; EBT00001541722.
DR   EnsemblGenomes-Tr; EBT00001541723.
DR   EnsemblGenomes-Tr; EBT00001541724.
DR   EnsemblGenomes-Tr; EBT00001541725.
DR   EnsemblGenomes-Tr; EBT00001541727.
DR   EnsemblGenomes-Tr; EBT00001541728.
DR   EnsemblGenomes-Tr; EBT00001541729.
DR   EnsemblGenomes-Tr; EBT00001541730.
DR   EnsemblGenomes-Tr; EBT00001541731.
DR   EnsemblGenomes-Tr; EBT00001541732.
DR   EnsemblGenomes-Tr; EBT00001541733.
DR   EnsemblGenomes-Tr; EBT00001541735.
DR   EnsemblGenomes-Tr; EBT00001541736.
DR   EnsemblGenomes-Tr; EBT00001541737.
DR   EnsemblGenomes-Tr; EBT00001541739.
DR   EnsemblGenomes-Tr; EBT00001541741.
DR   EnsemblGenomes-Tr; EBT00001541743.
DR   EnsemblGenomes-Tr; EBT00001541744.
DR   EnsemblGenomes-Tr; EBT00001541745.
DR   EnsemblGenomes-Tr; EBT00001541747.
DR   EnsemblGenomes-Tr; EBT00001541748.
DR   EnsemblGenomes-Tr; EBT00001541749.
DR   EnsemblGenomes-Tr; EBT00001541750.
DR   EnsemblGenomes-Tr; EBT00001541751.
DR   EnsemblGenomes-Tr; EBT00001541753.
DR   EnsemblGenomes-Tr; EBT00001541754.
DR   EnsemblGenomes-Tr; EBT00001541755.
DR   EnsemblGenomes-Tr; EBT00001541756.
DR   EnsemblGenomes-Tr; EBT00001541757.
DR   EnsemblGenomes-Tr; EBT00001541759.
DR   EnsemblGenomes-Tr; EBT00001541760.
DR   EnsemblGenomes-Tr; EBT00001541761.
DR   EnsemblGenomes-Tr; EBT00001541762.
DR   EnsemblGenomes-Tr; EBT00001541763.
DR   EnsemblGenomes-Tr; EBT00001541764.
DR   EnsemblGenomes-Tr; EBT00001541765.
DR   EnsemblGenomes-Tr; EBT00001541766.
DR   EnsemblGenomes-Tr; EBT00001541767.
DR   EnsemblGenomes-Tr; EBT00001541768.
DR   EnsemblGenomes-Tr; EBT00001541769.
DR   EnsemblGenomes-Tr; EBT00001541770.
DR   EnsemblGenomes-Tr; EBT00001541772.
DR   EnsemblGenomes-Tr; EBT00001541773.
DR   EnsemblGenomes-Tr; EBT00001541774.
DR   EnsemblGenomes-Tr; EBT00001541775.
DR   EnsemblGenomes-Tr; EBT00001541776.
DR   EnsemblGenomes-Tr; EBT00001541777.
DR   EnsemblGenomes-Tr; EBT00001541778.
DR   EnsemblGenomes-Tr; EBT00001541779.
DR   EnsemblGenomes-Tr; EBT00001541780.
DR   EnsemblGenomes-Tr; EBT00001541781.
DR   EnsemblGenomes-Tr; EBT00001541782.
DR   EnsemblGenomes-Tr; EBT00001541783.
DR   EnsemblGenomes-Tr; EBT00001541785.
DR   EnsemblGenomes-Tr; EBT00001541787.
DR   EnsemblGenomes-Tr; EBT00001541788.
DR   EnsemblGenomes-Tr; EBT00001541789.
DR   EnsemblGenomes-Tr; EBT00001541790.
DR   EnsemblGenomes-Tr; EBT00001541791.
DR   EnsemblGenomes-Tr; EBT00001541793.
DR   EnsemblGenomes-Tr; EBT00001541794.
DR   EnsemblGenomes-Tr; EBT00001541795.
DR   EnsemblGenomes-Tr; EBT00001541797.
DR   EnsemblGenomes-Tr; EBT00001541798.
DR   EnsemblGenomes-Tr; EBT00001541800.
DR   EnsemblGenomes-Tr; EBT00001541803.
DR   EnsemblGenomes-Tr; EBT00001541805.
DR   EnsemblGenomes-Tr; EBT00001541807.
DR   EnsemblGenomes-Tr; EBT00001541808.
DR   EnsemblGenomes-Tr; EBT00001541810.
DR   EnsemblGenomes-Tr; EBT00001541812.
DR   EnsemblGenomes-Tr; EBT00001541814.
DR   EnsemblGenomes-Tr; EBT00001541818.
DR   EnsemblGenomes-Tr; EBT00001541820.
DR   EnsemblGenomes-Tr; EBT00001541823.
DR   EnsemblGenomes-Tr; EBT00001541826.
DR   EnsemblGenomes-Tr; EBT00001541831.
DR   EnsemblGenomes-Tr; EBT00001541832.
DR   EnsemblGenomes-Tr; EBT00001541835.
DR   EnsemblGenomes-Tr; EBT00001541837.
DR   EnsemblGenomes-Tr; EBT00001541839.
DR   EnsemblGenomes-Tr; EBT00001541841.
DR   EnsemblGenomes-Tr; EBT00001541843.
DR   EnsemblGenomes-Tr; EBT00001541845.
DR   EnsemblGenomes-Tr; EBT00001541846.
DR   EnsemblGenomes-Tr; EBT00001541849.
DR   EnsemblGenomes-Tr; EBT00001541851.
DR   EnsemblGenomes-Tr; EBT00001541853.
DR   EnsemblGenomes-Tr; EBT00001541855.
DR   EnsemblGenomes-Tr; EBT00001541857.
DR   EnsemblGenomes-Tr; EBT00001541859.
DR   EnsemblGenomes-Tr; EBT00001541861.
DR   EnsemblGenomes-Tr; EBT00001541864.
DR   EnsemblGenomes-Tr; EBT00001541867.
DR   EnsemblGenomes-Tr; EBT00001541869.
DR   EnsemblGenomes-Tr; EBT00001541870.
DR   EnsemblGenomes-Tr; EBT00001541872.
DR   EnsemblGenomes-Tr; EBT00001541874.
DR   EnsemblGenomes-Tr; EBT00001541877.
DR   EnsemblGenomes-Tr; EBT00001541879.
DR   EnsemblGenomes-Tr; EBT00001541881.
DR   EnsemblGenomes-Tr; EBT00001541883.
DR   EnsemblGenomes-Tr; EBT00001541885.
DR   EnsemblGenomes-Tr; EBT00001541887.
DR   EnsemblGenomes-Tr; EBT00001541889.
DR   EnsemblGenomes-Tr; EBT00001541891.
DR   EnsemblGenomes-Tr; EBT00001541893.
DR   EnsemblGenomes-Tr; EBT00001541895.
DR   EnsemblGenomes-Tr; EBT00001541897.
DR   EnsemblGenomes-Tr; EBT00001541900.
DR   EnsemblGenomes-Tr; EBT00001541902.
DR   EnsemblGenomes-Tr; EBT00001541904.
DR   EnsemblGenomes-Tr; EBT00001541906.
DR   EnsemblGenomes-Tr; EBT00001541908.
DR   EnsemblGenomes-Tr; EBT00001541910.
DR   EnsemblGenomes-Tr; EBT00001541912.
DR   EnsemblGenomes-Tr; EBT00001541914.
DR   EnsemblGenomes-Tr; EBT00001541917.
DR   EnsemblGenomes-Tr; EBT00001541918.
DR   EnsemblGenomes-Tr; EBT00001541921.
DR   EnsemblGenomes-Tr; EBT00001541923.
DR   EnsemblGenomes-Tr; EBT00001541925.
DR   EnsemblGenomes-Tr; EBT00001541926.
DR   EnsemblGenomes-Tr; EBT00001541928.
DR   EnsemblGenomes-Tr; EBT00001541929.
DR   EnsemblGenomes-Tr; EBT00001541931.
DR   EnsemblGenomes-Tr; EBT00001541932.
DR   EnsemblGenomes-Tr; EBT00001541934.
DR   EnsemblGenomes-Tr; EBT00001541936.
DR   EnsemblGenomes-Tr; EBT00001541939.
DR   EnsemblGenomes-Tr; EBT00001541940.
DR   EnsemblGenomes-Tr; EBT00001541941.
DR   EnsemblGenomes-Tr; EBT00001541943.
DR   EnsemblGenomes-Tr; EBT00001541945.
DR   EnsemblGenomes-Tr; EBT00001541948.
DR   EnsemblGenomes-Tr; EBT00001541950.
DR   EnsemblGenomes-Tr; EBT00001541952.
DR   EnsemblGenomes-Tr; EBT00001541954.
DR   EnsemblGenomes-Tr; EBT00001541956.
DR   EnsemblGenomes-Tr; EBT00001541958.
DR   EnsemblGenomes-Tr; EBT00001541960.
DR   EnsemblGenomes-Tr; EBT00001541962.
DR   EnsemblGenomes-Tr; EBT00001541964.
DR   EnsemblGenomes-Tr; EBT00001541967.
DR   EnsemblGenomes-Tr; EBT00001541970.
DR   EnsemblGenomes-Tr; EBT00001541972.
DR   EnsemblGenomes-Tr; EBT00001541974.
DR   EnsemblGenomes-Tr; EBT00001541978.
DR   EnsemblGenomes-Tr; EBT00001541980.
DR   EnsemblGenomes-Tr; EBT00001541981.
DR   EnsemblGenomes-Tr; EBT00001541982.
DR   EnsemblGenomes-Tr; EBT00001541984.
DR   EnsemblGenomes-Tr; EBT00001541986.
DR   EnsemblGenomes-Tr; EBT00001541988.
DR   EnsemblGenomes-Tr; EBT00001541990.
DR   EnsemblGenomes-Tr; EBT00001541993.
DR   EuropePMC; PMC2632077; 19060151.
DR   EuropePMC; PMC3815948; 21255307.
DR   EuropePMC; PMC5433235; 28515790.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; CP000227.
DR   SILVA-SSU; CP000227.
FH   Key             Location/Qualifiers
FT   source          1..5214195
FT                   /organism="Bacillus cereus Q1"
FT                   /strain="Q1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:361100"
FT   gene            408..1748
FT                   /gene="dnaA"
FT                   /locus_tag="BCQ_0001"
FT                   /note="BC0001"
FT   CDS_pept        408..1748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BCQ_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Code: L; COG: COG0593"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10530"
FT                   /db_xref="GOA:B9IYG8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYG8"
FT                   /protein_id="ACM10530.1"
FT   gene            1927..3066
FT                   /gene="dnaN"
FT                   /locus_tag="BCQ_0002"
FT                   /note="BC0002"
FT   CDS_pept        1927..3066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BCQ_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="Code: L; COG: COG0592"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10531"
FT                   /db_xref="GOA:B9IYG9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYG9"
FT                   /protein_id="ACM10531.1"
FT   gene            3182..3406
FT                   /gene="yaaA"
FT                   /locus_tag="BCQ_0003"
FT                   /note="BC0003"
FT   CDS_pept        3182..3406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="BCQ_0003"
FT                   /product="YaaA"
FT                   /note="Code: S; COG: COG2501"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10532"
FT                   /db_xref="GOA:B9IYH0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH0"
FT                   /protein_id="ACM10532.1"
FT   gene            3419..4546
FT                   /gene="recF"
FT                   /locus_tag="BCQ_0004"
FT                   /note="BC0004"
FT   CDS_pept        3419..4546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BCQ_0004"
FT                   /product="DNA replication and repair protein"
FT                   /note="Code: L; COG: COG1195"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10533"
FT                   /db_xref="GOA:B9IYH1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYH1"
FT                   /protein_id="ACM10533.1"
FT   gene            4585..6507
FT                   /gene="gyrB"
FT                   /locus_tag="BCQ_0005"
FT                   /note="BC0005"
FT   CDS_pept        4585..6507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BCQ_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="Code: L; COG: COG0187"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10534"
FT                   /db_xref="GOA:B9IYH2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH2"
FT                   /protein_id="ACM10534.1"
FT                   KNLDI"
FT   gene            6596..9067
FT                   /gene="gyrA"
FT                   /locus_tag="BCQ_0006"
FT                   /note="BC0006"
FT   CDS_pept        6596..9067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BCQ_0006"
FT                   /product="DNA topoisomerase II, ATP-hydrolyzing (DNA
FT                   gyrase, subunit A)"
FT                   /note="Code: L; COG: COG0188"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10535"
FT                   /db_xref="GOA:B9IYH3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH3"
FT                   /protein_id="ACM10535.1"
FT                   EETSEEVSSEE"
FT   gene            9338..10843
FT                   /locus_tag="BCQ_0007"
FT                   /note="BC0007"
FT   rRNA            9338..10843
FT                   /locus_tag="BCQ_0007"
FT                   /product="16S ribosomal RNA"
FT   gene            10994..11070
FT                   /locus_tag="BCQ_0008"
FT                   /note="BC0008"
FT   tRNA            10994..11070
FT                   /locus_tag="BCQ_0008"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            11079..11154
FT                   /locus_tag="BCQ_0009"
FT                   /note="BC0009"
FT   tRNA            11079..11154
FT                   /locus_tag="BCQ_0009"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            11249..14157
FT                   /locus_tag="BCQ_0010"
FT                   /note="BC0010"
FT   rRNA            11249..14157
FT                   /locus_tag="BCQ_0010"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(11273..11704)
FT                   /locus_tag="BCQ_0011"
FT                   /note="BC0011"
FT   CDS_pept        complement(11273..11704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10536"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10536.1"
FT   gene            14208..14322
FT                   /locus_tag="BCQ_0012"
FT                   /note="BC0012"
FT   rRNA            14208..14322
FT                   /locus_tag="BCQ_0012"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14359..15360)
FT                   /gene="yaaC"
FT                   /locus_tag="BCQ_0013"
FT                   /note="BC0013"
FT   CDS_pept        complement(14359..15360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BCQ_0013"
FT                   /product="YaaC"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10537"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH5"
FT                   /protein_id="ACM10537.1"
FT   gene            15476..16939
FT                   /gene="guaB"
FT                   /locus_tag="BCQ_0014"
FT                   /note="BC0014"
FT   CDS_pept        15476..16939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BCQ_0014"
FT                   /product="IMP dehydrogenase (inositol-monophosphate
FT                   dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10538"
FT                   /db_xref="GOA:B9IYH6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH6"
FT                   /protein_id="ACM10538.1"
FT   gene            17053..18360
FT                   /gene="dacA"
FT                   /locus_tag="BCQ_0015"
FT                   /note="BC0015"
FT   CDS_pept        17053..18360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BCQ_0015"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="Code: M; COG: COG1686"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10539"
FT                   /db_xref="GOA:B9IYH7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH7"
FT                   /protein_id="ACM10539.1"
FT   gene            18522..19409
FT                   /gene="pdx1"
FT                   /locus_tag="BCQ_0016"
FT                   /note="BC0016"
FT   CDS_pept        18522..19409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdx1"
FT                   /locus_tag="BCQ_0016"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase
FT                   (pyridoxine biosynthesis protein)"
FT                   /note="Code: H; COG: COG0214"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10540"
FT                   /db_xref="GOA:B9IYH8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYH8"
FT                   /protein_id="ACM10540.1"
FT                   STLLPEQRMQERGW"
FT   gene            19428..20018
FT                   /gene="guaA"
FT                   /locus_tag="BCQ_0017"
FT                   /note="BC0017"
FT   CDS_pept        19428..20018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BCQ_0017"
FT                   /product="GMP synthase, glutamine-hydrolyzing (glutamine
FT                   amidotransferase)"
FT                   /note="Code: H; COG: COG0311"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10541"
FT                   /db_xref="GOA:B9IYH9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYH9"
FT                   /protein_id="ACM10541.1"
FT   gene            20346..21620
FT                   /gene="serS"
FT                   /locus_tag="BCQ_0018"
FT                   /note="BC0018"
FT   CDS_pept        20346..21620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BCQ_0018"
FT                   /product="serine--tRNA ligase (seryl-tRNA synthetase)"
FT                   /note="Code: J; COG: COG0172"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10542"
FT                   /db_xref="GOA:B9IYI0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYI0"
FT                   /protein_id="ACM10542.1"
FT   gene            21777..21869
FT                   /locus_tag="BCQ_0019"
FT                   /note="BC0019"
FT   tRNA            21777..21869
FT                   /locus_tag="BCQ_0019"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   gene            21877..22428
FT                   /locus_tag="BCQ_0020"
FT                   /note="BC0020"
FT   CDS_pept        21877..22428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10543"
FT                   /db_xref="GOA:B9IYI1"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR024256"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI1"
FT                   /protein_id="ACM10543.1"
FT   gene            complement(22464..23132)
FT                   /gene="dck"
FT                   /locus_tag="BCQ_0021"
FT                   /note="BC0021"
FT   CDS_pept        complement(22464..23132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BCQ_0021"
FT                   /product="deoxynucleoside kinase"
FT                   /note="Code: F; COG: COG1428"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10544"
FT                   /db_xref="GOA:B9IYI2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI2"
FT                   /protein_id="ACM10544.1"
FT                   "
FT   gene            complement(23135..23770)
FT                   /gene="dgk"
FT                   /locus_tag="BCQ_0022"
FT                   /note="BC0022"
FT   CDS_pept        complement(23135..23770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BCQ_0022"
FT                   /product="deoxyguanosine kinase"
FT                   /note="Code: F; COG: COG1428"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10545"
FT                   /db_xref="GOA:B9IYI3"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI3"
FT                   /protein_id="ACM10545.1"
FT   gene            complement(23896..24435)
FT                   /locus_tag="BCQ_0023"
FT                   /note="BC0023"
FT   CDS_pept        complement(23896..24435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0023"
FT                   /product="nicotinamidase (pyrazinamidase)"
FT                   /note="Code: Q; COG: COG1335"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10546"
FT                   /db_xref="GOA:B9IYI4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI4"
FT                   /protein_id="ACM10546.1"
FT                   TILKANIVPSSQIKFN"
FT   gene            24543..25043
FT                   /locus_tag="BCQ_0024"
FT                   /note="BC0024"
FT   CDS_pept        24543..25043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0024"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="Code: FJ; COG: COG0590"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10547"
FT                   /db_xref="GOA:B9IYI5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI5"
FT                   /protein_id="ACM10547.1"
FT                   KEN"
FT   gene            25520..27034
FT                   /gene="dnaX"
FT                   /locus_tag="BCQ_0025"
FT                   /note="BC0025"
FT   CDS_pept        25520..27034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BCQ_0025"
FT                   /product="dna polymerase iii, gamma and tau subunits"
FT                   /note="Code: L; COG: COG2812"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10548"
FT                   /db_xref="GOA:B9IYI6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI6"
FT                   /protein_id="ACM10548.1"
FT   gene            27007..27207
FT                   /gene="dnaX"
FT                   /locus_tag="BCQ_0026"
FT                   /note="BC0026"
FT   CDS_pept        27007..27207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BCQ_0026"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10549"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYI7"
FT                   /protein_id="ACM10549.1"
FT   gene            27230..27559
FT                   /gene="yaaK"
FT                   /locus_tag="BCQ_0027"
FT                   /note="BC0027"
FT   CDS_pept        27230..27559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BCQ_0027"
FT                   /product="YaaK"
FT                   /note="Code: S; COG: COG0718"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10550"
FT                   /db_xref="GOA:B9IYI8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYI8"
FT                   /protein_id="ACM10550.1"
FT                   PGGMF"
FT   gene            27574..28170
FT                   /gene="recR"
FT                   /locus_tag="BCQ_0028"
FT                   /note="BC0028"
FT   CDS_pept        27574..28170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BCQ_0028"
FT                   /product="recombination protein"
FT                   /note="Code: L; COG: COG0353"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10551"
FT                   /db_xref="GOA:B9IYI9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IYI9"
FT                   /protein_id="ACM10551.1"
FT   gene            28185..28406
FT                   /gene="yaaL"
FT                   /locus_tag="BCQ_0029"
FT                   /note="BC0029"
FT   CDS_pept        28185..28406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BCQ_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10552"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYJ0"
FT                   /protein_id="ACM10552.1"
FT   gene            28599..28868
FT                   /gene="bofA"
FT                   /locus_tag="BCQ_0030"
FT                   /note="BC0030"
FT   CDS_pept        28599..28868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BCQ_0030"
FT                   /product="sigma-K factor processing regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10553"
FT                   /db_xref="GOA:B9IZA9"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZA9"
FT                   /protein_id="ACM10553.1"
FT   gene            29114..30619
FT                   /locus_tag="BCQ_0031"
FT                   /note="BC0031"
FT   rRNA            29114..30619
FT                   /locus_tag="BCQ_0031"
FT                   /product="16S ribosomal RNA"
FT   gene            30797..33705
FT                   /locus_tag="BCQ_0032"
FT                   /note="BC0032"
FT   rRNA            30797..33705
FT                   /locus_tag="BCQ_0032"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(30821..31252)
FT                   /locus_tag="BCQ_0033"
FT                   /note="BC0033"
FT   CDS_pept        complement(30821..31252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10554"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10554.1"
FT   gene            33755..33869
FT                   /locus_tag="BCQ_0034"
FT                   /note="BC0034"
FT   rRNA            33755..33869
FT                   /locus_tag="BCQ_0034"
FT                   /product="5S ribosomal RNA"
FT   gene            34061..34240
FT                   /locus_tag="BCQ_0035"
FT                   /note="BC0035"
FT   CDS_pept        34061..34240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0035"
FT                   /product="csfB protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10555"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB1"
FT                   /protein_id="ACM10555.1"
FT                   YYLKQLRKLEVSYF"
FT   gene            34313..35734
FT                   /gene="cad"
FT                   /locus_tag="BCQ_0036"
FT                   /note="BC0036"
FT   CDS_pept        34313..35734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cad"
FT                   /locus_tag="BCQ_0036"
FT                   /product="lysine decarboxylase"
FT                   /note="Code: E; COG: COG1982"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10556"
FT                   /db_xref="GOA:B9IZB2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB2"
FT                   /protein_id="ACM10556.1"
FT                   GSTKYMKVYDIESRF"
FT   gene            35736..36362
FT                   /gene="tmk"
FT                   /locus_tag="BCQ_0037"
FT                   /note="BC0037"
FT   CDS_pept        35736..36362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BCQ_0037"
FT                   /product="thymidylate kinase"
FT                   /note="Code: F; COG: COG0125"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10557"
FT                   /db_xref="GOA:B9IZB3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZB3"
FT                   /protein_id="ACM10557.1"
FT   gene            36449..37381
FT                   /gene="holB"
FT                   /locus_tag="BCQ_0038"
FT                   /note="BC0038"
FT   CDS_pept        36449..37381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BCQ_0038"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="Code: L; COG: COG0470"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10558"
FT                   /db_xref="GOA:B9IZB4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB4"
FT                   /protein_id="ACM10558.1"
FT   gene            37378..38214
FT                   /locus_tag="BCQ_0039"
FT                   /note="BC0039"
FT   CDS_pept        37378..38214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0039"
FT                   /product="signal peptidase-like protein"
FT                   /note="Code: S; COG: COG1774"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10559"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB5"
FT                   /protein_id="ACM10559.1"
FT   gene            38214..38579
FT                   /gene="yabA"
FT                   /locus_tag="BCQ_0040"
FT                   /note="BC0040"
FT   CDS_pept        38214..38579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BCQ_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4467"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10560"
FT                   /db_xref="GOA:B9IZB6"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB6"
FT                   /protein_id="ACM10560.1"
FT                   VRKEGDCLFCLSFLNKK"
FT   gene            38700..39440
FT                   /locus_tag="BCQ_0041"
FT                   /note="BC0041"
FT   CDS_pept        38700..39440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0041"
FT                   /product="Methyltransferase"
FT                   /note="Code: R; COG: COG4123"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10561"
FT                   /db_xref="GOA:B9IZB7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB7"
FT                   /protein_id="ACM10561.1"
FT   gene            39427..39717
FT                   /gene="uvrC"
FT                   /locus_tag="BCQ_0042"
FT                   /note="BC0042"
FT   CDS_pept        39427..39717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BCQ_0042"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="Code: L; COG: COG2827"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10562"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB8"
FT                   /protein_id="ACM10562.1"
FT   gene            39686..40561
FT                   /locus_tag="BCQ_0043"
FT                   /note="BC0043"
FT   CDS_pept        39686..40561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0043"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="Code: R; COG: COG0313"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10563"
FT                   /db_xref="GOA:B9IZB9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZB9"
FT                   /protein_id="ACM10563.1"
FT                   VYQIYHVDKK"
FT   gene            complement(40582..40866)
FT                   /gene="abrB"
FT                   /locus_tag="BCQ_0044"
FT                   /note="BC0044"
FT   CDS_pept        complement(40582..40866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BCQ_0044"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /note="Code: K; COG: COG2002"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10564"
FT                   /db_xref="GOA:B9IZC0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC0"
FT                   /protein_id="ACM10564.1"
FT   gene            41487..43367
FT                   /gene="metS"
FT                   /locus_tag="BCQ_0045"
FT                   /note="BC0045"
FT   CDS_pept        41487..43367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BCQ_0045"
FT                   /product="methionine--tRNA ligase (methionyl-tRNA
FT                   synthetase)"
FT                   /note="Code: J; COG: COG0143"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10565"
FT                   /db_xref="GOA:B9IZC1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC1"
FT                   /protein_id="ACM10565.1"
FT   gene            43534..44301
FT                   /gene="tatD"
FT                   /locus_tag="BCQ_0046"
FT                   /note="BC0046"
FT   CDS_pept        43534..44301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="BCQ_0046"
FT                   /product="TatD related DNase"
FT                   /note="Code: L; COG: COG0084"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10566"
FT                   /db_xref="GOA:B9IZC2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC2"
FT                   /protein_id="ACM10566.1"
FT   gene            44519..45076
FT                   /gene="rnmV"
FT                   /locus_tag="BCQ_0047"
FT                   /note="BC0047"
FT   CDS_pept        44519..45076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BCQ_0047"
FT                   /product="ribonuclease M5"
FT                   /note="Code: L; COG: COG1658"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10567"
FT                   /db_xref="GOA:B9IZC3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC3"
FT                   /protein_id="ACM10567.1"
FT   gene            45073..45951
FT                   /gene="ksgA"
FT                   /locus_tag="BCQ_0048"
FT                   /note="BC0048"
FT   CDS_pept        45073..45951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BCQ_0048"
FT                   /product="dimethyladenosine transferase"
FT                   /note="Code: J; COG: COG0030"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10568"
FT                   /db_xref="GOA:B9IZC4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZC4"
FT                   /protein_id="ACM10568.1"
FT                   LSNALVLHKLS"
FT   gene            46062..46925
FT                   /gene="yabG"
FT                   /locus_tag="BCQ_0049"
FT                   /note="BC0049"
FT   CDS_pept        46062..46925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="BCQ_0049"
FT                   /product="sporulation-specific protease YabG"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10569"
FT                   /db_xref="GOA:B9IZC5"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC5"
FT                   /protein_id="ACM10569.1"
FT                   FQHYEE"
FT   gene            47164..47424
FT                   /gene="veg"
FT                   /locus_tag="BCQ_0050"
FT                   /note="BC0050"
FT   CDS_pept        47164..47424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BCQ_0050"
FT                   /product="veg protein"
FT                   /note="Code: S; COG: COG4466"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10570"
FT                   /db_xref="GOA:B9IZC6"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC6"
FT                   /protein_id="ACM10570.1"
FT   gene            47516..47695
FT                   /gene="sspF"
FT                   /locus_tag="BCQ_0051"
FT                   /note="BC0051"
FT   CDS_pept        47516..47695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BCQ_0051"
FT                   /product="small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10571"
FT                   /db_xref="GOA:B9IZC7"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC7"
FT                   /protein_id="ACM10571.1"
FT                   AIEIAEQQLMKQNQ"
FT   gene            47883..48761
FT                   /gene="ispE"
FT                   /locus_tag="BCQ_0052"
FT                   /note="BC0052"
FT   CDS_pept        47883..48761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BCQ_0052"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase
FT                   (CMK)"
FT                   /note="Code: I; COG: COG1947"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10572"
FT                   /db_xref="GOA:B9IZC8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZC8"
FT                   /protein_id="ACM10572.1"
FT                   VRLLGERETLE"
FT   gene            48816..49664
FT                   /gene="purR"
FT                   /locus_tag="BCQ_0053"
FT                   /note="BC0053"
FT   CDS_pept        48816..49664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BCQ_0053"
FT                   /product="purine operon transcription repressor"
FT                   /note="Code: F; COG: COG0503"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10573"
FT                   /db_xref="GOA:B9IZC9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZC9"
FT                   /protein_id="ACM10573.1"
FT                   E"
FT   gene            49787..50161
FT                   /gene="purR"
FT                   /locus_tag="BCQ_0054"
FT                   /note="BC0054"
FT   CDS_pept        49787..50161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BCQ_0054"
FT                   /product="pur operon repressor"
FT                   /note="Code: J; COG: COG0251"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10574"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD0"
FT                   /protein_id="ACM10574.1"
FT   gene            50260..50607
FT                   /gene="spoVG"
FT                   /locus_tag="BCQ_0055"
FT                   /note="BC0055"
FT   CDS_pept        50260..50607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BCQ_0055"
FT                   /product="stage V sporulation protein G"
FT                   /note="Code: M; COG: COG2088"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10575"
FT                   /db_xref="GOA:B9IZD1"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD1"
FT                   /protein_id="ACM10575.1"
FT                   EEVEFEEAGAS"
FT   gene            50930..52309
FT                   /gene="gcaD"
FT                   /locus_tag="BCQ_0056"
FT                   /note="BC0056"
FT   CDS_pept        50930..52309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BCQ_0056"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="Code: M; COG: COG1207"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10576"
FT                   /db_xref="GOA:B9IZD2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZD2"
FT                   /protein_id="ACM10576.1"
FT                   S"
FT   gene            52328..53281
FT                   /gene="prs"
FT                   /locus_tag="BCQ_0057"
FT                   /note="BC0057"
FT   CDS_pept        52328..53281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BCQ_0057"
FT                   /product="ribose-phosphate diphosphokinase
FT                   (ribose-phosphate pyrophosphokinase) (RPPK) (Phosphoribosyl
FT                   pyrophosphate synthetase)"
FT                   /note="Code: FE; COG: COG0462"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10577"
FT                   /db_xref="GOA:B9IZD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD3"
FT                   /protein_id="ACM10577.1"
FT   gene            53354..53914
FT                   /gene="spoVC"
FT                   /locus_tag="BCQ_0058"
FT                   /note="BC0058"
FT   CDS_pept        53354..53914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BCQ_0058"
FT                   /product="aminoacyl-tRNA hydrolase (peptidyl-tRNA
FT                   hydrolase);stage V sporulation protein C"
FT                   /note="Code: J; COG: COG0193"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10578"
FT                   /db_xref="GOA:B9IZD4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZD4"
FT                   /protein_id="ACM10578.1"
FT   gene            53985..54209
FT                   /gene="yabK"
FT                   /locus_tag="BCQ_0059"
FT                   /note="BC0059"
FT   CDS_pept        53985..54209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="BCQ_0059"
FT                   /product="YabK"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10579"
FT                   /db_xref="GOA:B9IZD5"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD5"
FT                   /protein_id="ACM10579.1"
FT   gene            54316..57846
FT                   /gene="mfd"
FT                   /locus_tag="BCQ_0060"
FT                   /note="BC0060"
FT   CDS_pept        54316..57846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BCQ_0060"
FT                   /product="transcription-repair coupling factor"
FT                   /note="Code: LK; COG: COG1197"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10580"
FT                   /db_xref="GOA:B9IZD6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD6"
FT                   /protein_id="ACM10580.1"
FT                   PDVKKEVINA"
FT   gene            57983..58519
FT                   /gene="spoVT"
FT                   /locus_tag="BCQ_0061"
FT                   /note="BC0061"
FT   CDS_pept        57983..58519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BCQ_0061"
FT                   /product="stage V sporulation protein T"
FT                   /note="Code: K; COG: COG2002"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10581"
FT                   /db_xref="GOA:B9IZD7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD7"
FT                   /protein_id="ACM10581.1"
FT                   AVNTAASFLAKQMEQ"
FT   gene            58750..60351
FT                   /locus_tag="BCQ_0062"
FT                   /note="BC0062"
FT   CDS_pept        58750..60351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0062"
FT                   /product="stage V sporulation protein B, putative"
FT                   /note="Code: R; COG: COG2244"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10582"
FT                   /db_xref="GOA:B9IZD8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD8"
FT                   /protein_id="ACM10582.1"
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60457..61824
FT                   /gene="mazG"
FT                   /locus_tag="BCQ_0063"
FT                   /note="BC0063"
FT   CDS_pept        60457..61824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazG"
FT                   /locus_tag="BCQ_0063"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylases and
FT                   MazG nucleotide pyrophosphohydrolase domain fusion protein"
FT                   /note="Code: R; COG: COG3956"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10583"
FT                   /db_xref="GOA:B9IZD9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZD9"
FT                   /protein_id="ACM10583.1"
FT   gene            61839..62114
FT                   /gene="hslR"
FT                   /locus_tag="BCQ_0064"
FT                   /note="BC0064"
FT   CDS_pept        61839..62114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="BCQ_0064"
FT                   /product="S4 domain protein; probable heat shock protein
FT                   15"
FT                   /note="Code: J; COG: COG1188"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10584"
FT                   /db_xref="GOA:B9IZE0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE0"
FT                   /protein_id="ACM10584.1"
FT   gene            62173..62481
FT                   /gene="yabP"
FT                   /locus_tag="BCQ_0065"
FT                   /note="BC0065"
FT   CDS_pept        62173..62481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BCQ_0065"
FT                   /product="yabP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10585"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE1"
FT                   /protein_id="ACM10585.1"
FT   gene            62478..63131
FT                   /locus_tag="BCQ_0066"
FT                   /note="BC0066"
FT   CDS_pept        62478..63131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0066"
FT                   /product="spore cortex biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10586"
FT                   /db_xref="GOA:B9IZE2"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE2"
FT                   /protein_id="ACM10586.1"
FT   gene            63128..63487
FT                   /gene="divIC"
FT                   /locus_tag="BCQ_0067"
FT                   /note="BC0067"
FT   CDS_pept        63128..63487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BCQ_0067"
FT                   /product="cell division protein DIVIC"
FT                   /note="Code: D; COG: COG2919"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10587"
FT                   /db_xref="GOA:B9IZE3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE3"
FT                   /protein_id="ACM10587.1"
FT                   YFFSGKGEIIFPVSK"
FT   gene            63575..64057
FT                   /locus_tag="BCQ_0068"
FT                   /note="BC0068"
FT   CDS_pept        63575..64057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0068"
FT                   /product="S1-type RNA-binding domain protein"
FT                   /note="Code: J; COG: COG1098"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10588"
FT                   /db_xref="GOA:B9IZE4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE4"
FT                   /protein_id="ACM10588.1"
FT   gene            64218..64291
FT                   /locus_tag="BCQ_0069"
FT                   /note="BC0069"
FT   tRNA            64218..64291
FT                   /locus_tag="BCQ_0069"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            64305..64376
FT                   /locus_tag="BCQ_0070"
FT                   /note="BC0070"
FT   tRNA            64305..64376
FT                   /locus_tag="BCQ_0070"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            64729..67107
FT                   /gene="spoIIE"
FT                   /locus_tag="BCQ_0071"
FT                   /note="BC0071"
FT   CDS_pept        64729..67107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BCQ_0071"
FT                   /product="stage II sporulation protein E"
FT                   /note="Code: TK; COG: COG2208"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10589"
FT                   /db_xref="GOA:B9IZE5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE5"
FT                   /protein_id="ACM10589.1"
FT   gene            67333..68763
FT                   /gene="mesJ"
FT                   /locus_tag="BCQ_0072"
FT                   /note="BC0072"
FT   CDS_pept        67333..68763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="BCQ_0072"
FT                   /product="cell cycle protein"
FT                   /note="Code: D; COG: COG0037"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10590"
FT                   /db_xref="GOA:B9IZE6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE6"
FT                   /protein_id="ACM10590.1"
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68760..69302
FT                   /gene="hprT"
FT                   /locus_tag="BCQ_0073"
FT                   /note="BC0073"
FT   CDS_pept        68760..69302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BCQ_0073"
FT                   /product="hypoxanthine phosphoribosyltransferase
FT                   (hypoxanthine-guanine phosphoribosyltransferase)"
FT                   /note="Code: F; COG: COG0634"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10591"
FT                   /db_xref="GOA:B9IZE7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE7"
FT                   /protein_id="ACM10591.1"
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69388..71289
FT                   /gene="ftsH"
FT                   /locus_tag="BCQ_0074"
FT                   /note="BC0074"
FT   CDS_pept        69388..71289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BCQ_0074"
FT                   /product="cell division protein"
FT                   /note="Code: O; COG: COG0465"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10592"
FT                   /db_xref="GOA:B9IZE8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE8"
FT                   /protein_id="ACM10592.1"
FT   gene            71598..72305
FT                   /locus_tag="BCQ_0075"
FT                   /note="BC0075"
FT   CDS_pept        71598..72305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0075"
FT                   /product="transcriptional activator"
FT                   /note="Code: K; COG: COG1521"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10593"
FT                   /db_xref="GOA:B9IZE9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZE9"
FT                   /protein_id="ACM10593.1"
FT                   YERNANLQHEKGE"
FT   gene            72312..73187
FT                   /gene="hslO"
FT                   /locus_tag="BCQ_0076"
FT                   /note="BC0076"
FT   CDS_pept        72312..73187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BCQ_0076"
FT                   /product="33 kDa chaperonin (HSP33)"
FT                   /note="Code: O; COG: COG1281"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10594"
FT                   /db_xref="GOA:B9IZF0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZF0"
FT                   /protein_id="ACM10594.1"
FT                   EDITNLIENL"
FT   gene            73292..74215
FT                   /gene="cysK"
FT                   /locus_tag="BCQ_0077"
FT                   /note="BC0077"
FT   CDS_pept        73292..74215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BCQ_0077"
FT                   /product="cysteine synthase (cysteine synthase A)
FT                   (O-acetylserine sulfhydrylase)"
FT                   /note="Code: E; COG: COG0031"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10595"
FT                   /db_xref="GOA:B9IZF1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF1"
FT                   /protein_id="ACM10595.1"
FT   gene            74436..75833
FT                   /gene="pabB"
FT                   /locus_tag="BCQ_0078"
FT                   /note="BC0078"
FT   CDS_pept        74436..75833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BCQ_0078"
FT                   /product="anthranilate synthase, component I
FT                   (para-aminobenzoate synthase)"
FT                   /note="Code: EH; COG: COG0147"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10596"
FT                   /db_xref="GOA:B9IZF2"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF2"
FT                   /protein_id="ACM10596.1"
FT                   RSEETVR"
FT   gene            75839..76426
FT                   /gene="pabA"
FT                   /locus_tag="BCQ_0079"
FT                   /note="BC0079"
FT   CDS_pept        75839..76426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BCQ_0079"
FT                   /product="anthranilate synthase, component II
FT                   (para-aminobenzoate synthase glutamine amidotransferase,
FT                   component II )"
FT                   /note="Code: EH; COG: COG0512"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10597"
FT                   /db_xref="GOA:B9IZF3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF3"
FT                   /protein_id="ACM10597.1"
FT   gene            76420..77292
FT                   /gene="pabC"
FT                   /locus_tag="BCQ_0080"
FT                   /note="BC0080"
FT   CDS_pept        76420..77292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BCQ_0080"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /note="Code: EH; COG: COG0115"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10598"
FT                   /db_xref="GOA:B9IZF4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF4"
FT                   /protein_id="ACM10598.1"
FT                   RNELRRGDV"
FT   gene            77285..78127
FT                   /gene="sul"
FT                   /locus_tag="BCQ_0081"
FT                   /note="BC0081"
FT   CDS_pept        77285..78127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="BCQ_0081"
FT                   /product="dihydropteroate synthase (DHPS) (dihydropteroate
FT                   pyrophosphorylase)"
FT                   /note="Code: H; COG: COG0294"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10599"
FT                   /db_xref="GOA:B9IZF5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF5"
FT                   /protein_id="ACM10599.1"
FT   gene            78152..78490
FT                   /gene="folB"
FT                   /locus_tag="BCQ_0082"
FT                   /note="BC0082"
FT   CDS_pept        78152..78490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BCQ_0082"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="Code: H; COG: COG1539"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10600"
FT                   /db_xref="GOA:B9IZF6"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF6"
FT                   /protein_id="ACM10600.1"
FT                   VEITRERP"
FT   gene            78487..79002
FT                   /gene="folK"
FT                   /locus_tag="BCQ_0083"
FT                   /note="BC0083"
FT   CDS_pept        78487..79002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BCQ_0083"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase (7,8-dihydro-6-hydroxymethylpterin)"
FT                   /note="Code: H; COG: COG0801"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10601"
FT                   /db_xref="GOA:B9IZF7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF7"
FT                   /protein_id="ACM10601.1"
FT                   DAFVLFEN"
FT   gene            78954..79157
FT                   /locus_tag="BCQ_0084"
FT                   /note="BC0084"
FT   CDS_pept        78954..79157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0084"
FT                   /product="probable transcriptional regulator"
FT                   /note="Code: K; COG: COG1396"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10602"
FT                   /db_xref="GOA:B9IZF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF8"
FT                   /protein_id="ACM10602.1"
FT   gene            79205..80179
FT                   /locus_tag="BCQ_0085"
FT                   /note="BC0085"
FT   CDS_pept        79205..80179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0085"
FT                   /product="TIM-barrel protein, putative, NifR3 family"
FT                   /note="Code: J; COG: COG0042"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10603"
FT                   /db_xref="GOA:B9IZF9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZF9"
FT                   /protein_id="ACM10603.1"
FT   gene            80339..81838
FT                   /gene="lysS"
FT                   /locus_tag="BCQ_0086"
FT                   /note="BC0086"
FT   CDS_pept        80339..81838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BCQ_0086"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="Code: J; COG: COG1190"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10604"
FT                   /db_xref="GOA:B9IZG0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG0"
FT                   /protein_id="ACM10604.1"
FT   gene            82100..82273
FT                   /locus_tag="BCQ_0087"
FT                   /note="BC0087"
FT   CDS_pept        82100..82273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10605"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG1"
FT                   /protein_id="ACM10605.1"
FT                   TNFIGEFDPGSG"
FT   gene            82270..83774
FT                   /locus_tag="BCQ_0088"
FT                   /note="BC0088"
FT   rRNA            82270..83774
FT                   /locus_tag="BCQ_0088"
FT                   /product="16S ribosomal RNA"
FT   gene            83952..86861
FT                   /locus_tag="BCQ_0089"
FT                   /note="BC0089"
FT   rRNA            83952..86861
FT                   /locus_tag="BCQ_0089"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(83976..84407)
FT                   /locus_tag="BCQ_0090"
FT                   /note="BC0090"
FT   CDS_pept        complement(83976..84407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10606"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10606.1"
FT   gene            86912..87026
FT                   /locus_tag="BCQ_0091"
FT                   /note="BC0091"
FT   rRNA            86912..87026
FT                   /locus_tag="BCQ_0091"
FT                   /product="5S ribosomal RNA"
FT   gene            87234..87695
FT                   /gene="ctsR"
FT                   /locus_tag="BCQ_0092"
FT                   /note="BC0092"
FT   CDS_pept        87234..87695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BCQ_0092"
FT                   /product="transcriptional regulator"
FT                   /note="Code: K; COG: COG4463"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10607"
FT                   /db_xref="GOA:B9IZG3"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG3"
FT                   /protein_id="ACM10607.1"
FT   gene            87869..88417
FT                   /locus_tag="BCQ_0093"
FT                   /note="BC0093"
FT   CDS_pept        87869..88417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0093"
FT                   /product="UvrB/UvrC protein"
FT                   /note="Code: S; COG: COG3880"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10608"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG4"
FT                   /protein_id="ACM10608.1"
FT   gene            88422..89486
FT                   /gene="karG"
FT                   /locus_tag="BCQ_0094"
FT                   /note="BC0094"
FT   CDS_pept        88422..89486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="karG"
FT                   /locus_tag="BCQ_0094"
FT                   /product="ATP: guanido phosphotransferase family; probable
FT                   arginine kinase"
FT                   /note="Code: E; COG: COG3869"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10609"
FT                   /db_xref="GOA:B9IZG5"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZG5"
FT                   /protein_id="ACM10609.1"
FT                   RATLIRERLRIEKN"
FT   gene            89509..91944
FT                   /gene="clpC"
FT                   /locus_tag="BCQ_0095"
FT                   /note="BC0095"
FT   CDS_pept        89509..91944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BCQ_0095"
FT                   /product="negative regulator of genetic competence
FT                   clpC/mecB (ATP-dependent Clp protease)"
FT                   /note="Code: O; COG: COG0542"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10610"
FT                   /db_xref="GOA:B9IZG6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG6"
FT                   /protein_id="ACM10610.1"
FT   gene            92041..93417
FT                   /gene="radA"
FT                   /locus_tag="BCQ_0096"
FT                   /note="BC0096"
FT   CDS_pept        92041..93417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BCQ_0096"
FT                   /product="DNA repair protein"
FT                   /note="Code: O; COG: COG1066"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10611"
FT                   /db_xref="GOA:B9IZG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG7"
FT                   /protein_id="ACM10611.1"
FT                   "
FT   gene            93421..94494
FT                   /locus_tag="BCQ_0097"
FT                   /note="BC0097"
FT   CDS_pept        93421..94494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0097"
FT                   /product="DNA-binding protein"
FT                   /note="Code: R; COG: COG1623"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10612"
FT                   /db_xref="GOA:B9IZG8"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZG8"
FT                   /protein_id="ACM10612.1"
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94655..95764
FT                   /locus_tag="BCQ_0098"
FT                   /note="BC0098"
FT   CDS_pept        94655..95764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG4956"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10613"
FT                   /db_xref="GOA:B9IZG9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZG9"
FT                   /protein_id="ACM10613.1"
FT   gene            95781..96461
FT                   /gene="ispD"
FT                   /locus_tag="BCQ_0099"
FT                   /note="BC0099"
FT   CDS_pept        95781..96461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BCQ_0099"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="Code: I; COG: COG1211"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10614"
FT                   /db_xref="GOA:B9IZH0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH0"
FT                   /protein_id="ACM10614.1"
FT                   VQKK"
FT   gene            96577..97053
FT                   /gene="ispF"
FT                   /locus_tag="BCQ_0100"
FT                   /note="BC0100"
FT   CDS_pept        96577..97053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BCQ_0100"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase (MECDP-synthase)"
FT                   /note="Code: I; COG: COG0245"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10615"
FT                   /db_xref="GOA:B9IZH1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZH1"
FT                   /protein_id="ACM10615.1"
FT   gene            97143..98600
FT                   /gene="gltX"
FT                   /locus_tag="BCQ_0101"
FT                   /note="BC0101"
FT   CDS_pept        97143..98600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BCQ_0101"
FT                   /product="glutamate--tRNA ligase (glutamyl-tRNA
FT                   synthetase)"
FT                   /note="Code: J; COG: COG0008"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10616"
FT                   /db_xref="GOA:B9IZH2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH2"
FT                   /protein_id="ACM10616.1"
FT   gene            99032..99697
FT                   /gene="cysE"
FT                   /locus_tag="BCQ_0102"
FT                   /note="BC0102"
FT   CDS_pept        99032..99697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BCQ_0102"
FT                   /product="serine O-acetyltransferase"
FT                   /note="Code: E; COG: COG1045"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10617"
FT                   /db_xref="GOA:B9IZH3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH3"
FT                   /protein_id="ACM10617.1"
FT   gene            99678..101075
FT                   /gene="cysS"
FT                   /locus_tag="BCQ_0103"
FT                   /note="BC0103"
FT   CDS_pept        99678..101075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BCQ_0103"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="Code: J; COG: COG0215"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10618"
FT                   /db_xref="GOA:B9IZH4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZH4"
FT                   /protein_id="ACM10618.1"
FT                   GTRWKRG"
FT   gene            101078..101485
FT                   /gene="yazC"
FT                   /locus_tag="BCQ_0104"
FT                   /note="BC0104"
FT   CDS_pept        101078..101485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazC"
FT                   /locus_tag="BCQ_0104"
FT                   /product="YazC"
FT                   /note="Code: S; COG: COG1939"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10619"
FT                   /db_xref="GOA:B9IZH5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH5"
FT                   /protein_id="ACM10619.1"
FT   gene            101482..102225
FT                   /locus_tag="BCQ_0105"
FT                   /note="BC0105"
FT   CDS_pept        101482..102225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0105"
FT                   /product="tRNA/rRNA methyltransferase (SpoU); probable TrmH
FT                   family"
FT                   /note="Code: J; COG: COG0566"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10620"
FT                   /db_xref="GOA:B9IZH6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH6"
FT                   /protein_id="ACM10620.1"
FT   gene            102229..102741
FT                   /gene="yacP"
FT                   /locus_tag="BCQ_0106"
FT                   /note="BC0106"
FT   CDS_pept        102229..102741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="BCQ_0106"
FT                   /product="YacP"
FT                   /note="Code: R; COG: COG3688"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10621"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH7"
FT                   /protein_id="ACM10621.1"
FT                   KLRRGER"
FT   gene            102809..103465
FT                   /gene="spo0H"
FT                   /locus_tag="BCQ_0107"
FT                   /note="BC0107"
FT   CDS_pept        102809..103465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0H"
FT                   /locus_tag="BCQ_0107"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="Code: K; COG: COG1595"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10622"
FT                   /db_xref="GOA:B9IZH8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH8"
FT                   /protein_id="ACM10622.1"
FT   gene            103776..103955
FT                   /gene="secE"
FT                   /locus_tag="BCQ_0108"
FT                   /note="BC0108"
FT   CDS_pept        103776..103955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BCQ_0108"
FT                   /product="preprotein translocase secE subunit"
FT                   /note="Code: U; COG: COG0690"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10623"
FT                   /db_xref="GOA:B9IZH9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZH9"
FT                   /protein_id="ACM10623.1"
FT                   VDMGISSLIRLILG"
FT   gene            104087..104620
FT                   /gene="nusG"
FT                   /locus_tag="BCQ_0109"
FT                   /note="BC0109"
FT   CDS_pept        104087..104620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BCQ_0109"
FT                   /product="transcription antitermination factor"
FT                   /note="Code: K; COG: COG0250"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10624"
FT                   /db_xref="GOA:B9IZI0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZI0"
FT                   /protein_id="ACM10624.1"
FT                   ETPVELDFHQIEKL"
FT   gene            104809..105213
FT                   /gene="rplK"
FT                   /locus_tag="BCQ_0110"
FT                   /note="BC0110"
FT   CDS_pept        104809..105213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BCQ_0110"
FT                   /product="ribosomal protein L11 (50S ribosomal protein
FT                   L11)"
FT                   /note="Code: J; COG: COG0080"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10625"
FT                   /db_xref="GOA:B9IZI1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZI1"
FT                   /protein_id="ACM10625.1"
FT   gene            105391..106083
FT                   /gene="rplA"
FT                   /locus_tag="BCQ_0111"
FT                   /note="BC0111"
FT   CDS_pept        105391..106083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BCQ_0111"
FT                   /product="ribosomal protein L1 (50S ribosomal protein L1)"
FT                   /note="Code: J; COG: COG0081"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10626"
FT                   /db_xref="GOA:B9IZI2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZI2"
FT                   /protein_id="ACM10626.1"
FT                   RVDVSTLA"
FT   gene            106316..106816
FT                   /gene="rplJ"
FT                   /locus_tag="BCQ_0112"
FT                   /note="BC0112"
FT   CDS_pept        106316..106816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BCQ_0112"
FT                   /product="ribosomal protein L10 (50S ribosomal protein
FT                   L10)"
FT                   /note="Code: J; COG: COG0244"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10627"
FT                   /db_xref="GOA:B9IZI3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZI3"
FT                   /protein_id="ACM10627.1"
FT                   QGA"
FT   gene            106884..107243
FT                   /gene="rplL"
FT                   /locus_tag="BCQ_0113"
FT                   /note="BC0113"
FT   CDS_pept        106884..107243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BCQ_0113"
FT                   /product="ribosomal protein L7/L12 (50S ribosomal protein
FT                   L7/L12)"
FT                   /note="Code: J; COG: COG0222"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10628"
FT                   /db_xref="GOA:B9IZI4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZI4"
FT                   /protein_id="ACM10628.1"
FT                   IKAKLEEVGAAVEVK"
FT   gene            107320..107919
FT                   /locus_tag="BCQ_0114"
FT                   /note="BC0114"
FT   CDS_pept        107320..107919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0114"
FT                   /product="ybxB protein"
FT                   /note="Code: J; COG: COG2813"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10629"
FT                   /db_xref="GOA:B9IZI5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZI5"
FT                   /protein_id="ACM10629.1"
FT   gene            108212..111745
FT                   /gene="rpoB"
FT                   /locus_tag="BCQ_0115"
FT                   /note="BC0115"
FT   CDS_pept        108212..111745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BCQ_0115"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="Code: K; COG: COG0085"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10630"
FT                   /db_xref="GOA:B9IZI6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZI6"
FT                   /protein_id="ACM10630.1"
FT                   KLNVEVETTKE"
FT   gene            111810..115394
FT                   /gene="rpoC"
FT                   /locus_tag="BCQ_0116"
FT                   /note="BC0116"
FT   CDS_pept        111810..115394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BCQ_0116"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="Code: K; COG: COG0086"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10631"
FT                   /db_xref="GOA:B9IZI7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZI7"
FT                   /protein_id="ACM10631.1"
FT   gene            115475..115756
FT                   /locus_tag="BCQ_0117"
FT                   /note="BC0117"
FT   CDS_pept        115475..115756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0117"
FT                   /product="ribosomal protein, L7Ae family (50S ribosomal
FT                   protein)"
FT                   /note="Code: J; COG: COG1358"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10632"
FT                   /db_xref="GOA:B9IZI8"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZI8"
FT                   /protein_id="ACM10632.1"
FT   gene            115871..116293
FT                   /gene="rpsl"
FT                   /locus_tag="BCQ_0118"
FT                   /note="BC0118"
FT   CDS_pept        115871..116293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsl"
FT                   /locus_tag="BCQ_0118"
FT                   /product="ribosomal protein S12 (30S ribosomal protein
FT                   S12)"
FT                   /note="Code: J; COG: COG0048"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10633"
FT                   /db_xref="GOA:B9IZI9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZI9"
FT                   /protein_id="ACM10633.1"
FT   gene            116323..116793
FT                   /gene="rpsG"
FT                   /locus_tag="BCQ_0119"
FT                   /note="BC0119"
FT   CDS_pept        116323..116793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BCQ_0119"
FT                   /product="ribosomal protein S7 (30S ribosomal protein S7)"
FT                   /note="Code: J; COG: COG0049"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10634"
FT                   /db_xref="GOA:B9IZJ0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ0"
FT                   /protein_id="ACM10634.1"
FT   gene            117002..119080
FT                   /gene="fusA"
FT                   /locus_tag="BCQ_0120"
FT                   /note="BC0120"
FT   CDS_pept        117002..119080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BCQ_0120"
FT                   /product="protein-synthesizing GTPase (translation
FT                   elongation factor G (EF-G))"
FT                   /note="Code: J; COG: COG0480"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10635"
FT                   /db_xref="GOA:B9IZJ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ1"
FT                   /protein_id="ACM10635.1"
FT   gene            119198..120385
FT                   /gene="tuf"
FT                   /locus_tag="BCQ_0121"
FT                   /note="BC0121"
FT   CDS_pept        119198..120385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BCQ_0121"
FT                   /product="translation elongation factor Tu"
FT                   /note="Code: J; COG: COG0050"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10636"
FT                   /db_xref="GOA:B9IZJ2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ2"
FT                   /protein_id="ACM10636.1"
FT   gene            120786..121094
FT                   /gene="rpsJ"
FT                   /locus_tag="BCQ_0122"
FT                   /note="BC0122"
FT   CDS_pept        120786..121094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BCQ_0122"
FT                   /product="ribosomal protein S10 (30S ribosomal protein
FT                   S10)"
FT                   /note="Code: J; COG: COG0051"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10637"
FT                   /db_xref="GOA:B9IZJ3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ3"
FT                   /protein_id="ACM10637.1"
FT   gene            121129..121761
FT                   /gene="rplC"
FT                   /locus_tag="BCQ_0123"
FT                   /note="BC0123"
FT   CDS_pept        121129..121761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BCQ_0123"
FT                   /product="ribosomal protein L3 (50S ribosomal protein L3)"
FT                   /note="Code: J; COG: COG0087"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10638"
FT                   /db_xref="GOA:B9IZJ4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ4"
FT                   /protein_id="ACM10638.1"
FT   gene            121787..122410
FT                   /gene="rplD"
FT                   /locus_tag="BCQ_0124"
FT                   /note="BC0124"
FT   CDS_pept        121787..122410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BCQ_0124"
FT                   /product="ribosomal protein L4 (50S ribosomal protein L4)"
FT                   /note="Code: J; COG: COG0088"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10639"
FT                   /db_xref="GOA:B9IZJ5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ5"
FT                   /protein_id="ACM10639.1"
FT   gene            122410..122700
FT                   /gene="rplW"
FT                   /locus_tag="BCQ_0125"
FT                   /note="BC0125"
FT   CDS_pept        122410..122700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BCQ_0125"
FT                   /product="ribosomal protein L23 (50S ribosomal protein
FT                   L23)"
FT                   /note="Code: J; COG: COG0089"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10640"
FT                   /db_xref="GOA:B9IZJ6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ6"
FT                   /protein_id="ACM10640.1"
FT   gene            122729..123559
FT                   /gene="rplB"
FT                   /locus_tag="BCQ_0126"
FT                   /note="BC0126"
FT   CDS_pept        122729..123559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BCQ_0126"
FT                   /product="ribosomal protein L2 (50S ribosomal protein L2)"
FT                   /note="Code: J; COG: COG0090"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10641"
FT                   /db_xref="GOA:B9IZJ7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ7"
FT                   /protein_id="ACM10641.1"
FT   gene            123620..123898
FT                   /gene="rpsS"
FT                   /locus_tag="BCQ_0127"
FT                   /note="BC0127"
FT   CDS_pept        123620..123898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BCQ_0127"
FT                   /product="ribosomal protein S19 (30S ribosomal protein
FT                   S19)"
FT                   /note="Code: J; COG: COG0185"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10642"
FT                   /db_xref="GOA:B9IZJ8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ8"
FT                   /protein_id="ACM10642.1"
FT   gene            123916..124257
FT                   /gene="rplV"
FT                   /locus_tag="BCQ_0128"
FT                   /note="BC0128"
FT   CDS_pept        123916..124257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BCQ_0128"
FT                   /product="ribosomal protein L22"
FT                   /note="Code: J; COG: COG0091"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10643"
FT                   /db_xref="GOA:B9IZJ9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZJ9"
FT                   /protein_id="ACM10643.1"
FT                   VVVSEKKEG"
FT   gene            124261..124920
FT                   /gene="rpsC"
FT                   /locus_tag="BCQ_0129"
FT                   /note="BC0129"
FT   CDS_pept        124261..124920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BCQ_0129"
FT                   /product="ribosomal protein S3 (30S ribosomal protein S3)"
FT                   /note="Code: J; COG: COG0092"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10644"
FT                   /db_xref="GOA:B9IZK0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZK0"
FT                   /protein_id="ACM10644.1"
FT   gene            124922..125356
FT                   /gene="rplP"
FT                   /locus_tag="BCQ_0130"
FT                   /note="BC0130"
FT   CDS_pept        124922..125356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BCQ_0130"
FT                   /product="ribosomal protein L16"
FT                   /note="Code: J; COG: COG0197"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10645"
FT                   /db_xref="GOA:B9IZK1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK1"
FT                   /protein_id="ACM10645.1"
FT   gene            125331..125546
FT                   /gene="rpmC"
FT                   /locus_tag="BCQ_0131"
FT                   /note="BC0131"
FT   CDS_pept        125331..125546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BCQ_0131"
FT                   /product="ribosomal protein L29 (50S ribosomal protein
FT                   L29)"
FT                   /note="Code: J; COG: COG0255"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10646"
FT                   /db_xref="GOA:B9IZK2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZK2"
FT                   /protein_id="ACM10646.1"
FT   gene            125567..125830
FT                   /gene="rpsQ"
FT                   /locus_tag="BCQ_0132"
FT                   /note="BC0132"
FT   CDS_pept        125567..125830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BCQ_0132"
FT                   /product="ribosomal protein S17 (30S ribosomal protein
FT                   S17)"
FT                   /note="Code: J; COG: COG0186"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10647"
FT                   /db_xref="GOA:B9IZK3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK3"
FT                   /protein_id="ACM10647.1"
FT   gene            125874..126242
FT                   /gene="rplN"
FT                   /locus_tag="BCQ_0133"
FT                   /note="BC0133"
FT   CDS_pept        125874..126242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BCQ_0133"
FT                   /product="ribosomal protein L14 (50S ribosomal protein
FT                   L14)"
FT                   /note="Code: J; COG: COG0093"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10648"
FT                   /db_xref="GOA:B9IZK4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK4"
FT                   /protein_id="ACM10648.1"
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126281..126592
FT                   /gene="rplX"
FT                   /locus_tag="BCQ_0134"
FT                   /note="BC0134"
FT   CDS_pept        126281..126592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BCQ_0134"
FT                   /product="ribosomal protein L24 (50S ribosomal protein
FT                   L24)"
FT                   /note="Code: J; COG: COG0198"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10649"
FT                   /db_xref="GOA:B9IZK5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK5"
FT                   /protein_id="ACM10649.1"
FT   gene            126619..127158
FT                   /gene="rplE"
FT                   /locus_tag="BCQ_0135"
FT                   /note="BC0135"
FT   CDS_pept        126619..127158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BCQ_0135"
FT                   /product="ribosomal protein L5"
FT                   /note="Code: J; COG: COG0094"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10650"
FT                   /db_xref="GOA:B9IZK6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK6"
FT                   /protein_id="ACM10650.1"
FT                   EEARELLTQFGMPFQK"
FT   gene            127207..127377
FT                   /gene="rpsN"
FT                   /locus_tag="BCQ_0136"
FT                   /note="BC0136"
FT   CDS_pept        127207..127377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BCQ_0136"
FT                   /product="ribosomal protein S14 (30S ribosomal protein
FT                   S14)"
FT                   /note="Code: J; COG: COG0199"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10651"
FT                   /db_xref="GOA:B9IZK7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZK7"
FT                   /protein_id="ACM10651.1"
FT                   GQIPGVKKASW"
FT   gene            127407..127805
FT                   /gene="rpsH"
FT                   /locus_tag="BCQ_0137"
FT                   /note="BC0137"
FT   CDS_pept        127407..127805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BCQ_0137"
FT                   /product="ribosomal protein S8 (30S ribosomal protein S8)"
FT                   /note="Code: J; COG: COG0096"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10652"
FT                   /db_xref="GOA:B9IZK8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZK8"
FT                   /protein_id="ACM10652.1"
FT   gene            127838..128377
FT                   /gene="rplF"
FT                   /locus_tag="BCQ_0138"
FT                   /note="BC0138"
FT   CDS_pept        127838..128377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BCQ_0138"
FT                   /product="ribosomal protein L6 (50S ribosomal protein L6)"
FT                   /note="Code: J; COG: COG0097"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10653"
FT                   /db_xref="GOA:B9IZK9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZK9"
FT                   /protein_id="ACM10653.1"
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128409..128771
FT                   /gene="rplR"
FT                   /locus_tag="BCQ_0139"
FT                   /note="BC0139"
FT   CDS_pept        128409..128771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BCQ_0139"
FT                   /product="ribosomal protein L18 (50S ribosomal protein
FT                   L18)"
FT                   /note="Code: J; COG: COG0256"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10654"
FT                   /db_xref="GOA:B9IZL0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL0"
FT                   /protein_id="ACM10654.1"
FT                   RVKALAEAAREAGLQF"
FT   gene            128793..129293
FT                   /gene="rplR"
FT                   /locus_tag="BCQ_0140"
FT                   /note="BC0140"
FT   CDS_pept        128793..129293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BCQ_0140"
FT                   /product="ribosomal protein L18 (50S ribosomal protein
FT                   L18)"
FT                   /note="Code: J; COG: COG0098"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10655"
FT                   /db_xref="GOA:B9IZL1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZL1"
FT                   /protein_id="ACM10655.1"
FT                   LLG"
FT   gene            129307..129489
FT                   /gene="rpmD"
FT                   /locus_tag="BCQ_0141"
FT                   /note="BC0141"
FT   CDS_pept        129307..129489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BCQ_0141"
FT                   /product="ribosomal protein L30 (50S ribosomal protein
FT                   L30)"
FT                   /note="Code: J; COG: COG1841"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10656"
FT                   /db_xref="GOA:B9IZL2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL2"
FT                   /protein_id="ACM10656.1"
FT                   GMINKVSHLVTVKEA"
FT   gene            129523..129963
FT                   /gene="rplO"
FT                   /locus_tag="BCQ_0142"
FT                   /note="BC0142"
FT   CDS_pept        129523..129963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BCQ_0142"
FT                   /product="ribosomal protein L15 (50S ribosomal protein
FT                   L15)"
FT                   /note="Code: J; COG: COG0200"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10657"
FT                   /db_xref="GOA:B9IZL3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL3"
FT                   /protein_id="ACM10657.1"
FT   gene            129963..131264
FT                   /gene="secY"
FT                   /locus_tag="BCQ_0143"
FT                   /note="BC0143"
FT   CDS_pept        129963..131264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BCQ_0143"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="Code: U; COG: COG0201"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10658"
FT                   /db_xref="GOA:B9IZL4"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZL4"
FT                   /protein_id="ACM10658.1"
FT   gene            131321..131971
FT                   /gene="adk"
FT                   /locus_tag="BCQ_0144"
FT                   /note="BC0144"
FT   CDS_pept        131321..131971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BCQ_0144"
FT                   /product="adenylate kinase"
FT                   /note="Code: F; COG: COG0563"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10659"
FT                   /db_xref="GOA:B9IZL5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL5"
FT                   /protein_id="ACM10659.1"
FT   gene            131971..132717
FT                   /gene="map"
FT                   /locus_tag="BCQ_0145"
FT                   /note="BC0145"
FT   CDS_pept        131971..132717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BCQ_0145"
FT                   /product="methionyl aminopeptidase"
FT                   /note="Code: J; COG: COG0024"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10660"
FT                   /db_xref="GOA:B9IZL6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZL6"
FT                   /protein_id="ACM10660.1"
FT   gene            132786..133004
FT                   /gene="infA"
FT                   /locus_tag="BCQ_0146"
FT                   /note="BC0146"
FT   CDS_pept        132786..133004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BCQ_0146"
FT                   /product="protein-synthesizing GTPase (initiation factor
FT                   IF-I)"
FT                   /note="Code: J; COG: COG0361"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10661"
FT                   /db_xref="GOA:B9IZL7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZL7"
FT                   /protein_id="ACM10661.1"
FT   gene            133040..133153
FT                   /gene="rpmJ"
FT                   /locus_tag="BCQ_0147"
FT                   /note="BC0147"
FT   CDS_pept        133040..133153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BCQ_0147"
FT                   /product="ribosomal protein L36"
FT                   /note="Code: J; COG: COG0257"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10662"
FT                   /db_xref="GOA:B9IZL8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL8"
FT                   /protein_id="ACM10662.1"
FT   gene            133175..133540
FT                   /gene="rpsM"
FT                   /locus_tag="BCQ_0148"
FT                   /note="BC0148"
FT   CDS_pept        133175..133540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BCQ_0148"
FT                   /product="ribosomal protein S13"
FT                   /note="Code: J; COG: COG0099"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10663"
FT                   /db_xref="GOA:B9IZL9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZL9"
FT                   /protein_id="ACM10663.1"
FT                   NARTRKGPRRTVANKKK"
FT   gene            133565..133954
FT                   /gene="rpsK"
FT                   /locus_tag="BCQ_0149"
FT                   /note="BC0149"
FT   CDS_pept        133565..133954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BCQ_0149"
FT                   /product="ribosomal protein S11 (30A ribosomal protein
FT                   S11)"
FT                   /note="Code: J; COG: COG0100"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10664"
FT                   /db_xref="GOA:B9IZM0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZM0"
FT                   /protein_id="ACM10664.1"
FT   gene            134135..135079
FT                   /gene="rpoA"
FT                   /locus_tag="BCQ_0150"
FT                   /note="BC0150"
FT   CDS_pept        134135..135079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BCQ_0150"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="Code: K; COG: COG0202"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10665"
FT                   /db_xref="GOA:B9IZM1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM1"
FT                   /protein_id="ACM10665.1"
FT   gene            135115..135477
FT                   /gene="rplQ"
FT                   /locus_tag="BCQ_0151"
FT                   /note="BC0151"
FT   CDS_pept        135115..135477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BCQ_0151"
FT                   /product="ribosomal protein L17 (50S ribosomal protein
FT                   L17)"
FT                   /note="Code: J; COG: COG0203"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10666"
FT                   /db_xref="GOA:B9IZM2"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZM2"
FT                   /protein_id="ACM10666.1"
FT                   GPRRGDAAPMVIIELV"
FT   gene            135521..136423
FT                   /locus_tag="BCQ_0152"
FT                   /note="BC0152"
FT   CDS_pept        135521..136423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0152"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: P; COG: COG1122"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10667"
FT                   /db_xref="GOA:B9IZM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM3"
FT                   /protein_id="ACM10667.1"
FT   gene            136399..137280
FT                   /locus_tag="BCQ_0153"
FT                   /note="BC0153"
FT   CDS_pept        136399..137280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0153"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: P; COG: COG1122"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10668"
FT                   /db_xref="GOA:B9IZM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM4"
FT                   /protein_id="ACM10668.1"
FT                   VLRKGGHESCSS"
FT   gene            137268..138062
FT                   /locus_tag="BCQ_0154"
FT                   /note="BC0154"
FT   CDS_pept        137268..138062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0154"
FT                   /product="ABC transporter, permease; possible cobalt
FT                   transport protein"
FT                   /note="Code: P; COG: COG0619"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10669"
FT                   /db_xref="GOA:B9IZM5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM5"
FT                   /protein_id="ACM10669.1"
FT   gene            138077..138820
FT                   /gene="truA"
FT                   /locus_tag="BCQ_0155"
FT                   /note="BC0155"
FT   CDS_pept        138077..138820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BCQ_0155"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="Code: J; COG: COG0101"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10670"
FT                   /db_xref="GOA:B9IZM6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM6"
FT                   /protein_id="ACM10670.1"
FT   gene            138973..139410
FT                   /gene="rplM"
FT                   /locus_tag="BCQ_0156"
FT                   /note="BC0156"
FT   CDS_pept        138973..139410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BCQ_0156"
FT                   /product="ribosomal protein L13 (50S ribosomal protein
FT                   L13)"
FT                   /note="Code: J; COG: COG0102"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10671"
FT                   /db_xref="GOA:B9IZM7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZM7"
FT                   /protein_id="ACM10671.1"
FT   gene            139432..139824
FT                   /gene="rpsI"
FT                   /locus_tag="BCQ_0157"
FT                   /note="BC0157"
FT   CDS_pept        139432..139824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BCQ_0157"
FT                   /product="ribosomal protein S9"
FT                   /note="Code: J; COG: COG0103"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10672"
FT                   /db_xref="GOA:B9IZM8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9IZM8"
FT                   /protein_id="ACM10672.1"
FT   gene            139986..140414
FT                   /gene="ybaK"
FT                   /locus_tag="BCQ_0158"
FT                   /note="BC0158"
FT   CDS_pept        139986..140414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BCQ_0158"
FT                   /product="YbaK"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10673"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZM9"
FT                   /protein_id="ACM10673.1"
FT   gene            140481..141194
FT                   /gene="cwlD"
FT                   /locus_tag="BCQ_0159"
FT                   /note="BC0159"
FT   CDS_pept        140481..141194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BCQ_0159"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Code: M; COG: COG0860"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10674"
FT                   /db_xref="GOA:B9IZN0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZN0"
FT                   /protein_id="ACM10674.1"
FT                   RGILRYFTEKGNPPE"
FT   gene            141339..142406
FT                   /gene="mrp"
FT                   /locus_tag="BCQ_0160"
FT                   /note="BC0160"
FT   CDS_pept        141339..142406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="BCQ_0160"
FT                   /product="ATP-binding protein; Mrp protein"
FT                   /note="Code: D; COG: COG0489"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10675"
FT                   /db_xref="GOA:B9IZN1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9IZN1"
FT                   /protein_id="ACM10675.1"
FT                   TIAEAVIDKTTVAQK"
FT   gene            complement(142463..143080)
FT                   /gene="gerD"
FT                   /locus_tag="BCQ_0161"
FT                   /note="BC0161"
FT   CDS_pept        complement(142463..143080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BCQ_0161"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10676"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E2"
FT                   /protein_id="ACM10676.1"
FT   gene            143220..143831
FT                   /gene="kbaA"
FT                   /locus_tag="BCQ_0162"
FT                   /note="BC0162"
FT   CDS_pept        143220..143831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BCQ_0162"
FT                   /product="kinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10677"
FT                   /db_xref="GOA:B9J0E3"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E3"
FT                   /protein_id="ACM10677.1"
FT   gene            complement(143936..144700)
FT                   /gene="cda1"
FT                   /locus_tag="BCQ_0163"
FT                   /note="BC0163"
FT   CDS_pept        complement(143936..144700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cda1"
FT                   /locus_tag="BCQ_0163"
FT                   /product="probable xylanase/chitin deacetylase"
FT                   /note="Code: G; COG: COG0726"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10678"
FT                   /db_xref="GOA:B9J0E4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E4"
FT                   /protein_id="ACM10678.1"
FT   gene            144871..145089
FT                   /locus_tag="BCQ_0164"
FT                   /note="BC0164"
FT   CDS_pept        144871..145089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10679"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E5"
FT                   /protein_id="ACM10679.1"
FT   gene            145343..146847
FT                   /locus_tag="BCQ_0165"
FT                   /note="BC0165"
FT   rRNA            145343..146847
FT                   /locus_tag="BCQ_0165"
FT                   /product="16S ribosomal RNA"
FT   gene            147025..149933
FT                   /locus_tag="BCQ_0166"
FT                   /note="BC0166"
FT   rRNA            147025..149933
FT                   /locus_tag="BCQ_0166"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(147049..147480)
FT                   /locus_tag="BCQ_0167"
FT                   /note="BC0167"
FT   CDS_pept        complement(147049..147480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10680"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10680.1"
FT   gene            150022..150132
FT                   /locus_tag="BCQ_0168"
FT                   /note="BC0168"
FT   rRNA            150022..150132
FT                   /locus_tag="BCQ_0168"
FT                   /product="5S ribosomal RNA"
FT   gene            150145..150219
FT                   /locus_tag="BCQ_0169"
FT                   /note="BC0169"
FT   tRNA            150145..150219
FT                   /locus_tag="BCQ_0169"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            150224..150296
FT                   /locus_tag="BCQ_0170"
FT                   /note="BC0170"
FT   tRNA            150224..150296
FT                   /locus_tag="BCQ_0170"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   gene            150321..150395
FT                   /locus_tag="BCQ_0171"
FT                   /note="BC0171"
FT   tRNA            150321..150395
FT                   /locus_tag="BCQ_0171"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            150401..150476
FT                   /locus_tag="BCQ_0172"
FT                   /note="BC0172"
FT   tRNA            150401..150476
FT                   /locus_tag="BCQ_0172"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            150494..150577
FT                   /locus_tag="BCQ_0173"
FT                   /note="BC0173"
FT   tRNA            150494..150577
FT                   /locus_tag="BCQ_0173"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            150643..150717
FT                   /locus_tag="BCQ_0174"
FT                   /note="BC0174"
FT   tRNA            150643..150717
FT                   /locus_tag="BCQ_0174"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            150723..150798
FT                   /locus_tag="BCQ_0175"
FT                   /note="BC0175"
FT   tRNA            150723..150798
FT                   /locus_tag="BCQ_0175"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            150804..150875
FT                   /locus_tag="BCQ_0176"
FT                   /note="BC0176"
FT   tRNA            150804..150875
FT                   /locus_tag="BCQ_0176"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            150886..150958
FT                   /locus_tag="BCQ_0177"
FT                   /note="BC0177"
FT   tRNA            150886..150958
FT                   /locus_tag="BCQ_0177"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            151075..152220
FT                   /gene="garK"
FT                   /locus_tag="BCQ_0178"
FT                   /note="BC0178"
FT   CDS_pept        151075..152220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="BCQ_0178"
FT                   /product="glycerate kinase"
FT                   /note="Code: G; COG: COG1929"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10681"
FT                   /db_xref="GOA:B9J0E7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E7"
FT                   /protein_id="ACM10681.1"
FT   gene            152430..153323
FT                   /gene="rocF"
FT                   /locus_tag="BCQ_0179"
FT                   /note="BC0179"
FT   CDS_pept        152430..153323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BCQ_0179"
FT                   /product="arginase"
FT                   /note="Code: E; COG: COG0010"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10682"
FT                   /db_xref="GOA:B9J0E8"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E8"
FT                   /protein_id="ACM10682.1"
FT                   TTAVALMGSLFGEKLK"
FT   gene            153573..154394
FT                   /gene="ybbP"
FT                   /locus_tag="BCQ_0180"
FT                   /note="BC0180"
FT   CDS_pept        153573..154394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="BCQ_0180"
FT                   /product="YbbP"
FT                   /note="Code: S; COG: COG1624"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10683"
FT                   /db_xref="GOA:B9J0E9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0E9"
FT                   /protein_id="ACM10683.1"
FT   gene            154387..155874
FT                   /gene="ybbR"
FT                   /locus_tag="BCQ_0181"
FT                   /note="BC0181"
FT   CDS_pept        154387..155874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="BCQ_0181"
FT                   /product="YbbR"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10684"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F0"
FT                   /protein_id="ACM10684.1"
FT   gene            155867..157213
FT                   /gene="glmM"
FT                   /locus_tag="BCQ_0182"
FT                   /note="BC0182"
FT   CDS_pept        155867..157213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BCQ_0182"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="Code: G; COG: COG1109"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10685"
FT                   /db_xref="GOA:B9J0F1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J0F1"
FT                   /protein_id="ACM10685.1"
FT   gene            157698..159500
FT                   /gene="glmS"
FT                   /locus_tag="BCQ_0183"
FT                   /note="BC0183"
FT   CDS_pept        157698..159500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BCQ_0183"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /note="Code: M; COG: COG0449"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10686"
FT                   /db_xref="GOA:B9J0F2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F2"
FT                   /protein_id="ACM10686.1"
FT   gene            159837..160673
FT                   /locus_tag="BCQ_0184"
FT                   /note="BC0184"
FT   CDS_pept        159837..160673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10687"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F3"
FT                   /protein_id="ACM10687.1"
FT   gene            161081..161812
FT                   /gene="gntR"
FT                   /locus_tag="BCQ_0185"
FT                   /note="BC0185"
FT   CDS_pept        161081..161812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="BCQ_0185"
FT                   /product="gluconate operon transcriptional repressor;
FT                   transcriptional regulator, GntR family"
FT                   /note="Code: K; COG: COG1802"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10688"
FT                   /db_xref="GOA:B9J0F4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F4"
FT                   /protein_id="ACM10688.1"
FT   gene            161805..163340
FT                   /gene="gntK"
FT                   /locus_tag="BCQ_0186"
FT                   /note="BC0186"
FT   CDS_pept        161805..163340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="BCQ_0186"
FT                   /product="gluconokinase"
FT                   /note="Code: G; COG: COG1070"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10689"
FT                   /db_xref="GOA:B9J0F5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006002"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F5"
FT                   /protein_id="ACM10689.1"
FT   gene            163460..164806
FT                   /gene="gntP"
FT                   /locus_tag="BCQ_0187"
FT                   /note="BC0187"
FT   CDS_pept        163460..164806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="BCQ_0187"
FT                   /product="gluconate permease"
FT                   /note="Code: GE; COG: COG2610"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10690"
FT                   /db_xref="GOA:B9J0F6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F6"
FT                   /protein_id="ACM10690.1"
FT   gene            165071..166480
FT                   /gene="gntZ"
FT                   /locus_tag="BCQ_0188"
FT                   /note="BC0188"
FT   CDS_pept        165071..166480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntZ"
FT                   /locus_tag="BCQ_0188"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="Code: G; COG: COG0362"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10691"
FT                   /db_xref="GOA:B9J0F7"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F7"
FT                   /protein_id="ACM10691.1"
FT                   DKEGTFHTKWI"
FT   gene            166794..168752
FT                   /locus_tag="BCQ_0189"
FT                   /note="BC0189"
FT   CDS_pept        166794..168752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0189"
FT                   /product="prolyl oligopeptidase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10692"
FT                   /db_xref="GOA:B9J0F8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F8"
FT                   /protein_id="ACM10692.1"
FT                   WFSHYILGESMKDFRTI"
FT   gene            168898..169464
FT                   /locus_tag="BCQ_0190"
FT                   /note="BC0190"
FT   CDS_pept        168898..169464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10693"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0F9"
FT                   /protein_id="ACM10693.1"
FT   gene            complement(169536..170042)
FT                   /locus_tag="BCQ_0191"
FT                   /note="BC0191"
FT   CDS_pept        complement(169536..170042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2259"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10694"
FT                   /db_xref="GOA:B9J0G0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G0"
FT                   /protein_id="ACM10694.1"
FT                   LSKTA"
FT   gene            complement(170283..171200)
FT                   /locus_tag="BCQ_0192"
FT                   /note="BC0192"
FT   CDS_pept        complement(170283..171200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10695"
FT                   /db_xref="GOA:B9J0G1"
FT                   /db_xref="InterPro:IPR025672"
FT                   /db_xref="InterPro:IPR029101"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G1"
FT                   /protein_id="ACM10695.1"
FT   gene            complement(171200..171691)
FT                   /locus_tag="BCQ_0193"
FT                   /note="BC0193"
FT   CDS_pept        complement(171200..171691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0193"
FT                   /product="rna polymerase sigma-70 factor, ecf subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10696"
FT                   /db_xref="GOA:B9J0G2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G2"
FT                   /protein_id="ACM10696.1"
FT                   "
FT   gene            complement(171832..173133)
FT                   /locus_tag="BCQ_0194"
FT                   /note="BC0194"
FT   CDS_pept        complement(171832..173133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0194"
FT                   /product="group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10697"
FT                   /db_xref="InterPro:IPR031888"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G3"
FT                   /protein_id="ACM10697.1"
FT   gene            173576..174349
FT                   /gene="fabG"
FT                   /locus_tag="BCQ_0195"
FT                   /note="BC0195"
FT   CDS_pept        173576..174349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BCQ_0195"
FT                   /product="probable 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /note="Code: IQR; COG: COG1028"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10698"
FT                   /db_xref="GOA:B9J0G4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G4"
FT                   /protein_id="ACM10698.1"
FT   gene            complement(174387..175055)
FT                   /locus_tag="BCQ_0196"
FT                   /note="BC0196"
FT   CDS_pept        complement(174387..175055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0196"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Code: P; COG: COG2011"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10699"
FT                   /db_xref="GOA:B9J0G5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G5"
FT                   /protein_id="ACM10699.1"
FT                   "
FT   gene            complement(175030..176070)
FT                   /locus_tag="BCQ_0197"
FT                   /note="BC0197"
FT   CDS_pept        complement(175030..176070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0197"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: P; COG: COG1135"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10700"
FT                   /db_xref="GOA:B9J0G6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G6"
FT                   /protein_id="ACM10700.1"
FT                   KQVLFG"
FT   gene            complement(176083..176895)
FT                   /locus_tag="BCQ_0198"
FT                   /note="BC0198"
FT   CDS_pept        complement(176083..176895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0198"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /note="Code: P; COG: COG1464"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10701"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G7"
FT                   /protein_id="ACM10701.1"
FT   gene            complement(177178..178086)
FT                   /locus_tag="BCQ_0199"
FT                   /note="BC0199"
FT   CDS_pept        complement(177178..178086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0199"
FT                   /product="alcohol dehydrogenase, zinc containing"
FT                   /note="Code: CR; COG: COG0604"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10702"
FT                   /db_xref="GOA:B9J0G8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G8"
FT                   /protein_id="ACM10702.1"
FT   gene            178233..178997
FT                   /locus_tag="BCQ_0200"
FT                   /note="BC0200"
FT   CDS_pept        178233..178997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0200"
FT                   /product="group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10703"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0G9"
FT                   /protein_id="ACM10703.1"
FT   gene            179130..180545
FT                   /locus_tag="BCQ_0201"
FT                   /note="BC0201"
FT   CDS_pept        179130..180545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0201"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="Code: C; COG: COG0277"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10704"
FT                   /db_xref="GOA:B9J0H0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H0"
FT                   /protein_id="ACM10704.1"
FT                   ERFVNLFYREYTK"
FT   gene            180542..181075
FT                   /locus_tag="BCQ_0202"
FT                   /note="BC0202"
FT   CDS_pept        180542..181075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0202"
FT                   /product="multi-drug resistance protein, putative"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10705"
FT                   /db_xref="GOA:B9J0H1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H1"
FT                   /protein_id="ACM10705.1"
FT                   LYVVSGVVLSSKKI"
FT   gene            181154..182875
FT                   /locus_tag="BCQ_0203"
FT                   /note="BC0203"
FT   CDS_pept        181154..182875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10706"
FT                   /db_xref="GOA:B9J0H2"
FT                   /db_xref="InterPro:IPR025043"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H2"
FT                   /protein_id="ACM10706.1"
FT   gene            183003..184253
FT                   /locus_tag="BCQ_0204"
FT                   /note="BC0204"
FT   CDS_pept        183003..184253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0204"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10707"
FT                   /db_xref="GOA:B9J0H3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H3"
FT                   /protein_id="ACM10707.1"
FT                   RRSEKQFELQARQNLEA"
FT   gene            complement(184287..184733)
FT                   /locus_tag="BCQ_0205"
FT                   /note="BC0205"
FT   CDS_pept        complement(184287..184733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10708"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H4"
FT                   /protein_id="ACM10708.1"
FT   gene            185008..185511
FT                   /locus_tag="BCQ_0206"
FT                   /note="BC0206"
FT   CDS_pept        185008..185511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10709"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H5"
FT                   /protein_id="ACM10709.1"
FT                   ETKK"
FT   gene            complement(185528..185743)
FT                   /locus_tag="BCQ_0207"
FT                   /note="BC0207"
FT   CDS_pept        complement(185528..185743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0207"
FT                   /product="group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10710"
FT                   /db_xref="GOA:B9J0H6"
FT                   /db_xref="InterPro:IPR025028"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H6"
FT                   /protein_id="ACM10710.1"
FT   gene            186183..187073
FT                   /locus_tag="BCQ_0208"
FT                   /note="BC0208"
FT   CDS_pept        186183..187073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0208"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="Code: EP; COG: COG0601"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10711"
FT                   /db_xref="GOA:B9J0H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H7"
FT                   /protein_id="ACM10711.1"
FT                   DIIHRIVDPRIRSIT"
FT   gene            187091..188095
FT                   /gene="oppC"
FT                   /locus_tag="BCQ_0209"
FT                   /note="BC0209"
FT   CDS_pept        187091..188095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="BCQ_0209"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /note="Code: EP; COG: COG1173"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10712"
FT                   /db_xref="GOA:B9J0H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H8"
FT                   /protein_id="ACM10712.1"
FT   gene            188052..189062
FT                   /gene="oppD"
FT                   /locus_tag="BCQ_0210"
FT                   /note="BC0210"
FT   CDS_pept        188052..189062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BCQ_0210"
FT                   /product="oligopeptide ABC transportor, ATP-binding
FT                   protein"
FT                   /note="Code: EP; COG: COG0444"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10713"
FT                   /db_xref="GOA:B9J0H9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0H9"
FT                   /protein_id="ACM10713.1"
FT   gene            189059..189832
FT                   /gene="oppF"
FT                   /locus_tag="BCQ_0211"
FT                   /note="BC0211"
FT   CDS_pept        189059..189832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BCQ_0211"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Code: E; COG: COG4608"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10714"
FT                   /db_xref="GOA:B9J0I0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I0"
FT                   /protein_id="ACM10714.1"
FT   gene            189846..191435
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0212"
FT                   /note="BC0212"
FT   CDS_pept        189846..191435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0212"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="Code: E; COG: COG4166"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10715"
FT                   /db_xref="GOA:B9J0I1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I1"
FT                   /protein_id="ACM10715.1"
FT                   VGSQPSLRYAKK"
FT   gene            complement(191465..191932)
FT                   /locus_tag="BCQ_0213"
FT                   /note="BC0213"
FT   CDS_pept        complement(191465..191932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0213"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10716"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I2"
FT                   /protein_id="ACM10716.1"
FT   gene            192106..193005
FT                   /locus_tag="BCQ_0214"
FT                   /note="BC0214"
FT   CDS_pept        192106..193005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0214"
FT                   /product="transcriptional regulator, AraC family; possible
FT                   arabinose operon regulator"
FT                   /note="Code: K; COG: COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10717"
FT                   /db_xref="GOA:B9J0I3"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I3"
FT                   /protein_id="ACM10717.1"
FT                   YETLLEEPVNLQFEELEK"
FT   gene            193279..193860
FT                   /locus_tag="BCQ_0215"
FT                   /note="BC0215"
FT   CDS_pept        193279..193860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0215"
FT                   /product="possible transcription regulator, TetR/AcrR
FT                   family"
FT                   /note="Code: K; COG: COG1309"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10718"
FT                   /db_xref="GOA:B9J0I4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I4"
FT                   /protein_id="ACM10718.1"
FT   gene            193919..195061
FT                   /locus_tag="BCQ_0216"
FT                   /note="BC0216"
FT   CDS_pept        193919..195061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10719"
FT                   /db_xref="GOA:B9J0I5"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I5"
FT                   /protein_id="ACM10719.1"
FT   gene            complement(195106..196746)
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0217"
FT                   /note="BC0217"
FT   CDS_pept        complement(195106..196746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0217"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5 (SBP_bac_5)"
FT                   /note="Code: E; COG: COG4166"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10720"
FT                   /db_xref="GOA:B9J0I6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I6"
FT                   /protein_id="ACM10720.1"
FT   gene            complement(197134..198774)
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0218"
FT                   /note="BC0218"
FT   CDS_pept        complement(197134..198774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0218"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5 (SBP_bac_5)"
FT                   /note="Code: E; COG: COG4166"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10721"
FT                   /db_xref="GOA:B9J0I7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I7"
FT                   /protein_id="ACM10721.1"
FT   gene            complement(199165..199998)
FT                   /locus_tag="BCQ_0219"
FT                   /note="BC0219"
FT   CDS_pept        complement(199165..199998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0219"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="Code: R; COG: COG0656"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10722"
FT                   /db_xref="GOA:B9J0I8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I8"
FT                   /protein_id="ACM10722.1"
FT   gene            complement(200000..200803)
FT                   /gene="proC"
FT                   /locus_tag="BCQ_0220"
FT                   /note="BC0220"
FT   CDS_pept        complement(200000..200803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BCQ_0220"
FT                   /product="pyrroline-5-carboxylate reductase (P5CR)"
FT                   /note="Code: E; COG: COG0345"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10723"
FT                   /db_xref="GOA:B9J0I9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0I9"
FT                   /protein_id="ACM10723.1"
FT   gene            200991..201641
FT                   /locus_tag="BCQ_0221"
FT                   /note="BC0221"
FT   CDS_pept        200991..201641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0221"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /note="Code: H; COG: COG3201"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10724"
FT                   /db_xref="GOA:B9J0J0"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J0"
FT                   /protein_id="ACM10724.1"
FT   gene            complement(201709..202560)
FT                   /gene="glcU"
FT                   /locus_tag="BCQ_0222"
FT                   /note="BC0222"
FT   CDS_pept        complement(201709..202560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BCQ_0222"
FT                   /product="probable glucose uptake protein"
FT                   /note="Code: G; COG: COG4975"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10725"
FT                   /db_xref="GOA:B9J0J1"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J1"
FT                   /protein_id="ACM10725.1"
FT                   KA"
FT   gene            complement(202862..203377)
FT                   /gene="modB"
FT                   /locus_tag="BCQ_0223"
FT                   /note="BC0223"
FT   CDS_pept        complement(202862..203377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BCQ_0223"
FT                   /product="molybdenum ABC transporter, permease"
FT                   /note="Code: P; COG: COG4149"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10726"
FT                   /db_xref="GOA:B9J0J2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J2"
FT                   /protein_id="ACM10726.1"
FT                   INKRITNS"
FT   gene            complement(203542..204348)
FT                   /gene="modA"
FT                   /locus_tag="BCQ_0224"
FT                   /note="BC0224"
FT   CDS_pept        complement(203542..204348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BCQ_0224"
FT                   /product="molybdenum ABC transporter, substrate-binding
FT                   protein"
FT                   /note="Code: P; COG: COG0725"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10727"
FT                   /db_xref="GOA:B9J0J3"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J3"
FT                   /protein_id="ACM10727.1"
FT   gene            204626..205429
FT                   /locus_tag="BCQ_0225"
FT                   /note="BC0225"
FT   CDS_pept        204626..205429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0225"
FT                   /product="molybdopterin biosynthesis protein, putative"
FT                   /note="Code: P; COG: COG1910"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10728"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J4"
FT                   /protein_id="ACM10728.1"
FT   gene            complement(205495..205596)
FT                   /locus_tag="BCQ_0226"
FT                   /note="BC0226"
FT   CDS_pept        complement(205495..205596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10729"
FT                   /db_xref="GOA:B9J0J5"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J5"
FT                   /protein_id="ACM10729.1"
FT   gene            complement(205609..205710)
FT                   /locus_tag="BCQ_0227"
FT                   /note="BC0227"
FT   CDS_pept        complement(205609..205710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10730"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J6"
FT                   /protein_id="ACM10730.1"
FT   gene            complement(205852..206718)
FT                   /gene="gltR"
FT                   /locus_tag="BCQ_0228"
FT                   /note="BC0228"
FT   CDS_pept        complement(205852..206718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltR"
FT                   /locus_tag="BCQ_0228"
FT                   /product="HTH_1-type transcriptional regulator, Lys R
FT                   family"
FT                   /note="Code: K; COG: COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10731"
FT                   /db_xref="GOA:B9J0J7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J7"
FT                   /protein_id="ACM10731.1"
FT                   HHHINML"
FT   gene            206846..207814
FT                   /locus_tag="BCQ_0229"
FT                   /note="BC0229"
FT   CDS_pept        206846..207814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0229"
FT                   /product="transporter, eama family"
FT                   /note="Code: GER; COG: COG0697"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10732"
FT                   /db_xref="GOA:B9J0J8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J8"
FT                   /protein_id="ACM10732.1"
FT   gene            207836..207976
FT                   /locus_tag="BCQ_0230"
FT                   /note="BC0230"
FT   CDS_pept        207836..207976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10733"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0J9"
FT                   /protein_id="ACM10733.1"
FT                   I"
FT   gene            complement(208037..208132)
FT                   /locus_tag="BCQ_0231"
FT                   /note="BC0231"
FT   CDS_pept        complement(208037..208132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10734"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K0"
FT                   /protein_id="ACM10734.1"
FT                   /translation="MNNITFNKLDFLGLASGSLLLTAFIYAATLV"
FT   gene            complement(208145..208246)
FT                   /locus_tag="BCQ_0232"
FT                   /note="BC0232"
FT   CDS_pept        complement(208145..208246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10735"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K1"
FT                   /protein_id="ACM10735.1"
FT   gene            208470..209075
FT                   /locus_tag="BCQ_0233"
FT                   /note="BC0233"
FT   CDS_pept        208470..209075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0233"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase
FT                   (1-acyl-sn-glycerol-3-phosphate acyltransferase)"
FT                   /note="Code: I; COG: COG0204"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10736"
FT                   /db_xref="GOA:B9J0K2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K2"
FT                   /protein_id="ACM10736.1"
FT   gene            complement(209407..209508)
FT                   /locus_tag="BCQ_0234"
FT                   /note="BC0234"
FT   CDS_pept        complement(209407..209508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10737"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K3"
FT                   /protein_id="ACM10737.1"
FT   gene            209700..210677
FT                   /locus_tag="BCQ_0235"
FT                   /note="BC0235"
FT   CDS_pept        209700..210677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0235"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="Code: K; COG: COG1609"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10738"
FT                   /db_xref="GOA:B9J0K4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K4"
FT                   /protein_id="ACM10738.1"
FT   gene            211274..212110
FT                   /locus_tag="BCQ_0236"
FT                   /note="BC0236"
FT   CDS_pept        211274..212110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0236"
FT                   /product="yitT family protein"
FT                   /note="Code: S; COG: COG1284"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10739"
FT                   /db_xref="GOA:B9J0K5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K5"
FT                   /protein_id="ACM10739.1"
FT   gene            212250..212606
FT                   /locus_tag="BCQ_0237"
FT                   /note="BC0237"
FT   CDS_pept        212250..212606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10740"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K6"
FT                   /protein_id="ACM10740.1"
FT                   NIPINAKSKLLAMR"
FT   gene            213352..214116
FT                   /locus_tag="BCQ_0238"
FT                   /note="BC0238"
FT   CDS_pept        213352..214116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0238"
FT                   /product="deoxyribonuclease, TatD family, putative"
FT                   /note="Code: L; COG: COG0084"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10741"
FT                   /db_xref="GOA:B9J0K7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K7"
FT                   /protein_id="ACM10741.1"
FT   gene            complement(214257..215906)
FT                   /locus_tag="BCQ_0239"
FT                   /note="BC0239"
FT   CDS_pept        complement(214257..215906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG5298"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10742"
FT                   /db_xref="GOA:B9J0K8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K8"
FT                   /protein_id="ACM10742.1"
FT   gene            216158..216691
FT                   /locus_tag="BCQ_0240"
FT                   /note="BC0240"
FT   CDS_pept        216158..216691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0240"
FT                   /product="invasion protein IagB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10743"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0K9"
FT                   /protein_id="ACM10743.1"
FT                   LEDVYYRNKGVIKE"
FT   gene            complement(216703..217497)
FT                   /locus_tag="BCQ_0241"
FT                   /note="BC0241"
FT   CDS_pept        complement(216703..217497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0241"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /note="Code: C; COG: COG1085"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10744"
FT                   /db_xref="GOA:B9J0L0"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L0"
FT                   /protein_id="ACM10744.1"
FT   gene            complement(217632..217754)
FT                   /locus_tag="BCQ_0242"
FT                   /note="BC0242"
FT   CDS_pept        complement(217632..217754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10745"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L1"
FT                   /protein_id="ACM10745.1"
FT   gene            218123..218314
FT                   /locus_tag="BCQ_0243"
FT                   /note="BC0243"
FT   CDS_pept        218123..218314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10746"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L2"
FT                   /protein_id="ACM10746.1"
FT                   VNGIRLSFFNNCIVAIER"
FT   gene            218439..220319
FT                   /locus_tag="BCQ_0244"
FT                   /note="BC0244"
FT   CDS_pept        218439..220319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0244"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10747"
FT                   /db_xref="GOA:B9J0L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L3"
FT                   /protein_id="ACM10747.1"
FT   gene            complement(220564..220809)
FT                   /locus_tag="BCQ_0245"
FT                   /note="BC0245"
FT   CDS_pept        complement(220564..220809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10748"
FT                   /db_xref="GOA:B9J0L4"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L4"
FT                   /protein_id="ACM10748.1"
FT   gene            220999..222699
FT                   /locus_tag="BCQ_0246"
FT                   /note="BC0246"
FT   CDS_pept        220999..222699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0246"
FT                   /product="oligopeptide ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /note="Code: E; COG: COG0747"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10749"
FT                   /db_xref="GOA:B9J0L5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L5"
FT                   /protein_id="ACM10749.1"
FT   gene            222942..224669
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0247"
FT                   /note="BC0247"
FT   CDS_pept        222942..224669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="BCQ_0247"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="Code: E; COG: COG0747"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10750"
FT                   /db_xref="GOA:B9J0L6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L6"
FT                   /protein_id="ACM10750.1"
FT   gene            224806..225729
FT                   /gene="oppB"
FT                   /locus_tag="BCQ_0248"
FT                   /note="BC0248"
FT   CDS_pept        224806..225729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="BCQ_0248"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /note="Code: EP; COG: COG0601"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10751"
FT                   /db_xref="GOA:B9J0L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L7"
FT                   /protein_id="ACM10751.1"
FT   gene            225742..226665
FT                   /gene="oppC"
FT                   /locus_tag="BCQ_0249"
FT                   /note="BC0249"
FT   CDS_pept        225742..226665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="BCQ_0249"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /note="Code: EP; COG: COG1173"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10752"
FT                   /db_xref="GOA:B9J0L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L8"
FT                   /protein_id="ACM10752.1"
FT   gene            226676..227656
FT                   /gene="oppD"
FT                   /locus_tag="BCQ_0250"
FT                   /note="BC0250"
FT   CDS_pept        226676..227656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BCQ_0250"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Code: EP; COG: COG0444"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10753"
FT                   /db_xref="GOA:B9J0L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0L9"
FT                   /protein_id="ACM10753.1"
FT   gene            227653..228618
FT                   /gene="oppF"
FT                   /locus_tag="BCQ_0251"
FT                   /note="BC0251"
FT   CDS_pept        227653..228618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BCQ_0251"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Code: E; COG: COG4608"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10754"
FT                   /db_xref="GOA:B9J0M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M0"
FT                   /protein_id="ACM10754.1"
FT   gene            complement(228656..229537)
FT                   /locus_tag="BCQ_0252"
FT                   /note="BC0252"
FT   CDS_pept        complement(228656..229537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0252"
FT                   /product="hydrolase, HAD superfamily (haloacid
FT                   dehalogenase-like family)"
FT                   /note="Code: R; COG: COG0561"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10755"
FT                   /db_xref="GOA:B9J0M1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M1"
FT                   /protein_id="ACM10755.1"
FT                   EQFVLKQTSSSK"
FT   gene            complement(229933..230424)
FT                   /locus_tag="BCQ_0253"
FT                   /note="BC0253"
FT   CDS_pept        complement(229933..230424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10756"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M2"
FT                   /protein_id="ACM10756.1"
FT                   "
FT   gene            230426..230533
FT                   /locus_tag="BCQ_0254"
FT                   /note="BC0254"
FT   CDS_pept        230426..230533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10757"
FT                   /db_xref="GOA:B9J0M3"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M3"
FT                   /protein_id="ACM10757.1"
FT   gene            230576..230686
FT                   /locus_tag="BCQ_0255"
FT                   /note="BC0255"
FT   CDS_pept        230576..230686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10758"
FT                   /db_xref="GOA:B9J0M4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M4"
FT                   /protein_id="ACM10758.1"
FT   gene            230996..232114
FT                   /gene="hppD"
FT                   /locus_tag="BCQ_0256"
FT                   /note="BC0256"
FT   CDS_pept        230996..232114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BCQ_0256"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /note="Code: ER; COG: COG3185"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10759"
FT                   /db_xref="GOA:B9J0M5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M5"
FT                   /protein_id="ACM10759.1"
FT   gene            232181..233137
FT                   /locus_tag="BCQ_0257"
FT                   /note="BC0257"
FT   CDS_pept        232181..233137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0257"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="Code: Q; COG: COG0179"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10760"
FT                   /db_xref="GOA:B9J0M6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M6"
FT                   /protein_id="ACM10760.1"
FT   gene            233103..234275
FT                   /locus_tag="BCQ_0258"
FT                   /note="BC0258"
FT   CDS_pept        233103..234275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0258"
FT                   /product="homogentisate 1,2-dioxygenase, putative"
FT                   /note="Code: Q; COG: COG3508"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10761"
FT                   /db_xref="GOA:B9J0M7"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M7"
FT                   /protein_id="ACM10761.1"
FT   gene            234508..235923
FT                   /locus_tag="BCQ_0259"
FT                   /note="BC0259"
FT   CDS_pept        234508..235923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0259"
FT                   /product="amino acid permease"
FT                   /note="Code: E; COG: COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10762"
FT                   /db_xref="GOA:B9J0M8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M8"
FT                   /protein_id="ACM10762.1"
FT                   LNNSKEEDDAANL"
FT   gene            236032..237303
FT                   /locus_tag="BCQ_0260"
FT                   /note="BC0260"
FT   CDS_pept        236032..237303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0260"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10763"
FT                   /db_xref="GOA:B9J0M9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0M9"
FT                   /protein_id="ACM10763.1"
FT   gene            237686..238771
FT                   /gene="ddlA"
FT                   /locus_tag="BCQ_0261"
FT                   /note="BC0261"
FT   CDS_pept        237686..238771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BCQ_0261"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="Code: M; COG: COG1181"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10764"
FT                   /db_xref="GOA:B9J0N0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N0"
FT                   /protein_id="ACM10764.1"
FT   gene            238833..240209
FT                   /gene="murF"
FT                   /locus_tag="BCQ_0262"
FT                   /note="BC0262"
FT   CDS_pept        238833..240209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BCQ_0262"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="Code: M; COG: COG0770"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10765"
FT                   /db_xref="GOA:B9J0N1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N1"
FT                   /protein_id="ACM10765.1"
FT                   "
FT   gene            240515..242092
FT                   /gene="deaD"
FT                   /locus_tag="BCQ_0263"
FT                   /note="BC0263"
FT   CDS_pept        240515..242092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="BCQ_0263"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="Code: LKJ; COG: COG0513"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10766"
FT                   /db_xref="GOA:B9J0N2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N2"
FT                   /protein_id="ACM10766.1"
FT                   HHSRKPQA"
FT   gene            242189..243151
FT                   /locus_tag="BCQ_0264"
FT                   /note="BC0264"
FT   CDS_pept        242189..243151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0264"
FT                   /product="UV-endonuclease, putative"
FT                   /note="Code: L; COG: COG4294"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10767"
FT                   /db_xref="GOA:B9J0N3"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N3"
FT                   /protein_id="ACM10767.1"
FT   gene            complement(243144..243716)
FT                   /locus_tag="BCQ_0265"
FT                   /note="BC0265"
FT   CDS_pept        complement(243144..243716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0265"
FT                   /product="rhomboid family protein"
FT                   /note="Code: R; COG: COG0705"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10768"
FT                   /db_xref="GOA:B9J0N4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N4"
FT                   /protein_id="ACM10768.1"
FT   gene            243809..244168
FT                   /gene="acpS"
FT                   /locus_tag="BCQ_0266"
FT                   /note="BC0266"
FT   CDS_pept        243809..244168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BCQ_0266"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /note="Code: I; COG: COG0736"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10769"
FT                   /db_xref="GOA:B9J0N5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J0N5"
FT                   /protein_id="ACM10769.1"
FT                   KEFAVAQVVLESSSR"
FT   gene            244262..245275
FT                   /locus_tag="BCQ_0267"
FT                   /note="BC0267"
FT   CDS_pept        244262..245275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0267"
FT                   /product="lipoprotein, putative"
FT                   /note="Code: M; COG: COG2834"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10770"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N6"
FT                   /protein_id="ACM10770.1"
FT   gene            245394..246563
FT                   /gene="alr"
FT                   /locus_tag="BCQ_0268"
FT                   /note="BC0268"
FT   CDS_pept        245394..246563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BCQ_0268"
FT                   /product="alanine racemase"
FT                   /note="Code: M; COG: COG0787"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10771"
FT                   /db_xref="GOA:B9J0N7"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N7"
FT                   /protein_id="ACM10771.1"
FT   gene            246863..247150
FT                   /locus_tag="BCQ_0269"
FT                   /note="BC0269"
FT   CDS_pept        246863..247150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG0864"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10772"
FT                   /db_xref="GOA:B9J0N8"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N8"
FT                   /protein_id="ACM10772.1"
FT   gene            247176..247505
FT                   /locus_tag="BCQ_0270"
FT                   /note="BC0270"
FT   CDS_pept        247176..247505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0270"
FT                   /product="pemK-like protein"
FT                   /note="Code: T; COG: COG2337"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10773"
FT                   /db_xref="GOA:B9J0N9"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0N9"
FT                   /protein_id="ACM10773.1"
FT                   GLIDF"
FT   gene            247573..249741
FT                   /locus_tag="BCQ_0271"
FT                   /note="BC0271"
FT   CDS_pept        247573..249741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0271"
FT                   /product="probable transcription accessory protein, S1
FT                   RNA-binding domain protein"
FT                   /note="Code: K; COG: COG2183"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10774"
FT                   /db_xref="GOA:B9J0P0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P0"
FT                   /protein_id="ACM10774.1"
FT   gene            250111..250569
FT                   /locus_tag="BCQ_0272"
FT                   /note="BC0272"
FT   CDS_pept        250111..250569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0272"
FT                   /product="zinc metalloprotease"
FT                   /note="Code: S; COG: COG3091"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10775"
FT                   /db_xref="GOA:B9J0P1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J0P1"
FT                   /protein_id="ACM10775.1"
FT   gene            250684..250758
FT                   /locus_tag="BCQ_0273"
FT                   /note="BC0273"
FT   tRNA            250684..250758
FT                   /locus_tag="BCQ_0273"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            250762..250852
FT                   /locus_tag="BCQ_0274"
FT                   /note="BC0274"
FT   tRNA            250762..250852
FT                   /locus_tag="BCQ_0274"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   gene            250861..250935
FT                   /locus_tag="BCQ_0275"
FT                   /note="BC0275"
FT   tRNA            250861..250935
FT                   /locus_tag="BCQ_0275"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            250940..251015
FT                   /locus_tag="BCQ_0276"
FT                   /note="BC0276"
FT   tRNA            250940..251015
FT                   /locus_tag="BCQ_0276"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            251062..251137
FT                   /locus_tag="BCQ_0277"
FT                   /note="BC0277"
FT   tRNA            251062..251137
FT                   /locus_tag="BCQ_0277"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            251225..251299
FT                   /locus_tag="BCQ_0278"
FT                   /note="BC0278"
FT   tRNA            251225..251299
FT                   /locus_tag="BCQ_0278"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            251305..251377
FT                   /locus_tag="BCQ_0279"
FT                   /note="BC0279"
FT   tRNA            251305..251377
FT                   /locus_tag="BCQ_0279"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            251395..251480
FT                   /locus_tag="BCQ_0280"
FT                   /note="BC0280"
FT   tRNA            251395..251480
FT                   /locus_tag="BCQ_0280"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   gene            251575..251651
FT                   /locus_tag="BCQ_0281"
FT                   /note="BC0281"
FT   tRNA            251575..251651
FT                   /locus_tag="BCQ_0281"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            251656..251732
FT                   /locus_tag="BCQ_0282"
FT                   /note="BC0282"
FT   tRNA            251656..251732
FT                   /locus_tag="BCQ_0282"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   gene            251734..251804
FT                   /locus_tag="BCQ_0283"
FT                   /note="BC0283"
FT   tRNA            251734..251804
FT                   /locus_tag="BCQ_0283"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            251909..253413
FT                   /locus_tag="BCQ_0284"
FT                   /note="BC0284"
FT   rRNA            251909..253413
FT                   /locus_tag="BCQ_0284"
FT                   /product="16S ribosomal RNA"
FT   gene            253592..256500
FT                   /locus_tag="BCQ_0285"
FT                   /note="BC0285"
FT   rRNA            253592..256500
FT                   /locus_tag="BCQ_0285"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(253616..254047)
FT                   /locus_tag="BCQ_0286"
FT                   /note="BC0286"
FT   CDS_pept        complement(253616..254047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10776"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10776.1"
FT   gene            256550..256664
FT                   /locus_tag="BCQ_0287"
FT                   /note="BC0287"
FT   rRNA            256550..256664
FT                   /locus_tag="BCQ_0287"
FT                   /product="5S ribosomal RNA"
FT   gene            256678..256754
FT                   /locus_tag="BCQ_0288"
FT                   /note="BC0288"
FT   tRNA            256678..256754
FT                   /locus_tag="BCQ_0288"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            256758..256833
FT                   /locus_tag="BCQ_0289"
FT                   /note="BC0289"
FT   tRNA            256758..256833
FT                   /locus_tag="BCQ_0289"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            257008..257481
FT                   /locus_tag="BCQ_0290"
FT                   /note="BC0290"
FT   CDS_pept        257008..257481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0290"
FT                   /product="ATP/GTP hydrolase"
FT                   /note="Code: R; COG: COG0802"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10777"
FT                   /db_xref="GOA:B9J0P3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P3"
FT                   /protein_id="ACM10777.1"
FT   gene            257462..258154
FT                   /locus_tag="BCQ_0291"
FT                   /note="BC0291"
FT   CDS_pept        257462..258154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0291"
FT                   /product="probable O-sialoglycoprotein endopeptidase
FT                   (glycoprotease)"
FT                   /note="Code: O; COG: COG1214"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10778"
FT                   /db_xref="GOA:B9J0P4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P4"
FT                   /protein_id="ACM10778.1"
FT                   KWLESQNK"
FT   gene            258168..258611
FT                   /gene="rimI"
FT                   /locus_tag="BCQ_0292"
FT                   /note="BC0292"
FT   CDS_pept        258168..258611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BCQ_0292"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /note="Code: R; COG: COG0456"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10779"
FT                   /db_xref="GOA:B9J0P5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P5"
FT                   /protein_id="ACM10779.1"
FT   gene            258611..259627
FT                   /gene="gcP"
FT                   /locus_tag="BCQ_0293"
FT                   /note="BC0293"
FT   CDS_pept        258611..259627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcP"
FT                   /locus_tag="BCQ_0293"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="Code: O; COG: COG0533"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10780"
FT                   /db_xref="GOA:B9J0P6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P6"
FT                   /protein_id="ACM10780.1"
FT   gene            complement(260048..262036)
FT                   /gene="uup"
FT                   /locus_tag="BCQ_0294"
FT                   /note="BC0294"
FT   CDS_pept        complement(260048..262036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup"
FT                   /locus_tag="BCQ_0294"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: R; COG: COG0488"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10781"
FT                   /db_xref="GOA:B9J0P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B9J0P7"
FT                   /protein_id="ACM10781.1"
FT   gene            262170..262799
FT                   /locus_tag="BCQ_0295"
FT                   /note="BC0295"
FT   CDS_pept        262170..262799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0295"
FT                   /product="probable AT-rich DNA-binding protein"
FT                   /note="Code: R; COG: COG2344"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10782"
FT                   /db_xref="GOA:B9J1G9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1G9"
FT                   /protein_id="ACM10782.1"
FT   gene            complement(263017..263766)
FT                   /locus_tag="BCQ_0296"
FT                   /note="BC0296"
FT   CDS_pept        complement(263017..263766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0296"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Code: R; COG: COG1266"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10783"
FT                   /db_xref="GOA:B9J1H0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H0"
FT                   /protein_id="ACM10783.1"
FT   gene            264168..264452
FT                   /gene="groES"
FT                   /locus_tag="BCQ_0297"
FT                   /note="BC0297"
FT   CDS_pept        264168..264452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BCQ_0297"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (heat shock
FT                   protein)"
FT                   /note="Code: O; COG: COG0234"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10784"
FT                   /db_xref="GOA:B9J1H1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1H1"
FT                   /protein_id="ACM10784.1"
FT   gene            264491..266125
FT                   /gene="groEL"
FT                   /locus_tag="BCQ_0298"
FT                   /note="BC0298"
FT   CDS_pept        264491..266125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BCQ_0298"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (class I
FT                   heat-shock protein)"
FT                   /note="Code: O; COG: COG0459"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10785"
FT                   /db_xref="GOA:B9J1H2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1H2"
FT                   /protein_id="ACM10785.1"
FT   gene            266524..268071
FT                   /gene="guaA"
FT                   /locus_tag="BCQ_0299"
FT                   /note="BC0299"
FT   CDS_pept        266524..268071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BCQ_0299"
FT                   /product="GMP synthase"
FT                   /note="Code: F; COG: COG0519"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10786"
FT                   /db_xref="GOA:B9J1H3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H3"
FT                   /protein_id="ACM10786.1"
FT   gene            268456..269781
FT                   /locus_tag="BCQ_0300"
FT                   /note="BC0300"
FT   CDS_pept        268456..269781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0300"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="Code: R; COG: COG2252"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10787"
FT                   /db_xref="GOA:B9J1H4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H4"
FT                   /protein_id="ACM10787.1"
FT   gene            269926..270627
FT                   /locus_tag="BCQ_0301"
FT                   /note="BC0301"
FT   CDS_pept        269926..270627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0301"
FT                   /product="DNA-binding response regulator"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10788"
FT                   /db_xref="GOA:B9J1H5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H5"
FT                   /protein_id="ACM10788.1"
FT                   WGVGYKIEKDI"
FT   gene            270611..272116
FT                   /locus_tag="BCQ_0302"
FT                   /note="BC0302"
FT   CDS_pept        270611..272116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0302"
FT                   /product="sensor histidine kinase"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10789"
FT                   /db_xref="GOA:B9J1H6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H6"
FT                   /protein_id="ACM10789.1"
FT   gene            272440..273944
FT                   /locus_tag="BCQ_0303"
FT                   /note="BC0303"
FT   rRNA            272440..273944
FT                   /locus_tag="BCQ_0303"
FT                   /product="16S ribosomal RNA"
FT   gene            274123..277031
FT                   /locus_tag="BCQ_0304"
FT                   /note="BC0304"
FT   rRNA            274123..277031
FT                   /locus_tag="BCQ_0304"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(274147..274578)
FT                   /locus_tag="BCQ_0305"
FT                   /note="BC0305"
FT   CDS_pept        complement(274147..274578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10790"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10790.1"
FT   gene            277081..277195
FT                   /locus_tag="BCQ_0306"
FT                   /note="BC0306"
FT   rRNA            277081..277195
FT                   /locus_tag="BCQ_0306"
FT                   /product="5S ribosomal RNA"
FT   gene            277940..278149
FT                   /locus_tag="BCQ_0307"
FT                   /note="BC0307"
FT   CDS_pept        277940..278149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0307"
FT                   /product="probable alpha/beta hydrolase, N-terminal
FT                   fragment"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10791"
FT                   /db_xref="GOA:B9J1H8"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H8"
FT                   /protein_id="ACM10791.1"
FT   gene            278382..279113
FT                   /gene="frnE"
FT                   /locus_tag="BCQ_0308"
FT                   /note="BC0308"
FT   CDS_pept        278382..279113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frnE"
FT                   /locus_tag="BCQ_0308"
FT                   /product="protein disulfide isomerase (S-S rearrangase)"
FT                   /note="Code: Q; COG: COG2761"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10792"
FT                   /db_xref="GOA:B9J1H9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1H9"
FT                   /protein_id="ACM10792.1"
FT   gene            279469..280973
FT                   /locus_tag="BCQ_0309"
FT                   /note="BC0309"
FT   rRNA            279469..280973
FT                   /locus_tag="BCQ_0309"
FT                   /product="16S ribosomal RNA"
FT   gene            281152..284060
FT                   /locus_tag="BCQ_0310"
FT                   /note="BC0310"
FT   rRNA            281152..284060
FT                   /locus_tag="BCQ_0310"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(281176..281607)
FT                   /locus_tag="BCQ_0311"
FT                   /note="BC0311"
FT   CDS_pept        complement(281176..281607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10793"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10793.1"
FT   gene            284109..284223
FT                   /locus_tag="BCQ_0312"
FT                   /note="BC0312"
FT   rRNA            284109..284223
FT                   /locus_tag="BCQ_0312"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(284239..285315)
FT                   /locus_tag="BCQ_0313"
FT                   /note="BC0313"
FT   CDS_pept        complement(284239..285315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0313"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10794"
FT                   /db_xref="GOA:B9J1I1"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I1"
FT                   /protein_id="ACM10794.1"
FT                   VKQAINRGMKAYKKDESF"
FT   gene            complement(285490..286362)
FT                   /locus_tag="BCQ_0314"
FT                   /note="BC0314"
FT   CDS_pept        complement(285490..286362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0314"
FT                   /product="Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10795"
FT                   /db_xref="GOA:B9J1I2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I2"
FT                   /protein_id="ACM10795.1"
FT                   QALFVLQKD"
FT   gene            complement(286389..287111)
FT                   /locus_tag="BCQ_0315"
FT                   /note="BC0315"
FT   CDS_pept        complement(286389..287111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0315"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10796"
FT                   /db_xref="GOA:B9J1I3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I3"
FT                   /protein_id="ACM10796.1"
FT                   LDAEFLHVFISKKHEHNF"
FT   gene            complement(287269..288063)
FT                   /locus_tag="BCQ_0316"
FT                   /note="BC0316"
FT   CDS_pept        complement(287269..288063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10797"
FT                   /db_xref="GOA:B9J1I4"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I4"
FT                   /protein_id="ACM10797.1"
FT   gene            288320..289264
FT                   /locus_tag="BCQ_0317"
FT                   /note="BC0317"
FT   CDS_pept        288320..289264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0317"
FT                   /product="UDP-glucose 4-epimerase, putative"
FT                   /note="Code: MG; COG: COG0451"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10798"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I5"
FT                   /protein_id="ACM10798.1"
FT   gene            complement(289305..290078)
FT                   /locus_tag="BCQ_0318"
FT                   /note="BC0318"
FT   CDS_pept        complement(289305..290078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0318"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10799"
FT                   /db_xref="GOA:B9J1I6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I6"
FT                   /protein_id="ACM10799.1"
FT   gene            complement(290146..292077)
FT                   /locus_tag="BCQ_0319"
FT                   /note="BC0319"
FT   CDS_pept        complement(290146..292077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0319"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10800"
FT                   /db_xref="GOA:B9J1I7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I7"
FT                   /protein_id="ACM10800.1"
FT                   YLKAYLKV"
FT   gene            292583..294088
FT                   /locus_tag="BCQ_0320"
FT                   /note="BC0320"
FT   rRNA            292583..294088
FT                   /locus_tag="BCQ_0320"
FT                   /product="16S ribosomal RNA"
FT   gene            294267..297175
FT                   /locus_tag="BCQ_0321"
FT                   /note="BC0321"
FT   rRNA            294267..297175
FT                   /locus_tag="BCQ_0321"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(294291..294722)
FT                   /locus_tag="BCQ_0322"
FT                   /note="BC0322"
FT   CDS_pept        complement(294291..294722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10801"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10801.1"
FT   gene            297226..297340
FT                   /locus_tag="BCQ_0323"
FT                   /note="BC0323"
FT   rRNA            297226..297340
FT                   /locus_tag="BCQ_0323"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(297521..298933)
FT                   /gene="gabR"
FT                   /locus_tag="BCQ_0324"
FT                   /note="BC0324"
FT   CDS_pept        complement(297521..298933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BCQ_0324"
FT                   /product="GabR"
FT                   /note="Code: KE; COG: COG1167"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10802"
FT                   /db_xref="GOA:B9J1I9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1I9"
FT                   /protein_id="ACM10802.1"
FT                   RLQRALSCIYSC"
FT   gene            299052..300008
FT                   /gene="putA"
FT                   /locus_tag="BCQ_0325"
FT                   /note="BC0325"
FT   CDS_pept        299052..300008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="BCQ_0325"
FT                   /product="proline dehydrogenase"
FT                   /note="Code: E; COG: COG0506"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10803"
FT                   /db_xref="GOA:B9J1J0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J0"
FT                   /protein_id="ACM10803.1"
FT   gene            301203..302708
FT                   /locus_tag="BCQ_0326"
FT                   /note="BC0326"
FT   rRNA            301203..302708
FT                   /locus_tag="BCQ_0326"
FT                   /product="16S ribosomal RNA"
FT   gene            302887..305795
FT                   /locus_tag="BCQ_0327"
FT                   /note="BC0327"
FT   rRNA            302887..305795
FT                   /locus_tag="BCQ_0327"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(302911..303342)
FT                   /locus_tag="BCQ_0328"
FT                   /note="BC0328"
FT   CDS_pept        complement(302911..303342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10804"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10804.1"
FT   gene            305845..305959
FT                   /locus_tag="BCQ_0329"
FT                   /note="BC0329"
FT   rRNA            305845..305959
FT                   /locus_tag="BCQ_0329"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(306364..306762)
FT                   /locus_tag="BCQ_0330"
FT                   /note="BC0330"
FT   CDS_pept        complement(306364..306762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10805"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J2"
FT                   /protein_id="ACM10805.1"
FT   gene            306893..307813
FT                   /locus_tag="BCQ_0331"
FT                   /note="BC0331"
FT   CDS_pept        306893..307813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0331"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10806"
FT                   /db_xref="GOA:B9J1J3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J3"
FT                   /protein_id="ACM10806.1"
FT   gene            307946..308251
FT                   /locus_tag="BCQ_0332"
FT                   /note="BC0332"
FT   CDS_pept        307946..308251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0332"
FT                   /product="is1627s1-related, transposase, (pxo1-128)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10807"
FT                   /db_xref="GOA:B9J1J4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J4"
FT                   /protein_id="ACM10807.1"
FT   gene            308311..309102
FT                   /locus_tag="BCQ_0333"
FT                   /note="BC0333"
FT   CDS_pept        308311..309102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0333"
FT                   /product="ISPsy9, transposase OrfB"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10808"
FT                   /db_xref="GOA:B9J1J5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J5"
FT                   /protein_id="ACM10808.1"
FT   gene            complement(309184..309975)
FT                   /locus_tag="BCQ_0334"
FT                   /note="BC0334"
FT   CDS_pept        complement(309184..309975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10809"
FT                   /db_xref="GOA:B9J1J6"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J6"
FT                   /protein_id="ACM10809.1"
FT   gene            310222..310320
FT                   /locus_tag="BCQ_0335"
FT                   /note="BC0335"
FT   CDS_pept        310222..310320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10810"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J7"
FT                   /protein_id="ACM10810.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            310317..311821
FT                   /locus_tag="BCQ_0336"
FT                   /note="BC0336"
FT   rRNA            310317..311821
FT                   /locus_tag="BCQ_0336"
FT                   /product="16S ribosomal RNA"
FT   gene            312000..314908
FT                   /locus_tag="BCQ_0337"
FT                   /note="BC0337"
FT   rRNA            312000..314908
FT                   /locus_tag="BCQ_0337"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(312024..312455)
FT                   /locus_tag="BCQ_0338"
FT                   /note="BC0338"
FT   CDS_pept        complement(312024..312455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10811"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM10811.1"
FT   gene            314958..315072
FT                   /locus_tag="BCQ_0339"
FT                   /note="BC0339"
FT   rRNA            314958..315072
FT                   /locus_tag="BCQ_0339"
FT                   /product="5S ribosomal RNA"
FT   gene            315866..316351
FT                   /gene="purE"
FT                   /locus_tag="BCQ_0340"
FT                   /note="BC0340"
FT   CDS_pept        315866..316351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BCQ_0340"
FT                   /product="phosphoribosylaminoimidazole carboxylase (AIR
FT                   carboxylase) (AIRC)"
FT                   /note="Code: F; COG: COG0041"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10812"
FT                   /db_xref="GOA:B9J1J9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1J9"
FT                   /protein_id="ACM10812.1"
FT   gene            316414..317499
FT                   /gene="purK"
FT                   /locus_tag="BCQ_0341"
FT                   /note="BC0341"
FT   CDS_pept        316414..317499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BCQ_0341"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="Code: F; COG: COG0026"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10813"
FT                   /db_xref="GOA:B9J1K0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1K0"
FT                   /protein_id="ACM10813.1"
FT   gene            317496..318803
FT                   /gene="purB"
FT                   /locus_tag="BCQ_0342"
FT                   /note="BC0342"
FT   CDS_pept        317496..318803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BCQ_0342"
FT                   /product="adenylosuccinate lyase"
FT                   /note="Code: F; COG: COG0015"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10814"
FT                   /db_xref="GOA:B9J1K1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1K1"
FT                   /protein_id="ACM10814.1"
FT   gene            318892..319611
FT                   /gene="purC"
FT                   /locus_tag="BCQ_0343"
FT                   /note="BC0343"
FT   CDS_pept        318892..319611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BCQ_0343"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (SAICAR synthetase)"
FT                   /note="Code: F; COG: COG0152"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10815"
FT                   /db_xref="GOA:B9J1K2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1K2"
FT                   /protein_id="ACM10815.1"
FT                   TDAYEEILKRLGGISHV"
FT   gene            319604..319858
FT                   /gene="purS"
FT                   /locus_tag="BCQ_0344"
FT                   /note="BC0344"
FT   CDS_pept        319604..319858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BCQ_0344"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   component (FGAM synthase)"
FT                   /note="Code: F; COG: COG1828"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10816"
FT                   /db_xref="GOA:B9J1K3"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1K3"
FT                   /protein_id="ACM10816.1"
FT   gene            319855..320538
FT                   /gene="purQ"
FT                   /locus_tag="BCQ_0345"
FT                   /note="BC0345"
FT   CDS_pept        319855..320538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BCQ_0345"
FT                   /product="phosphoribosylformylglycinamidine synthase I
FT                   (FGAM synthase I)"
FT                   /note="Code: F; COG: COG0047"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10817"
FT                   /db_xref="GOA:B9J1K4"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1K4"
FT                   /protein_id="ACM10817.1"
FT                   YVVNA"
FT   gene            320522..322741
FT                   /gene="purL"
FT                   /locus_tag="BCQ_0346"
FT                   /note="BC0346"
FT   CDS_pept        320522..322741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BCQ_0346"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /note="Code: F; COG: COG0046"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10818"
FT                   /db_xref="GOA:B9J1K5"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1K5"
FT                   /protein_id="ACM10818.1"
FT   gene            322726..324141
FT                   /gene="purF"
FT                   /locus_tag="BCQ_0347"
FT                   /note="BC0347"
FT   CDS_pept        322726..324141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BCQ_0347"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0034"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10819"
FT                   /db_xref="GOA:B9J1K6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1K6"
FT                   /protein_id="ACM10819.1"
FT                   LYDYEQELLESMK"
FT   gene            324243..325283
FT                   /gene="purM"
FT                   /locus_tag="BCQ_0348"
FT                   /note="BC0348"
FT   CDS_pept        324243..325283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BCQ_0348"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="Code: F; COG: COG0150"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10820"
FT                   /db_xref="GOA:B9J1K7"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1K7"
FT                   /protein_id="ACM10820.1"
FT                   NGGTAL"
FT   gene            325280..325867
FT                   /gene="purN"
FT                   /locus_tag="BCQ_0349"
FT                   /note="BC0349"
FT   CDS_pept        325280..325867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BCQ_0349"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="Code: F; COG: COG0299"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10821"
FT                   /db_xref="GOA:B9J1K8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1K8"
FT                   /protein_id="ACM10821.1"
FT   gene            325892..327427
FT                   /gene="purH"
FT                   /locus_tag="BCQ_0350"
FT                   /note="BC0350"
FT   CDS_pept        325892..327427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BCQ_0350"
FT                   /product="phosphoribosylaminoimidazole carboxy
FT                   formyltransferase; inosine-monophosphate cyclohydrolase"
FT                   /note="Code: F; COG: COG0138"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10822"
FT                   /db_xref="GOA:B9J1K9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1K9"
FT                   /protein_id="ACM10822.1"
FT   gene            327552..328823
FT                   /gene="purD"
FT                   /locus_tag="BCQ_0351"
FT                   /note="BC0351"
FT   CDS_pept        327552..328823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BCQ_0351"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="Code: F; COG: COG0151"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10823"
FT                   /db_xref="GOA:B9J1L0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L0"
FT                   /protein_id="ACM10823.1"
FT   gene            complement(328861..329025)
FT                   /locus_tag="BCQ_0352"
FT                   /note="BC0352"
FT   CDS_pept        complement(328861..329025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4877"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10824"
FT                   /db_xref="GOA:B9J1L1"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L1"
FT                   /protein_id="ACM10824.1"
FT                   GKLKKDKDA"
FT   gene            complement(329042..329887)
FT                   /locus_tag="BCQ_0353"
FT                   /note="BC0353"
FT   CDS_pept        complement(329042..329887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0353"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="Code: O; COG: COG0330"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10825"
FT                   /db_xref="GOA:B9J1L2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L2"
FT                   /protein_id="ACM10825.1"
FT                   "
FT   gene            complement(330108..330485)
FT                   /locus_tag="BCQ_0354"
FT                   /note="BC0354"
FT   CDS_pept        complement(330108..330485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10826"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L3"
FT                   /protein_id="ACM10826.1"
FT   gene            330897..331511
FT                   /locus_tag="BCQ_0355"
FT                   /note="BC0355"
FT   CDS_pept        330897..331511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0355"
FT                   /product="pcrB family protein"
FT                   /note="Code: R; COG: COG1646"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10827"
FT                   /db_xref="GOA:B9J1L4"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L4"
FT                   /protein_id="ACM10827.1"
FT   gene            331524..333767
FT                   /gene="pcrA"
FT                   /locus_tag="BCQ_0356"
FT                   /note="BC0356"
FT   CDS_pept        331524..333767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BCQ_0356"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="Code: L; COG: COG0210"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10828"
FT                   /db_xref="GOA:B9J1L5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L5"
FT                   /protein_id="ACM10828.1"
FT   gene            333945..335792
FT                   /gene="ligA"
FT                   /locus_tag="BCQ_0357"
FT                   /note="BC0357"
FT   CDS_pept        333945..335792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BCQ_0357"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /note="Code: L; COG: COG0272"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10829"
FT                   /db_xref="GOA:B9J1L6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1L6"
FT                   /protein_id="ACM10829.1"
FT   gene            335809..337002
FT                   /locus_tag="BCQ_0358"
FT                   /note="BC0358"
FT   CDS_pept        335809..337002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0358"
FT                   /product="sex pheromone, putative"
FT                   /note="Code: R; COG: COG4851"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10830"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L7"
FT                   /protein_id="ACM10830.1"
FT   gene            337098..337868
FT                   /locus_tag="BCQ_0359"
FT                   /note="BC0359"
FT   CDS_pept        337098..337868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG0730"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10831"
FT                   /db_xref="GOA:B9J1L8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1L8"
FT                   /protein_id="ACM10831.1"
FT   gene            338022..339569
FT                   /gene="rocA"
FT                   /locus_tag="BCQ_0360"
FT                   /note="BC0360"
FT   CDS_pept        338022..339569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="BCQ_0360"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10832"
FT                   /db_xref="GOA:B9J1L9"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1L9"
FT                   /protein_id="ACM10832.1"
FT   gene            339756..339905
FT                   /locus_tag="BCQ_0361"
FT                   /note="BC0361"
FT   CDS_pept        339756..339905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10833"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M0"
FT                   /protein_id="ACM10833.1"
FT                   QTDK"
FT   gene            complement(340137..340700)
FT                   /locus_tag="BCQ_0362"
FT                   /note="BC0362"
FT   CDS_pept        complement(340137..340700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0362"
FT                   /product="isochorismatase family protein"
FT                   /note="Code: Q; COG: COG1335"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10834"
FT                   /db_xref="GOA:B9J1M1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M1"
FT                   /protein_id="ACM10834.1"
FT   gene            341173..342192
FT                   /locus_tag="BCQ_0363"
FT                   /note="BC0363"
FT   CDS_pept        341173..342192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0363"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: P; COG: COG1135"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10835"
FT                   /db_xref="GOA:B9J1M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M2"
FT                   /protein_id="ACM10835.1"
FT   gene            342182..342847
FT                   /locus_tag="BCQ_0364"
FT                   /note="BC0364"
FT   CDS_pept        342182..342847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0364"
FT                   /product="ABC transporter, permease"
FT                   /note="Code: P; COG: COG2011"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10836"
FT                   /db_xref="GOA:B9J1M3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M3"
FT                   /protein_id="ACM10836.1"
FT   gene            342869..343711
FT                   /locus_tag="BCQ_0365"
FT                   /note="BC0365"
FT   CDS_pept        342869..343711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0365"
FT                   /product="ABC transporter, substrate-binding protein;
FT                   probable NLPA lipoprotein"
FT                   /note="Code: P; COG: COG1464"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10837"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M4"
FT                   /protein_id="ACM10837.1"
FT   gene            complement(344412..344603)
FT                   /locus_tag="BCQ_0366"
FT                   /note="BC0366"
FT   CDS_pept        complement(344412..344603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10838"
FT                   /db_xref="InterPro:IPR025076"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M5"
FT                   /protein_id="ACM10838.1"
FT                   YPKEQGHHEDNLKSIIIE"
FT   gene            complement(344596..345774)
FT                   /gene="arsA"
FT                   /locus_tag="BCQ_0367"
FT                   /note="BC0367"
FT   CDS_pept        complement(344596..345774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="BCQ_0367"
FT                   /product="arsenite-transporting ATPase"
FT                   /note="Code: P; COG: COG0003"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10839"
FT                   /db_xref="GOA:B9J1M6"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M6"
FT                   /protein_id="ACM10839.1"
FT   gene            complement(345855..346337)
FT                   /locus_tag="BCQ_0368"
FT                   /note="BC0368"
FT   CDS_pept        complement(345855..346337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0368"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Code: K; COG: COG1846"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10840"
FT                   /db_xref="GOA:B9J1M7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M7"
FT                   /protein_id="ACM10840.1"
FT   gene            346569..346805
FT                   /gene="yubF"
FT                   /locus_tag="BCQ_0369"
FT                   /note="BC0369"
FT   CDS_pept        346569..346805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yubF"
FT                   /locus_tag="BCQ_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4682"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10841"
FT                   /db_xref="GOA:B9J1M8"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1M8"
FT                   /protein_id="ACM10841.1"
FT   gene            346947..347237
FT                   /gene="gatC"
FT                   /locus_tag="BCQ_0370"
FT                   /note="BC0370"
FT   CDS_pept        346947..347237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BCQ_0370"
FT                   /product="glutaminyl-tRNA synthase, glutamine-hydrolyzing,
FT                   subunit C (glutamyl-tRNA(Gln) amidotransferase, subunit C)"
FT                   /note="Code: J; COG: COG0721"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10842"
FT                   /db_xref="GOA:B9J1M9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1M9"
FT                   /protein_id="ACM10842.1"
FT   gene            347253..348710
FT                   /gene="gatA"
FT                   /locus_tag="BCQ_0371"
FT                   /note="BC0371"
FT   CDS_pept        347253..348710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BCQ_0371"
FT                   /product="glutaminyl-tRNA synthase, glutamine-hydrolyzing,
FT                   subunit A (glutamyl-tRNA(Gln) amidotransferase, subunit A)"
FT                   /note="Code: J; COG: COG0154"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10843"
FT                   /db_xref="GOA:B9J1N0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1N0"
FT                   /protein_id="ACM10843.1"
FT   gene            348725..350152
FT                   /gene="gatB"
FT                   /locus_tag="BCQ_0372"
FT                   /note="BC0372"
FT   CDS_pept        348725..350152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BCQ_0372"
FT                   /product="glutaminyl-tRNA synthase, glutamine-hydrolyzing,
FT                   subunit B (glutamyl-tRNA(Gln) amidotransferase, subunit B)"
FT                   /note="Code: J; COG: COG0064"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10844"
FT                   /db_xref="GOA:B9J1N1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J1N1"
FT                   /protein_id="ACM10844.1"
FT                   ANPPLVNKILLEEINKR"
FT   gene            350768..351529
FT                   /locus_tag="BCQ_0373"
FT                   /note="BC0373"
FT   CDS_pept        350768..351529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0373"
FT                   /product="DAGKc, Diacylglycerol kinase catalytic domain
FT                   (presumed)"
FT                   /note="Code: IR; COG: COG1597"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10845"
FT                   /db_xref="GOA:B9J1N2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N2"
FT                   /protein_id="ACM10845.1"
FT   gene            complement(351542..352711)
FT                   /gene="cfa"
FT                   /locus_tag="BCQ_0374"
FT                   /note="BC0374"
FT   CDS_pept        complement(351542..352711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="BCQ_0374"
FT                   /product="probable cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /note="Code: M; COG: COG2230"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10846"
FT                   /db_xref="GOA:B9J1N3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N3"
FT                   /protein_id="ACM10846.1"
FT   gene            352960..353706
FT                   /locus_tag="BCQ_0375"
FT                   /note="BC0375"
FT   CDS_pept        352960..353706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0375"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="Code: R; COG: COG0546"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10847"
FT                   /db_xref="GOA:B9J1N4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N4"
FT                   /protein_id="ACM10847.1"
FT   gene            353849..355213
FT                   /gene="gabT"
FT                   /locus_tag="BCQ_0376"
FT                   /note="BC0376"
FT   CDS_pept        353849..355213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BCQ_0376"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="Code: E; COG: COG0160"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10848"
FT                   /db_xref="GOA:B9J1N5"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N5"
FT                   /protein_id="ACM10848.1"
FT   gene            355330..356697
FT                   /locus_tag="BCQ_0377"
FT                   /note="BC0377"
FT   CDS_pept        355330..356697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0377"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /note="Code: KT; COG: COG3829"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10849"
FT                   /db_xref="GOA:B9J1N6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N6"
FT                   /protein_id="ACM10849.1"
FT   gene            356732..358141
FT                   /gene="gadD"
FT                   /locus_tag="BCQ_0378"
FT                   /note="BC0378"
FT   CDS_pept        356732..358141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadD"
FT                   /locus_tag="BCQ_0378"
FT                   /product="succinate-semialdehyde dehydrogenase (NAD(P)+)"
FT                   /note="Code: C; COG: COG1012"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10850"
FT                   /db_xref="GOA:B9J1N7"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N7"
FT                   /protein_id="ACM10850.1"
FT                   YLEIKYISLGL"
FT   gene            358189..358512
FT                   /locus_tag="BCQ_0379"
FT                   /note="BC0379"
FT   CDS_pept        358189..358512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0379"
FT                   /product="Quaternary ammonium compound-resistance protein"
FT                   /note="Code: P; COG: COG2076"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10851"
FT                   /db_xref="GOA:B9J1N8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N8"
FT                   /protein_id="ACM10851.1"
FT                   SAS"
FT   gene            complement(358553..359782)
FT                   /gene="ampS"
FT                   /locus_tag="BCQ_0380"
FT                   /note="BC0380"
FT   CDS_pept        complement(358553..359782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BCQ_0380"
FT                   /product="aminopeptidase AmpS"
FT                   /note="Code: E; COG: COG2309"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10852"
FT                   /db_xref="GOA:B9J1N9"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1N9"
FT                   /protein_id="ACM10852.1"
FT                   PIFRKGNWAF"
FT   gene            complement(359899..360981)
FT                   /locus_tag="BCQ_0381"
FT                   /note="BC0381"
FT   CDS_pept        complement(359899..360981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0381"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="Code: G; COG: COG0726"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10853"
FT                   /db_xref="GOA:B9J1P0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P0"
FT                   /protein_id="ACM10853.1"
FT   gene            complement(361159..362355)
FT                   /gene="nupC"
FT                   /locus_tag="BCQ_0382"
FT                   /note="BC0382"
FT   CDS_pept        complement(361159..362355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="BCQ_0382"
FT                   /product="nucleoside transporter"
FT                   /note="Code: F; COG: COG1972"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10854"
FT                   /db_xref="GOA:B9J1P1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P1"
FT                   /protein_id="ACM10854.1"
FT   gene            362780..364156
FT                   /gene="trmA"
FT                   /locus_tag="BCQ_0383"
FT                   /note="BC0383"
FT   CDS_pept        362780..364156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="BCQ_0383"
FT                   /product="RNA methyltransferase protein, trmA family (tRNA
FT                   (uracil-5-)-methyltransferase)"
FT                   /note="Code: J; COG: COG2265"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10855"
FT                   /db_xref="GOA:B9J1P2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P2"
FT                   /protein_id="ACM10855.1"
FT                   "
FT   gene            364253..365242
FT                   /locus_tag="BCQ_0384"
FT                   /note="BC0384"
FT   CDS_pept        364253..365242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0384"
FT                   /product="dihydrouridine synthase family protein"
FT                   /note="Code: J; COG: COG0042"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10856"
FT                   /db_xref="GOA:B9J1P3"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P3"
FT                   /protein_id="ACM10856.1"
FT   gene            365755..368532
FT                   /gene="kinA"
FT                   /locus_tag="BCQ_0385"
FT                   /note="BC0385"
FT   CDS_pept        365755..368532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinA"
FT                   /locus_tag="BCQ_0385"
FT                   /product="sensor histidine kinase (sporulation kinase),
FT                   C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10857"
FT                   /db_xref="GOA:B9J1P4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P4"
FT                   /protein_id="ACM10857.1"
FT   gene            368728..370215
FT                   /gene="ilvB"
FT                   /locus_tag="BCQ_0386"
FT                   /note="BC0386"
FT   CDS_pept        368728..370215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BCQ_0386"
FT                   /product="acetolactate synthase large subunit"
FT                   /note="Code: EH; COG: COG0028"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10858"
FT                   /db_xref="GOA:B9J1P5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P5"
FT                   /protein_id="ACM10858.1"
FT   gene            complement(370270..370899)
FT                   /locus_tag="BCQ_0387"
FT                   /note="BC0387"
FT   CDS_pept        complement(370270..370899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10859"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P6"
FT                   /protein_id="ACM10859.1"
FT   gene            371268..371786
FT                   /locus_tag="BCQ_0388"
FT                   /note="BC0388"
FT   CDS_pept        371268..371786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4807"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10860"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P7"
FT                   /protein_id="ACM10860.1"
FT                   KGLAVKYRG"
FT   gene            373074..374363
FT                   /gene="narA"
FT                   /locus_tag="BCQ_0389"
FT                   /note="BC0389"
FT   CDS_pept        373074..374363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narA"
FT                   /locus_tag="BCQ_0389"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10861"
FT                   /db_xref="GOA:B9J1P8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P8"
FT                   /protein_id="ACM10861.1"
FT   gene            374373..374969
FT                   /locus_tag="BCQ_0390"
FT                   /note="BC0390"
FT   CDS_pept        374373..374969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10862"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P9"
FT                   /protein_id="ACM10862.1"
FT   gene            374988..375881
FT                   /locus_tag="BCQ_0391"
FT                   /note="BC0391"
FT   CDS_pept        374988..375881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10863"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q0"
FT                   /protein_id="ACM10863.1"
FT                   VCESKYKNRKKVYSVE"
FT   gene            375874..376872
FT                   /gene="idh"
FT                   /locus_tag="BCQ_0392"
FT                   /note="BC0392"
FT   CDS_pept        375874..376872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idh"
FT                   /locus_tag="BCQ_0392"
FT                   /product="Idh"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10864"
FT                   /db_xref="GOA:B9J1Q1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q1"
FT                   /protein_id="ACM10864.1"
FT   gene            376865..379135
FT                   /gene="glcD"
FT                   /locus_tag="BCQ_0393"
FT                   /note="BC0393"
FT   CDS_pept        376865..379135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BCQ_0393"
FT                   /product="(S)-2-hydroxy-acid oxidase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10865"
FT                   /db_xref="GOA:B9J1Q2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q2"
FT                   /protein_id="ACM10865.1"
FT                   KLC"
FT   gene            379358..380506
FT                   /gene="argE"
FT                   /locus_tag="BCQ_0394"
FT                   /note="BC0394"
FT   CDS_pept        379358..380506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="BCQ_0394"
FT                   /product="acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10866"
FT                   /db_xref="GOA:B9J1Q3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q3"
FT                   /protein_id="ACM10866.1"
FT   gene            380526..381275
FT                   /locus_tag="BCQ_0395"
FT                   /note="BC0395"
FT   CDS_pept        380526..381275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10867"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q4"
FT                   /protein_id="ACM10867.1"
FT   gene            381350..381619
FT                   /locus_tag="BCQ_0396"
FT                   /note="BC0396"
FT   CDS_pept        381350..381619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10868"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q5"
FT                   /protein_id="ACM10868.1"
FT   mobile_element  complement(381795..382594)
FT                   /mobile_element_type="insertion sequence:Q1-RP3"
FT   gene            381850..383088
FT                   /locus_tag="BCQ_0397"
FT                   /note="BC0397"
FT   CDS_pept        381850..383088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0397"
FT                   /product="transposase (22)"
FT                   /note="Code: L; COG: COG4584"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10869"
FT                   /db_xref="GOA:B9ISY7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9ISY7"
FT                   /protein_id="ACM10869.1"
FT                   LAAYAALEEGESV"
FT   gene            383085..383849
FT                   /locus_tag="BCQ_0398"
FT                   /note="BC0398"
FT   CDS_pept        383085..383849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0398"
FT                   /product="transposase (23)"
FT                   /note="Code: L; COG: COG1484"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10870"
FT                   /db_xref="GOA:B9ISY8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B9ISY8"
FT                   /protein_id="ACM10870.1"
FT   mobile_element  complement(383114..383904)
FT                   /mobile_element_type="insertion sequence:Q1-RP2"
FT   gene            383984..385267
FT                   /gene="nprR"
FT                   /locus_tag="BCQ_0399"
FT                   /note="BC0399"
FT   CDS_pept        383984..385267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nprR"
FT                   /locus_tag="BCQ_0399"
FT                   /product="transcriptional activator (transcriptional
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10871"
FT                   /db_xref="GOA:B9J1Q8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q8"
FT                   /protein_id="ACM10871.1"
FT   gene            complement(385314..386597)
FT                   /gene="serS"
FT                   /locus_tag="BCQ_0400"
FT                   /note="BC0400"
FT   CDS_pept        complement(385314..386597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BCQ_0400"
FT                   /product="SerS"
FT                   /note="Code: J; COG: COG0172"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10872"
FT                   /db_xref="GOA:B9J1Q9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1Q9"
FT                   /protein_id="ACM10872.1"
FT   gene            386845..387321
FT                   /gene="bcP"
FT                   /locus_tag="BCQ_0401"
FT                   /note="BC0401"
FT   CDS_pept        386845..387321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BCQ_0401"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="Code: O; COG: COG1225"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10873"
FT                   /db_xref="GOA:B9J1R0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R0"
FT                   /protein_id="ACM10873.1"
FT   gene            387368..390556
FT                   /gene="dhbF"
FT                   /locus_tag="BCQ_0402"
FT                   /note="BC0402"
FT   CDS_pept        387368..390556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhbF"
FT                   /locus_tag="BCQ_0402"
FT                   /product="multifunctional nonribosomal peptide synthetase
FT                   (mycosubtilin synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10874"
FT                   /db_xref="GOA:B9J1R1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R1"
FT                   /protein_id="ACM10874.1"
FT                   YDTCIFNAKKVILN"
FT   gene            390683..391921
FT                   /locus_tag="BCQ_0403"
FT                   /note="BC0403"
FT   CDS_pept        390683..391921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0403"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10875"
FT                   /db_xref="GOA:B9J1R2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R2"
FT                   /protein_id="ACM10875.1"
FT                   SIENDKGILVVKE"
FT   gene            complement(392039..392872)
FT                   /locus_tag="BCQ_0404"
FT                   /note="BC0404"
FT   CDS_pept        complement(392039..392872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0404"
FT                   /product="transposase (06)"
FT                   /note="Code: L; COG: COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10876"
FT                   /db_xref="GOA:B9J1R3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R3"
FT                   /protein_id="ACM10876.1"
FT   mobile_element  392188..392732
FT                   /mobile_element_type="insertion sequence:Q1-RP1"
FT                   /note="partial"
FT   mobile_element  392823..392928
FT                   /mobile_element_type="insertion sequence:Q1-RP1"
FT                   /note="partial"
FT   gene            complement(392878..393168)
FT                   /locus_tag="BCQ_0405"
FT                   /note="BC0405"
FT   CDS_pept        complement(392878..393168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0405"
FT                   /product="transposase (05)"
FT                   /note="Code: L; COG: COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10877"
FT                   /db_xref="GOA:B9J1R4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R4"
FT                   /protein_id="ACM10877.1"
FT   gene            393811..394329
FT                   /locus_tag="BCQ_0406"
FT                   /note="BC0406"
FT   CDS_pept        393811..394329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4807"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10878"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1P7"
FT                   /protein_id="ACM10878.1"
FT                   KGLAVKYRG"
FT   gene            394423..395130
FT                   /locus_tag="BCQ_0407"
FT                   /note="BC0407"
FT   CDS_pept        394423..395130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0407"
FT                   /product="zinc metalloprotease"
FT                   /note="Code: R; COG: COG1451"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10879"
FT                   /db_xref="GOA:B9J1R6"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R6"
FT                   /protein_id="ACM10879.1"
FT                   ENWLALSSWKMTV"
FT   gene            complement(395280..395975)
FT                   /locus_tag="BCQ_0408"
FT                   /note="BC0408"
FT   CDS_pept        complement(395280..395975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10880"
FT                   /db_xref="GOA:B9J1R7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R7"
FT                   /protein_id="ACM10880.1"
FT                   EDFVVKFGR"
FT   gene            complement(395990..397099)
FT                   /locus_tag="BCQ_0409"
FT                   /note="BC0409"
FT   CDS_pept        complement(395990..397099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0409"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="Code: MR; COG: COG4948"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10881"
FT                   /db_xref="GOA:B9J1R8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R8"
FT                   /protein_id="ACM10881.1"
FT   gene            397192..398463
FT                   /locus_tag="BCQ_0410"
FT                   /note="BC0410"
FT   CDS_pept        397192..398463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10882"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1R9"
FT                   /protein_id="ACM10882.1"
FT   gene            complement(398452..399873)
FT                   /gene="nhaC"
FT                   /locus_tag="BCQ_0411"
FT                   /note="BC0411"
FT   CDS_pept        complement(398452..399873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="BCQ_0411"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="Code: C; COG: COG1757"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10883"
FT                   /db_xref="GOA:B9J1S0"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S0"
FT                   /protein_id="ACM10883.1"
FT                   EKAELLKKQKAQLEA"
FT   gene            400171..401286
FT                   /gene="amhX"
FT                   /locus_tag="BCQ_0412"
FT                   /note="BC0412"
FT   CDS_pept        400171..401286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BCQ_0412"
FT                   /product="amidohydrolase amhX"
FT                   /note="Code: R; COG: COG1473"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10884"
FT                   /db_xref="GOA:B9J1S1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S1"
FT                   /protein_id="ACM10884.1"
FT   gene            401510..402118
FT                   /locus_tag="BCQ_0413"
FT                   /note="BC0413"
FT   CDS_pept        401510..402118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0413"
FT                   /product="Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10885"
FT                   /db_xref="GOA:B9J1S2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S2"
FT                   /protein_id="ACM10885.1"
FT   gene            complement(402166..403692)
FT                   /gene="ahpF"
FT                   /locus_tag="BCQ_0414"
FT                   /note="BC0414"
FT   CDS_pept        complement(402166..403692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BCQ_0414"
FT                   /product="probable alkyl hydroperoxide reductase, subunit
FT                   F"
FT                   /note="Code: O; COG: COG3634"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10886"
FT                   /db_xref="GOA:B9J1S3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S3"
FT                   /protein_id="ACM10886.1"
FT   gene            complement(403707..404270)
FT                   /gene="ahpC"
FT                   /locus_tag="BCQ_0415"
FT                   /note="BC0415"
FT   CDS_pept        complement(403707..404270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BCQ_0415"
FT                   /product="probable alkyl hydroperoxide reductase
FT                   (peroxiredoxin)"
FT                   /note="Code: O; COG: COG0450"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10887"
FT                   /db_xref="GOA:B9J1S4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S4"
FT                   /protein_id="ACM10887.1"
FT   gene            404859..406088
FT                   /gene="mtrK"
FT                   /locus_tag="BCQ_0416"
FT                   /note="BC0416"
FT   CDS_pept        404859..406088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrK"
FT                   /locus_tag="BCQ_0416"
FT                   /product="probable 5-methylthioribose kinase"
FT                   /note="Code: R; COG: COG4857"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10888"
FT                   /db_xref="GOA:B9J1S5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S5"
FT                   /protein_id="ACM10888.1"
FT                   LKEQSMHYAK"
FT   gene            406101..407144
FT                   /locus_tag="BCQ_0417"
FT                   /note="BC0417"
FT   CDS_pept        406101..407144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0417"
FT                   /product="translation initiation factor, putative, aIF-2BI
FT                   family"
FT                   /note="Code: J; COG: COG0182"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10889"
FT                   /db_xref="GOA:B9J1S6"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S6"
FT                   /protein_id="ACM10889.1"
FT                   NLKKLFQ"
FT   gene            407199..407840
FT                   /gene="fucA"
FT                   /locus_tag="BCQ_0418"
FT                   /note="BC0418"
FT   CDS_pept        407199..407840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="BCQ_0418"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /note="Code: G; COG: COG0235"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10890"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S7"
FT                   /protein_id="ACM10890.1"
FT   gene            408094..408681
FT                   /locus_tag="BCQ_0419"
FT                   /note="BC0419"
FT   CDS_pept        408094..408681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10891"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S8"
FT                   /protein_id="ACM10891.1"
FT   gene            408678..410906
FT                   /locus_tag="BCQ_0420"
FT                   /note="BC0420"
FT   CDS_pept        408678..410906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0420"
FT                   /product="s-layer domain protein, SLH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10892"
FT                   /db_xref="UniProtKB/TrEMBL:B9J1S9"
FT                   /protein_id="ACM10892.1"
FT   gene            complement(410956..411963)
FT                   /locus_tag="BCQ_0421"
FT                   /note="BC0421"
FT   CDS_pept        complement(410956..411963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0421"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10893"
FT                   /db_xref="GOA:B9J2H4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H4"
FT                   /protein_id="ACM10893.1"
FT   gene            complement(411960..412976)
FT                   /gene="fhuB"
FT                   /locus_tag="BCQ_0422"
FT                   /note="BC0422"
FT   CDS_pept        complement(411960..412976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="BCQ_0422"
FT                   /product="ferrichrome transport system permease"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10894"
FT                   /db_xref="GOA:B9J2H5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H5"
FT                   /protein_id="ACM10894.1"
FT   gene            complement(413049..413966)
FT                   /gene="fhuD"
FT                   /locus_tag="BCQ_0423"
FT                   /note="BC0423"
FT   CDS_pept        complement(413049..413966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="BCQ_0423"
FT                   /product="ferrichrome-binding periplasmic protein"
FT                   /note="Code: P; COG: COG0614"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10895"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H6"
FT                   /protein_id="ACM10895.1"
FT   gene            414298..415347
FT                   /gene="trxB"
FT                   /locus_tag="BCQ_0424"
FT                   /note="BC0424"
FT   CDS_pept        414298..415347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="BCQ_0424"
FT                   /product="probable thioredoxin reductase"
FT                   /note="Code: O; COG: COG0492"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10896"
FT                   /db_xref="GOA:B9J2H7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H7"
FT                   /protein_id="ACM10896.1"
FT                   RELIKQMMK"
FT   gene            complement(415543..415911)
FT                   /locus_tag="BCQ_0425"
FT                   /note="BC0425"
FT   CDS_pept        complement(415543..415911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10897"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H8"
FT                   /protein_id="ACM10897.1"
FT                   IASILNMPFPNERAKGTA"
FT   gene            416093..416332
FT                   /locus_tag="BCQ_0426"
FT                   /note="BC0426"
FT   CDS_pept        416093..416332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0426"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10898"
FT                   /db_xref="GOA:B9J2H9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2H9"
FT                   /protein_id="ACM10898.1"
FT   gene            416569..417084
FT                   /gene="cotB"
FT                   /locus_tag="BCQ_0427"
FT                   /note="BC0427"
FT   CDS_pept        416569..417084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotB"
FT                   /locus_tag="BCQ_0427"
FT                   /product="spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10899"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I0"
FT                   /protein_id="ACM10899.1"
FT                   QRQSSRGR"
FT   gene            417617..417724
FT                   /locus_tag="BCQ_0428"
FT                   /note="BC0428"
FT   CDS_pept        417617..417724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10900"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I1"
FT                   /protein_id="ACM10900.1"
FT   gene            417717..418385
FT                   /locus_tag="BCQ_0429"
FT                   /note="BC0429"
FT   CDS_pept        417717..418385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10901"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I2"
FT                   /protein_id="ACM10901.1"
FT                   "
FT   gene            418623..419888
FT                   /locus_tag="BCQ_0430"
FT                   /note="BC0430"
FT   CDS_pept        418623..419888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10902"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I3"
FT                   /protein_id="ACM10902.1"
FT   gene            420419..420694
FT                   /locus_tag="BCQ_0431"
FT                   /note="BC0431"
FT   CDS_pept        420419..420694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10903"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I4"
FT                   /protein_id="ACM10903.1"
FT   gene            complement(420722..421354)
FT                   /locus_tag="BCQ_0432"
FT                   /note="BC0432"
FT   CDS_pept        complement(420722..421354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0432"
FT                   /product="metal-dependent hydrolase"
FT                   /note="Code: R; COG: COG1878"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10904"
FT                   /db_xref="GOA:B9J2I5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I5"
FT                   /protein_id="ACM10904.1"
FT   gene            421703..422812
FT                   /locus_tag="BCQ_0433"
FT                   /note="BC0433"
FT   CDS_pept        421703..422812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0433"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10905"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I6"
FT                   /protein_id="ACM10905.1"
FT   gene            422934..423716
FT                   /locus_tag="BCQ_0434"
FT                   /note="BC0434"
FT   CDS_pept        422934..423716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG3541"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10906"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I7"
FT                   /protein_id="ACM10906.1"
FT   gene            complement(423730..425031)
FT                   /locus_tag="BCQ_0435"
FT                   /note="BC0435"
FT   CDS_pept        complement(423730..425031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0435"
FT                   /product="sugar transporter; possible benzoate transport
FT                   protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10907"
FT                   /db_xref="GOA:B9J2I8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I8"
FT                   /protein_id="ACM10907.1"
FT   gene            complement(425171..426697)
FT                   /locus_tag="BCQ_0436"
FT                   /note="BC0436"
FT   CDS_pept        complement(425171..426697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0436"
FT                   /product="Rieske 2Fe-2S iron-sulfur protein, putative"
FT                   /note="Code: E; COG: COG0665"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10908"
FT                   /db_xref="GOA:B9J2I9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2I9"
FT                   /protein_id="ACM10908.1"
FT   gene            427279..428364
FT                   /locus_tag="BCQ_0437"
FT                   /note="BC0437"
FT   CDS_pept        427279..428364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0437"
FT                   /product="possible fatty acid desaturase"
FT                   /note="Code: I; COG: COG3239"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10909"
FT                   /db_xref="GOA:B9J2J0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J0"
FT                   /protein_id="ACM10909.1"
FT   gene            complement(428417..431971)
FT                   /locus_tag="BCQ_0438"
FT                   /note="BC0438"
FT   CDS_pept        complement(428417..431971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10910"
FT                   /db_xref="GOA:B9J2J1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J1"
FT                   /protein_id="ACM10910.1"
FT                   SRLKKSYYYMQKVYQATK"
FT   gene            complement(431958..432998)
FT                   /locus_tag="BCQ_0439"
FT                   /note="BC0439"
FT   CDS_pept        complement(431958..432998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10911"
FT                   /db_xref="GOA:B9J2J2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J2"
FT                   /protein_id="ACM10911.1"
FT                   TTYALS"
FT   gene            complement(432995..433879)
FT                   /gene="resD"
FT                   /locus_tag="BCQ_0440"
FT                   /note="BC0440"
FT   CDS_pept        complement(432995..433879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resD"
FT                   /locus_tag="BCQ_0440"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10912"
FT                   /db_xref="GOA:B9J2J3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J3"
FT                   /protein_id="ACM10912.1"
FT                   RLAHLLEGRNEGY"
FT   gene            complement(434080..434889)
FT                   /locus_tag="BCQ_0441"
FT                   /note="BC0441"
FT   CDS_pept        complement(434080..434889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0441"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10913"
FT                   /db_xref="GOA:B9J2J4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J4"
FT                   /protein_id="ACM10913.1"
FT   gene            complement(434864..435658)
FT                   /locus_tag="BCQ_0442"
FT                   /note="BC0442"
FT   CDS_pept        complement(434864..435658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0442"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10914"
FT                   /db_xref="GOA:B9J2J5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J5"
FT                   /protein_id="ACM10914.1"
FT   gene            complement(435780..436502)
FT                   /gene="glnQ"
FT                   /locus_tag="BCQ_0443"
FT                   /note="BC0443"
FT   CDS_pept        complement(435780..436502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BCQ_0443"
FT                   /product="glutamine transport, ATP-binding protein"
FT                   /note="Code: E; COG: COG1126"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10915"
FT                   /db_xref="GOA:B9J2J6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J6"
FT                   /protein_id="ACM10915.1"
FT                   FFSAPSHERAKQFLRNVL"
FT   gene            436713..438005
FT                   /gene="mcpA"
FT                   /locus_tag="BCQ_0444"
FT                   /note="BC0444"
FT   CDS_pept        436713..438005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA"
FT                   /locus_tag="BCQ_0444"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10916"
FT                   /db_xref="GOA:B9J2J7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J7"
FT                   /protein_id="ACM10916.1"
FT   gene            438244..439908
FT                   /locus_tag="BCQ_0445"
FT                   /note="BC0445"
FT   CDS_pept        438244..439908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0445"
FT                   /product="alpha-glucosidase"
FT                   /note="Code: G; COG: COG0366"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10917"
FT                   /db_xref="GOA:B9J2J8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J8"
FT                   /protein_id="ACM10917.1"
FT   gene            440114..441751
FT                   /gene="ptsG"
FT                   /locus_tag="BCQ_0446"
FT                   /note="BC0446"
FT   CDS_pept        440114..441751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /locus_tag="BCQ_0446"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase (enzyme II of the phosphotransferase
FT                   system) (PTS system glucose-specific IIBC component)"
FT                   /note="Code: G; COG: COG1263"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10918"
FT                   /db_xref="GOA:B9J2J9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2J9"
FT                   /protein_id="ACM10918.1"
FT   gene            441756..442547
FT                   /locus_tag="BCQ_0447"
FT                   /note="BC0447"
FT   CDS_pept        441756..442547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0447"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="Code: R; COG: COG3568"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10919"
FT                   /db_xref="GOA:B9J2K0"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K0"
FT                   /protein_id="ACM10919.1"
FT   gene            442853..445798
FT                   /locus_tag="BCQ_0448"
FT                   /note="BC0448"
FT   CDS_pept        442853..445798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0448"
FT                   /product="possible phage infection protein-like membrane
FT                   protein"
FT                   /note="Code: S; COG: COG1511"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10920"
FT                   /db_xref="GOA:B9J2K1"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K1"
FT                   /protein_id="ACM10920.1"
FT   gene            445990..448179
FT                   /gene="topB"
FT                   /locus_tag="BCQ_0449"
FT                   /note="BC0449"
FT   CDS_pept        445990..448179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BCQ_0449"
FT                   /product="DNA topoisomerase (DNA topoisomerase I)"
FT                   /note="Code: L; COG: COG0550"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10921"
FT                   /db_xref="GOA:B9J2K2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K2"
FT                   /protein_id="ACM10921.1"
FT   gene            448981..449310
FT                   /locus_tag="BCQ_0450"
FT                   /note="BC0450"
FT   CDS_pept        448981..449310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0450"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="Code: K; COG: COG1695"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10922"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K3"
FT                   /protein_id="ACM10922.1"
FT                   NKEGK"
FT   gene            complement(450158..451357)
FT                   /locus_tag="BCQ_0451"
FT                   /note="BC0451"
FT   CDS_pept        complement(450158..451357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0451"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Code: V; COG: COG0577"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10923"
FT                   /db_xref="GOA:B9J2K4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K4"
FT                   /protein_id="ACM10923.1"
FT                   "
FT   gene            complement(451354..452034)
FT                   /locus_tag="BCQ_0452"
FT                   /note="BC0452"
FT   CDS_pept        complement(451354..452034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0452"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Code: V; COG: COG1136"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10924"
FT                   /db_xref="GOA:B9J2K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K5"
FT                   /protein_id="ACM10924.1"
FT                   RCAV"
FT   gene            complement(452031..453218)
FT                   /locus_tag="BCQ_0453"
FT                   /note="BC0453"
FT   CDS_pept        complement(452031..453218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0453"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10925"
FT                   /db_xref="GOA:B9J2K6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K6"
FT                   /protein_id="ACM10925.1"
FT   gene            453654..453863
FT                   /locus_tag="BCQ_0454"
FT                   /note="BC0454"
FT   CDS_pept        453654..453863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10926"
FT                   /db_xref="GOA:B9J2K7"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K7"
FT                   /protein_id="ACM10926.1"
FT   gene            454300..454848
FT                   /locus_tag="BCQ_0455"
FT                   /note="BC0455"
FT   CDS_pept        454300..454848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10927"
FT                   /db_xref="GOA:B9J2K8"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K8"
FT                   /protein_id="ACM10927.1"
FT   gene            454996..456276
FT                   /locus_tag="BCQ_0456"
FT                   /note="BC0456"
FT   CDS_pept        454996..456276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0456"
FT                   /product="Heteropolysaccharide repeat unit export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10928"
FT                   /db_xref="GOA:B9J2K9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2K9"
FT                   /protein_id="ACM10928.1"
FT   gene            456280..456951
FT                   /gene="ydbJ"
FT                   /locus_tag="BCQ_0457"
FT                   /note="BC0457"
FT   CDS_pept        456280..456951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BCQ_0457"
FT                   /product="YdbJ"
FT                   /note="Code: V; COG: COG1131"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10929"
FT                   /db_xref="GOA:B9J2L0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L0"
FT                   /protein_id="ACM10929.1"
FT                   T"
FT   gene            456941..457471
FT                   /locus_tag="BCQ_0458"
FT                   /note="BC0458"
FT   CDS_pept        456941..457471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10930"
FT                   /db_xref="GOA:B9J2L1"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L1"
FT                   /protein_id="ACM10930.1"
FT                   YLSPSLVDKSYII"
FT   gene            457536..457634
FT                   /locus_tag="BCQ_0459"
FT                   /note="BC0459"
FT   CDS_pept        457536..457634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10931"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L2"
FT                   /protein_id="ACM10931.1"
FT                   /translation="MMVSNQEGGNIIKRKVILNAYKKSHKAVIALF"
FT   gene            complement(458146..458478)
FT                   /gene="topB"
FT                   /locus_tag="BCQ_0460"
FT                   /note="BC0460"
FT   CDS_pept        complement(458146..458478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BCQ_0460"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10932"
FT                   /db_xref="GOA:B9J2L3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L3"
FT                   /protein_id="ACM10932.1"
FT                   DAGLSL"
FT   gene            458929..459735
FT                   /gene="thiM"
FT                   /locus_tag="BCQ_0461"
FT                   /note="BC0461"
FT   CDS_pept        458929..459735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BCQ_0461"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /note="Code: H; COG: COG2145"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10933"
FT                   /db_xref="GOA:B9J2L4"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2L4"
FT                   /protein_id="ACM10933.1"
FT   gene            459752..460411
FT                   /gene="thiE"
FT                   /locus_tag="BCQ_0462"
FT                   /note="BC0462"
FT   CDS_pept        459752..460411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BCQ_0462"
FT                   /product="thiamine-phosphate diphosphorylase
FT                   (thiamine-phosphate pyrophosphorylase)"
FT                   /note="Code: H; COG: COG0352"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10934"
FT                   /db_xref="GOA:B9J2L5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2L5"
FT                   /protein_id="ACM10934.1"
FT   gene            460491..461426
FT                   /locus_tag="BCQ_0463"
FT                   /note="BC0463"
FT   CDS_pept        460491..461426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0463"
FT                   /product="group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10935"
FT                   /db_xref="InterPro:IPR021440"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L6"
FT                   /protein_id="ACM10935.1"
FT   gene            complement(461485..462720)
FT                   /gene="dcuB"
FT                   /locus_tag="BCQ_0464"
FT                   /note="BC0464"
FT   CDS_pept        complement(461485..462720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuB"
FT                   /locus_tag="BCQ_0464"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /note="Code: R; COG: COG2704"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10936"
FT                   /db_xref="GOA:B9J2L7"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L7"
FT                   /protein_id="ACM10936.1"
FT                   IGIGMLLISIMF"
FT   gene            463308..465047
FT                   /gene="cheW"
FT                   /locus_tag="BCQ_0465"
FT                   /note="BC0465"
FT   CDS_pept        463308..465047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BCQ_0465"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10937"
FT                   /db_xref="GOA:B9J2L8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L8"
FT                   /protein_id="ACM10937.1"
FT                   FKS"
FT   gene            465311..465631
FT                   /locus_tag="BCQ_0466"
FT                   /note="BC0466"
FT   CDS_pept        465311..465631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0011"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10938"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2L9"
FT                   /protein_id="ACM10938.1"
FT                   AI"
FT   gene            465603..466376
FT                   /locus_tag="BCQ_0467"
FT                   /note="BC0467"
FT   CDS_pept        465603..466376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0467"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="Code: P; COG: COG0600"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10939"
FT                   /db_xref="GOA:B9J2M0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M0"
FT                   /protein_id="ACM10939.1"
FT   gene            466373..467371
FT                   /locus_tag="BCQ_0468"
FT                   /note="BC0468"
FT   CDS_pept        466373..467371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0468"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="Code: P; COG: COG0715"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10940"
FT                   /db_xref="GOA:B9J2M1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M1"
FT                   /protein_id="ACM10940.1"
FT   gene            467509..468117
FT                   /locus_tag="BCQ_0469"
FT                   /note="BC0469"
FT   CDS_pept        467509..468117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0469"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: P; COG: COG1116"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10941"
FT                   /db_xref="GOA:B9J2M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M2"
FT                   /protein_id="ACM10941.1"
FT   gene            468184..468957
FT                   /locus_tag="BCQ_0470"
FT                   /note="BC0470"
FT   CDS_pept        468184..468957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10942"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M3"
FT                   /protein_id="ACM10942.1"
FT   gene            469263..470807
FT                   /locus_tag="BCQ_0471"
FT                   /note="BC0471"
FT   CDS_pept        469263..470807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0471"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: R; COG: COG0488"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10943"
FT                   /db_xref="GOA:B9J2M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M4"
FT                   /protein_id="ACM10943.1"
FT   gene            complement(471264..473288)
FT                   /gene="chiA"
FT                   /locus_tag="BCQ_0472"
FT                   /note="BC0472"
FT   CDS_pept        complement(471264..473288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiA"
FT                   /locus_tag="BCQ_0472"
FT                   /product="chitinase"
FT                   /note="Code: G; COG: COG3325"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10944"
FT                   /db_xref="GOA:B9J2M5"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M5"
FT                   /protein_id="ACM10944.1"
FT   gene            473643..474014
FT                   /locus_tag="BCQ_0473"
FT                   /note="BC0473"
FT   CDS_pept        473643..474014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10945"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M6"
FT                   /protein_id="ACM10945.1"
FT   gene            474025..474339
FT                   /locus_tag="BCQ_0474"
FT                   /note="BC0474"
FT   CDS_pept        474025..474339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0474"
FT                   /product="thioredoxin"
FT                   /note="Code: OC; COG: COG0526"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10946"
FT                   /db_xref="GOA:B9J2M7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M7"
FT                   /protein_id="ACM10946.1"
FT                   "
FT   gene            474353..474598
FT                   /locus_tag="BCQ_0475"
FT                   /note="BC0475"
FT   CDS_pept        474353..474598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10947"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M8"
FT                   /protein_id="ACM10947.1"
FT   gene            474725..474868
FT                   /locus_tag="BCQ_0476"
FT                   /note="BC0476"
FT   CDS_pept        474725..474868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10948"
FT                   /db_xref="GOA:B9J2M9"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2M9"
FT                   /protein_id="ACM10948.1"
FT                   FS"
FT   gene            474949..475530
FT                   /locus_tag="BCQ_0477"
FT                   /note="BC0477"
FT   CDS_pept        474949..475530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0477"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10949"
FT                   /db_xref="GOA:B9J2N0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N0"
FT                   /protein_id="ACM10949.1"
FT   gene            475596..476828
FT                   /locus_tag="BCQ_0478"
FT                   /note="BC0478"
FT   CDS_pept        475596..476828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0478"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10950"
FT                   /db_xref="GOA:B9J2N1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N1"
FT                   /protein_id="ACM10950.1"
FT                   KEELTNSLASQ"
FT   gene            476885..477136
FT                   /locus_tag="BCQ_0479"
FT                   /note="BC0479"
FT   CDS_pept        476885..477136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0479"
FT                   /product="transcriptional regulator, PBSX family"
FT                   /note="Code: K; COG: COG1476"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10951"
FT                   /db_xref="GOA:B9J2N2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N2"
FT                   /protein_id="ACM10951.1"
FT   gene            477149..477541
FT                   /locus_tag="BCQ_0480"
FT                   /note="BC0480"
FT   CDS_pept        477149..477541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0480"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10952"
FT                   /db_xref="GOA:B9J2N3"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N3"
FT                   /protein_id="ACM10952.1"
FT   gene            complement(477578..478861)
FT                   /locus_tag="BCQ_0481"
FT                   /note="BC0481"
FT   CDS_pept        complement(477578..478861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0481"
FT                   /product="permease, major facilitator superfamily"
FT                   /note="Code: R; COG: COG2270"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10953"
FT                   /db_xref="GOA:B9J2N4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N4"
FT                   /protein_id="ACM10953.1"
FT   gene            complement(478970..480283)
FT                   /locus_tag="BCQ_0482"
FT                   /note="BC0482"
FT   CDS_pept        complement(478970..480283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0482"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="Code: R; COG: COG1524"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10954"
FT                   /db_xref="GOA:B9J2N5"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N5"
FT                   /protein_id="ACM10954.1"
FT   gene            480437..480730
FT                   /locus_tag="BCQ_0483"
FT                   /note="BC0483"
FT   CDS_pept        480437..480730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10955"
FT                   /db_xref="GOA:B9J2N6"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N6"
FT                   /protein_id="ACM10955.1"
FT   gene            481077..482507
FT                   /gene="proS"
FT                   /locus_tag="BCQ_0484"
FT                   /note="BC0484"
FT   CDS_pept        481077..482507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BCQ_0484"
FT                   /product="proline--tRNA ligase (prolyl-tRNA synthetase)"
FT                   /note="Code: J; COG: COG0442"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10956"
FT                   /db_xref="GOA:B9J2N7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N7"
FT                   /protein_id="ACM10956.1"
FT                   CICCGKEAKQMVYWGKAY"
FT   gene            complement(482625..483833)
FT                   /locus_tag="BCQ_0485"
FT                   /note="BC0485"
FT   CDS_pept        complement(482625..483833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0485"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10957"
FT                   /db_xref="GOA:B9J2N8"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N8"
FT                   /protein_id="ACM10957.1"
FT                   NAK"
FT   gene            484036..484914
FT                   /locus_tag="BCQ_0486"
FT                   /note="BC0486"
FT   CDS_pept        484036..484914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0486"
FT                   /product="ROK family protein"
FT                   /note="Code: KG; COG: COG1940"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10958"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2N9"
FT                   /protein_id="ACM10958.1"
FT                   GSIYHFLHHHK"
FT   gene            485043..485639
FT                   /gene="terD"
FT                   /locus_tag="BCQ_0487"
FT                   /note="BC0487"
FT   CDS_pept        485043..485639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="BCQ_0487"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /note="Code: T; COG: COG2310"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10959"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P0"
FT                   /protein_id="ACM10959.1"
FT   gene            485663..486247
FT                   /gene="terD"
FT                   /locus_tag="BCQ_0488"
FT                   /note="BC0488"
FT   CDS_pept        485663..486247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="BCQ_0488"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /note="Code: T; COG: COG2310"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10960"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P1"
FT                   /protein_id="ACM10960.1"
FT   gene            486327..486905
FT                   /locus_tag="BCQ_0489"
FT                   /note="BC0489"
FT   CDS_pept        486327..486905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0489"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /note="Code: T; COG: COG2310"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10961"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P2"
FT                   /protein_id="ACM10961.1"
FT   gene            486978..487769
FT                   /locus_tag="BCQ_0490"
FT                   /note="BC0490"
FT   CDS_pept        486978..487769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0490"
FT                   /product="probable integral membrane protein, TerC family"
FT                   /note="Code: P; COG: COG0861"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10962"
FT                   /db_xref="GOA:B9J2P3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P3"
FT                   /protein_id="ACM10962.1"
FT   gene            487877..489508
FT                   /locus_tag="BCQ_0491"
FT                   /note="BC0491"
FT   CDS_pept        487877..489508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10963"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P4"
FT                   /protein_id="ACM10963.1"
FT   gene            489527..490609
FT                   /locus_tag="BCQ_0492"
FT                   /note="BC0492"
FT   CDS_pept        489527..490609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0492"
FT                   /product="probable tellurite resistance protein"
FT                   /note="Code: P; COG: COG3853"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10964"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P5"
FT                   /protein_id="ACM10964.1"
FT   gene            complement(490736..493402)
FT                   /gene="pacL"
FT                   /locus_tag="BCQ_0493"
FT                   /note="BC0493"
FT   CDS_pept        complement(490736..493402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="BCQ_0493"
FT                   /product="cation-transporting ATPase A, P type (ATPase,
FT                   E1-E2 type)"
FT                   /note="Code: P; COG: COG0474"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10965"
FT                   /db_xref="GOA:B9J2P6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P6"
FT                   /protein_id="ACM10965.1"
FT                   SIIPLVVNEIIKLVKKN"
FT   gene            complement(493593..493817)
FT                   /locus_tag="BCQ_0494"
FT                   /note="BC0494"
FT   CDS_pept        complement(493593..493817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0494"
FT                   /product="YfkK"
FT                   /note="Code: S; COG: COG4840"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10966"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2P7"
FT                   /protein_id="ACM10966.1"
FT   gene            493992..494456
FT                   /gene="ptp"
FT                   /locus_tag="BCQ_0495"
FT                   /note="BC0495"
FT   CDS_pept        493992..494456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptp"
FT                   /locus_tag="BCQ_0495"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /note="Code: T; COG: COG0394"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10967"
FT                   /db_xref="GOA:B9J2P8"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P8"
FT                   /protein_id="ACM10967.1"
FT   gene            494576..495025
FT                   /locus_tag="BCQ_0496"
FT                   /note="BC0496"
FT   CDS_pept        494576..495025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0496"
FT                   /product="mature parasite-infected erythrocyte surface
FT                   antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10968"
FT                   /db_xref="InterPro:IPR025276"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2P9"
FT                   /protein_id="ACM10968.1"
FT   gene            495032..495901
FT                   /gene="rbn"
FT                   /locus_tag="BCQ_0497"
FT                   /note="BC0497"
FT   CDS_pept        495032..495901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="BCQ_0497"
FT                   /product="probable ribonuclease BN"
FT                   /note="Code: S; COG: COG1295"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10969"
FT                   /db_xref="GOA:B9J2Q0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q0"
FT                   /protein_id="ACM10969.1"
FT                   DNNSRNEK"
FT   gene            complement(496086..498011)
FT                   /locus_tag="BCQ_0498"
FT                   /note="BC0498"
FT   CDS_pept        complement(496086..498011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0498"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="Code: P; COG: COG2217"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10970"
FT                   /db_xref="GOA:B9J2Q1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q1"
FT                   /protein_id="ACM10970.1"
FT                   LLKGNN"
FT   gene            498283..499233
FT                   /locus_tag="BCQ_0499"
FT                   /note="BC0499"
FT   CDS_pept        498283..499233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0499"
FT                   /product="transporter, EamA family"
FT                   /note="Code: GER; COG: COG0697"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10971"
FT                   /db_xref="GOA:B9J2Q2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q2"
FT                   /protein_id="ACM10971.1"
FT   gene            499356..500036
FT                   /locus_tag="BCQ_0500"
FT                   /note="BC0500"
FT   CDS_pept        499356..500036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10972"
FT                   /db_xref="GOA:B9J2Q3"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q3"
FT                   /protein_id="ACM10972.1"
FT                   YVGI"
FT   gene            complement(500090..500374)
FT                   /locus_tag="BCQ_0501"
FT                   /note="BC0501"
FT   CDS_pept        complement(500090..500374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10973"
FT                   /db_xref="GOA:B9J2Q4"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q4"
FT                   /protein_id="ACM10973.1"
FT   gene            500678..501097
FT                   /gene="sipS"
FT                   /locus_tag="BCQ_0502"
FT                   /note="BC0502"
FT   CDS_pept        500678..501097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipS"
FT                   /locus_tag="BCQ_0502"
FT                   /product="signal peptidase I"
FT                   /note="Code: U; COG: COG0681"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10974"
FT                   /db_xref="GOA:B9J2Q5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q5"
FT                   /protein_id="ACM10974.1"
FT   gene            complement(501140..503902)
FT                   /locus_tag="BCQ_0503"
FT                   /note="BC0503"
FT   CDS_pept        complement(501140..503902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0503"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10975"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q6"
FT                   /protein_id="ACM10975.1"
FT   gene            504365..504961
FT                   /locus_tag="BCQ_0504"
FT                   /note="BC0504"
FT   CDS_pept        504365..504961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0504"
FT                   /product="dedA family protein"
FT                   /note="Code: S; COG: COG0586"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10976"
FT                   /db_xref="GOA:B9J2Q7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q7"
FT                   /protein_id="ACM10976.1"
FT   gene            complement(504969..505397)
FT                   /locus_tag="BCQ_0505"
FT                   /note="BC0505"
FT   CDS_pept        complement(504969..505397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0505"
FT                   /product="permease, drug/metabolite transporter
FT                   superfamily"
FT                   /note="Code: S; COG: COG2510"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10977"
FT                   /db_xref="GOA:B9J2Q8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q8"
FT                   /protein_id="ACM10977.1"
FT   gene            complement(505543..505689)
FT                   /locus_tag="BCQ_0506"
FT                   /note="BC0506"
FT   CDS_pept        complement(505543..505689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10978"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2Q9"
FT                   /protein_id="ACM10978.1"
FT                   IAE"
FT   gene            complement(505845..506261)
FT                   /locus_tag="BCQ_0507"
FT                   /note="BC0507"
FT   CDS_pept        complement(505845..506261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0507"
FT                   /product="general stress protein 26"
FT                   /note="Code: R; COG: COG3871"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10979"
FT                   /db_xref="GOA:B9J2R0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R0"
FT                   /protein_id="ACM10979.1"
FT   gene            506432..507496
FT                   /gene="cax"
FT                   /locus_tag="BCQ_0508"
FT                   /note="BC0508"
FT   CDS_pept        506432..507496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="BCQ_0508"
FT                   /product="calcium/proton exchanger"
FT                   /note="Code: P; COG: COG0387"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10980"
FT                   /db_xref="GOA:B9J2R1"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R1"
FT                   /protein_id="ACM10980.1"
FT                   LAAYVIMGIGFYLL"
FT   gene            507611..508375
FT                   /locus_tag="BCQ_0509"
FT                   /note="BC0509"
FT   CDS_pept        507611..508375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0509"
FT                   /product="YfkD"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10981"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R2"
FT                   /protein_id="ACM10981.1"
FT   gene            complement(508410..509537)
FT                   /locus_tag="BCQ_0510"
FT                   /note="BC0510"
FT   CDS_pept        complement(508410..509537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0510"
FT                   /product="thioredoxin-like oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10982"
FT                   /db_xref="GOA:B9J2R3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R3"
FT                   /protein_id="ACM10982.1"
FT   gene            509751..509933
FT                   /locus_tag="BCQ_0511"
FT                   /note="BC0511"
FT   CDS_pept        509751..509933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10983"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R4"
FT                   /protein_id="ACM10983.1"
FT                   LDELELKCEQFKKDE"
FT   gene            510140..511660
FT                   /gene="fumA"
FT                   /locus_tag="BCQ_0512"
FT                   /note="BC0512"
FT   CDS_pept        510140..511660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BCQ_0512"
FT                   /product="fumarate hydratase, class I"
FT                   /note="Code: C; COG: COG1951"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10984"
FT                   /db_xref="GOA:B9J2R5"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R5"
FT                   /protein_id="ACM10984.1"
FT   gene            511788..512570
FT                   /locus_tag="BCQ_0513"
FT                   /note="BC0513"
FT   CDS_pept        511788..512570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0513"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /note="Code: G; COG: COG0726"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10985"
FT                   /db_xref="GOA:B9J2R6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R6"
FT                   /protein_id="ACM10985.1"
FT   gene            512630..513493
FT                   /gene="alkA"
FT                   /locus_tag="BCQ_0514"
FT                   /note="BC0514"
FT   CDS_pept        512630..513493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BCQ_0514"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /note="Code: L; COG: COG0122"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10986"
FT                   /db_xref="GOA:B9J2R7"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R7"
FT                   /protein_id="ACM10986.1"
FT                   LWKSIE"
FT   gene            513504..514883
FT                   /gene="trmA"
FT                   /locus_tag="BCQ_0515"
FT                   /note="BC0515"
FT   CDS_pept        513504..514883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="BCQ_0515"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="Code: J; COG: COG2265"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10987"
FT                   /db_xref="GOA:B9J2R8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R8"
FT                   /protein_id="ACM10987.1"
FT                   K"
FT   gene            514940..515677
FT                   /gene="truA"
FT                   /locus_tag="BCQ_0516"
FT                   /note="BC0516"
FT   CDS_pept        514940..515677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BCQ_0516"
FT                   /product="tRNA-pseudouridylate synthase I (tRNA
FT                   pseudouridine synthase A)"
FT                   /note="Code: J; COG: COG0101"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10988"
FT                   /db_xref="GOA:B9J2R9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2R9"
FT                   /protein_id="ACM10988.1"
FT   gene            515818..516672
FT                   /locus_tag="BCQ_0517"
FT                   /note="BC0517"
FT   CDS_pept        515818..516672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10989"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S0"
FT                   /protein_id="ACM10989.1"
FT                   GAV"
FT   gene            516675..517439
FT                   /locus_tag="BCQ_0518"
FT                   /note="BC0518"
FT   CDS_pept        516675..517439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10990"
FT                   /db_xref="GOA:B9J2S1"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S1"
FT                   /protein_id="ACM10990.1"
FT   gene            complement(517499..517696)
FT                   /locus_tag="BCQ_0519"
FT                   /note="BC0519"
FT   CDS_pept        complement(517499..517696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10991"
FT                   /db_xref="GOA:B9J2S2"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S2"
FT                   /protein_id="ACM10991.1"
FT   gene            complement(517776..519179)
FT                   /gene="rocR"
FT                   /locus_tag="BCQ_0520"
FT                   /note="BC0520"
FT   CDS_pept        complement(517776..519179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR"
FT                   /locus_tag="BCQ_0520"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /note="Code: KT; COG: COG3829"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10992"
FT                   /db_xref="GOA:B9J2S3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S3"
FT                   /protein_id="ACM10992.1"
FT                   RIKKLHLHI"
FT   gene            519454..519708
FT                   /locus_tag="BCQ_0521"
FT                   /note="BC0521"
FT   CDS_pept        519454..519708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0521"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10993"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S4"
FT                   /protein_id="ACM10993.1"
FT   gene            519813..521234
FT                   /gene="rocE"
FT                   /locus_tag="BCQ_0522"
FT                   /note="BC0522"
FT   CDS_pept        519813..521234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocE"
FT                   /locus_tag="BCQ_0522"
FT                   /product="amino acid permease"
FT                   /note="Code: E; COG: COG0833"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10994"
FT                   /db_xref="GOA:B9J2S5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S5"
FT                   /protein_id="ACM10994.1"
FT                   VEHIEKTDTTEVESL"
FT   gene            521330..522610
FT                   /locus_tag="BCQ_0523"
FT                   /note="BC0523"
FT   CDS_pept        521330..522610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0523"
FT                   /product="acetylornitine deacetylase, putative"
FT                   /note="Code: E; COG: COG0624"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10995"
FT                   /db_xref="GOA:B9J2S6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S6"
FT                   /protein_id="ACM10995.1"
FT   gene            complement(522705..523358)
FT                   /locus_tag="BCQ_0524"
FT                   /note="BC0524"
FT   CDS_pept        complement(522705..523358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0524"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10996"
FT                   /db_xref="GOA:B9J2S7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S7"
FT                   /protein_id="ACM10996.1"
FT   gene            523488..524099
FT                   /locus_tag="BCQ_0525"
FT                   /note="BC0525"
FT   CDS_pept        523488..524099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0525"
FT                   /product="probable integral membrane protein"
FT                   /note="Code: S; COG: COG1971"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10997"
FT                   /db_xref="GOA:B9J2S8"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S8"
FT                   /protein_id="ACM10997.1"
FT   gene            524214..524372
FT                   /locus_tag="BCQ_0526"
FT                   /note="BC0526"
FT   CDS_pept        524214..524372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10998"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2S9"
FT                   /protein_id="ACM10998.1"
FT                   KNSLKKH"
FT   gene            complement(524396..524737)
FT                   /locus_tag="BCQ_0527"
FT                   /note="BC0527"
FT   CDS_pept        complement(524396..524737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM10999"
FT                   /db_xref="InterPro:IPR025083"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T0"
FT                   /protein_id="ACM10999.1"
FT                   SEQLIEDIR"
FT   gene            complement(524913..525842)
FT                   /gene="glsA"
FT                   /locus_tag="BCQ_0528"
FT                   /note="BC0528"
FT   CDS_pept        complement(524913..525842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BCQ_0528"
FT                   /product="glutaminase"
FT                   /note="Code: E; COG: COG2066"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11000"
FT                   /db_xref="GOA:B9J2T1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T1"
FT                   /protein_id="ACM11000.1"
FT   gene            526167..527660
FT                   /gene="nagE"
FT                   /locus_tag="BCQ_0529"
FT                   /note="BC0529"
FT   CDS_pept        526167..527660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="BCQ_0529"
FT                   /product="PTS system, N-acetylglucosamine-specific EIIBC
FT                   component"
FT                   /note="Code: G; COG: COG1263"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11001"
FT                   /db_xref="GOA:B9J2T2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T2"
FT                   /protein_id="ACM11001.1"
FT   gene            527914..529155
FT                   /gene="pbpX"
FT                   /locus_tag="BCQ_0530"
FT                   /note="BC0530"
FT   CDS_pept        527914..529155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="BCQ_0530"
FT                   /product="beta-lactamase (penicillin-binding protein)
FT                   (penicillinase)"
FT                   /note="Code: V; COG: COG1680"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11002"
FT                   /db_xref="GOA:B9J2T3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T3"
FT                   /protein_id="ACM11002.1"
FT                   VNNDIYTMLRNIEV"
FT   gene            529313..529714
FT                   /locus_tag="BCQ_0531"
FT                   /note="BC0531"
FT   CDS_pept        529313..529714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11003"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T4"
FT                   /protein_id="ACM11003.1"
FT   gene            529731..529925
FT                   /locus_tag="BCQ_0532"
FT                   /note="BC0532"
FT   CDS_pept        529731..529925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11004"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T5"
FT                   /protein_id="ACM11004.1"
FT   gene            530014..531486
FT                   /locus_tag="BCQ_0533"
FT                   /note="BC0533"
FT   CDS_pept        530014..531486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0533"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11005"
FT                   /db_xref="GOA:B9J2T6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T6"
FT                   /protein_id="ACM11005.1"
FT   gene            531476..532720
FT                   /locus_tag="BCQ_0534"
FT                   /note="BC0534"
FT   CDS_pept        531476..532720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0534"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /note="Code: M; COG: COG0677"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11006"
FT                   /db_xref="GOA:B9J2T7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T7"
FT                   /protein_id="ACM11006.1"
FT                   KQVVDTRGIIKKVSV"
FT   gene            532717..533682
FT                   /gene="galE"
FT                   /locus_tag="BCQ_0535"
FT                   /note="BC0535"
FT   CDS_pept        532717..533682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="BCQ_0535"
FT                   /product="UDP-glucose 4-epimerase (NAD-dependent
FT                   epimerase)"
FT                   /note="Code: MG; COG: COG0451"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11007"
FT                   /db_xref="GOA:B9J2T8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T8"
FT                   /protein_id="ACM11007.1"
FT   gene            533663..535219
FT                   /locus_tag="BCQ_0536"
FT                   /note="BC0536"
FT   CDS_pept        533663..535219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0536"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11008"
FT                   /db_xref="GOA:B9J2T9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2T9"
FT                   /protein_id="ACM11008.1"
FT                   L"
FT   gene            535559..537808
FT                   /gene="pflB"
FT                   /locus_tag="BCQ_0537"
FT                   /note="BC0537"
FT   CDS_pept        535559..537808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="BCQ_0537"
FT                   /product="formate C-acetyltransferase (formate
FT                   acetyltransferase) (pyruvate formate-lyase)"
FT                   /note="Code: C; COG: COG1882"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11009"
FT                   /db_xref="GOA:B9J2U0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U0"
FT                   /protein_id="ACM11009.1"
FT   gene            537878..538609
FT                   /gene="pflA"
FT                   /locus_tag="BCQ_0538"
FT                   /note="BC0538"
FT   CDS_pept        537878..538609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BCQ_0538"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /note="Code: O; COG: COG1180"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11010"
FT                   /db_xref="GOA:B9J2U1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U1"
FT                   /protein_id="ACM11010.1"
FT   gene            539022..540188
FT                   /gene="ugtP"
FT                   /locus_tag="BCQ_0539"
FT                   /note="BC0539"
FT   CDS_pept        539022..540188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugtP"
FT                   /locus_tag="BCQ_0539"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase
FT                   (UDP-glucose-diacylglycerol glucosyltransferase)"
FT                   /note="Code: M; COG: COG0707"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11011"
FT                   /db_xref="GOA:B9J2U2"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2U2"
FT                   /protein_id="ACM11011.1"
FT   gene            complement(540553..540672)
FT                   /locus_tag="BCQ_0540"
FT                   /note="BC0540"
FT   CDS_pept        complement(540553..540672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11012"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U3"
FT                   /protein_id="ACM11012.1"
FT   gene            complement(540783..541340)
FT                   /locus_tag="BCQ_0541"
FT                   /note="BC0541"
FT   CDS_pept        complement(540783..541340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11013"
FT                   /db_xref="GOA:B9J2U4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U4"
FT                   /protein_id="ACM11013.1"
FT   gene            complement(541582..542589)
FT                   /locus_tag="BCQ_0542"
FT                   /note="BC0542"
FT   CDS_pept        complement(541582..542589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0542"
FT                   /product="chlorohydrolase family protein"
FT                   /note="Code: Q; COG: COG1228"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11014"
FT                   /db_xref="GOA:B9J2U5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U5"
FT                   /protein_id="ACM11014.1"
FT   gene            complement(542853..543758)
FT                   /locus_tag="BCQ_0543"
FT                   /note="BC0543"
FT   CDS_pept        complement(542853..543758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0543"
FT                   /product="cell division inhibitor-like protein"
FT                   /note="Code: R; COG: COG1090"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11015"
FT                   /db_xref="GOA:B9J2U6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U6"
FT                   /protein_id="ACM11015.1"
FT   gene            543840..544652
FT                   /gene="recX"
FT                   /locus_tag="BCQ_0544"
FT                   /note="BC0544"
FT   CDS_pept        543840..544652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="BCQ_0544"
FT                   /product="regulatory protein, RecX family"
FT                   /note="Code: R; COG: COG2137"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11016"
FT                   /db_xref="GOA:B9J2U7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2U7"
FT                   /protein_id="ACM11016.1"
FT   gene            544662..544979
FT                   /locus_tag="BCQ_0545"
FT                   /note="BC0545"
FT   CDS_pept        544662..544979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11017"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U8"
FT                   /protein_id="ACM11017.1"
FT                   K"
FT   gene            complement(545044..545196)
FT                   /locus_tag="BCQ_0546"
FT                   /note="BC0546"
FT   CDS_pept        complement(545044..545196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11018"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2U9"
FT                   /protein_id="ACM11018.1"
FT                   KKRQF"
FT   gene            complement(545234..545392)
FT                   /locus_tag="BCQ_0547"
FT                   /note="BC0547"
FT   CDS_pept        complement(545234..545392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11019"
FT                   /db_xref="GOA:B9J2V0"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2V0"
FT                   /protein_id="ACM11019.1"
FT                   AANQQEE"
FT   gene            545514..545780
FT                   /locus_tag="BCQ_0548"
FT                   /note="BC0548"
FT   CDS_pept        545514..545780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0548"
FT                   /product="YfhJ"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11020"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V1"
FT                   /protein_id="ACM11020.1"
FT   gene            complement(545805..546785)
FT                   /locus_tag="BCQ_0549"
FT                   /note="BC0549"
FT   CDS_pept        complement(545805..546785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0549"
FT                   /product="yfhP protein"
FT                   /note="Code: R; COG: COG1988"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11021"
FT                   /db_xref="GOA:B9J2V2"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V2"
FT                   /protein_id="ACM11021.1"
FT   gene            546935..548032
FT                   /gene="mutY"
FT                   /locus_tag="BCQ_0550"
FT                   /note="BC0550"
FT   CDS_pept        546935..548032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BCQ_0550"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="Code: L; COG: COG1194"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11022"
FT                   /db_xref="GOA:B9J2V3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V3"
FT                   /protein_id="ACM11022.1"
FT   gene            complement(548221..548508)
FT                   /locus_tag="BCQ_0551"
FT                   /note="BC0551"
FT   CDS_pept        complement(548221..548508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0551"
FT                   /product="YfhS"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11023"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V4"
FT                   /protein_id="ACM11023.1"
FT   gene            548571..548852
FT                   /gene="sspE"
FT                   /locus_tag="BCQ_0552"
FT                   /note="BC0552"
FT   CDS_pept        548571..548852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspE"
FT                   /locus_tag="BCQ_0552"
FT                   /product="small acid-soluble protein gamma type"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11024"
FT                   /db_xref="GOA:B9J2V5"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V5"
FT                   /protein_id="ACM11024.1"
FT   gene            548852..548980
FT                   /locus_tag="BCQ_0553"
FT                   /note="BC0553"
FT   CDS_pept        548852..548980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11025"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V6"
FT                   /protein_id="ACM11025.1"
FT   gene            549041..549301
FT                   /locus_tag="BCQ_0554"
FT                   /note="BC0554"
FT   CDS_pept        549041..549301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11026"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V7"
FT                   /protein_id="ACM11026.1"
FT   gene            549553..550083
FT                   /locus_tag="BCQ_0555"
FT                   /note="BC0555"
FT   CDS_pept        549553..550083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: J; COG: COG3557"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11027"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J2V8"
FT                   /protein_id="ACM11027.1"
FT                   VDMWYERYLMYRN"
FT   gene            550138..551898
FT                   /locus_tag="BCQ_0556"
FT                   /note="BC0556"
FT   CDS_pept        550138..551898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0556"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Code: V; COG: COG1132"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11028"
FT                   /db_xref="GOA:B9J2V9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2V9"
FT                   /protein_id="ACM11028.1"
FT                   QHITETAPLA"
FT   gene            complement(551912..553000)
FT                   /locus_tag="BCQ_0557"
FT                   /note="BC0557"
FT   CDS_pept        complement(551912..553000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0557"
FT                   /product="lipoprotein, putative"
FT                   /note="Code: S; COG: COG4129"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11029"
FT                   /db_xref="GOA:B9J2W0"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:B9J2W0"
FT                   /protein_id="ACM11029.1"
FT   gene            complement(553261..557697)
FT                   /gene="gltB"
FT                   /locus_tag="BCQ_0558"
FT                   /note="BC0558"
FT   CDS_pept        complement(553261..557697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="BCQ_0558"
FT                   /product="glutamate synthase, NADPH, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11030"
FT                   /db_xref="GOA:B9J3N1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N1"
FT                   /protein_id="ACM11030.1"
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(557896..559200)
FT                   /gene="hemL"
FT                   /locus_tag="BCQ_0559"
FT                   /note="BC0559"
FT   CDS_pept        complement(557896..559200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="BCQ_0559"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="Code: H; COG: COG0001"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11031"
FT                   /db_xref="GOA:B9J3N2"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J3N2"
FT                   /protein_id="ACM11031.1"
FT   gene            559322..560335
FT                   /locus_tag="BCQ_0560"
FT                   /note="BC0560"
FT   CDS_pept        559322..560335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0560"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Code: R; COG: COG4586"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11032"
FT                   /db_xref="GOA:B9J3N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N3"
FT                   /protein_id="ACM11032.1"
FT   gene            560328..561119
FT                   /locus_tag="BCQ_0561"
FT                   /note="BC0561"
FT   CDS_pept        560328..561119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0561"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11033"
FT                   /db_xref="GOA:B9J3N4"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N4"
FT                   /protein_id="ACM11033.1"
FT   gene            561124..561909
FT                   /locus_tag="BCQ_0562"
FT                   /note="BC0562"
FT   CDS_pept        561124..561909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0562"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="Code: R; COG: COG3694"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11034"
FT                   /db_xref="GOA:B9J3N5"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N5"
FT                   /protein_id="ACM11034.1"
FT   gene            561982..562386
FT                   /gene="lctB"
FT                   /locus_tag="BCQ_0563"
FT                   /note="BC0563"
FT   CDS_pept        561982..562386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctB"
FT                   /locus_tag="BCQ_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: P; COG: COG1226"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11035"
FT                   /db_xref="GOA:B9J3N6"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N6"
FT                   /protein_id="ACM11035.1"
FT   gene            562431..562886
FT                   /gene="bcP"
FT                   /locus_tag="BCQ_0564"
FT                   /note="BC0564"
FT   CDS_pept        562431..562886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BCQ_0564"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="Code: O; COG: COG1225"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11036"
FT                   /db_xref="GOA:B9J3N7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N7"
FT                   /protein_id="ACM11036.1"
FT   gene            563218..563613
FT                   /gene="perR"
FT                   /locus_tag="BCQ_0565"
FT                   /note="BC0565"
FT   CDS_pept        563218..563613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="BCQ_0565"
FT                   /product="ferric uptake regulator"
FT                   /note="similar to peroxide operon regulator in B.subtilis;
FT                   Code: P; COG: COG0735"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11037"
FT                   /db_xref="GOA:B9J3N8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3N8"
FT                   /protein_id="ACM11037.1"
FT   gene            complement(563810..564166)
FT                   /locus_tag="BCQ_0566"
FT                   /note="BC0566"
FT   CDS_pept        complement(563810..564166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11038"
FT                   /db_xref="GOA:B9J3N9"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J3N9"
FT                   /protein_id="ACM11038.1"
FT                   KEFDEKYNKKSYKS"
FT   gene            564583..566087
FT                   /locus_tag="BCQ_0567"
FT                   /note="BC0567"
FT   rRNA            564583..566087
FT                   /locus_tag="BCQ_0567"
FT                   /product="16S ribosomal RNA"
FT   gene            566266..569174
FT                   /locus_tag="BCQ_0568"
FT                   /note="BC0568"
FT   rRNA            566266..569174
FT                   /locus_tag="BCQ_0568"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(566290..566721)
FT                   /locus_tag="BCQ_0569"
FT                   /note="BC0569"
FT   CDS_pept        complement(566290..566721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11039"
FT                   /db_xref="UniProtKB/TrEMBL:B9IYH4"
FT                   /protein_id="ACM11039.1"
FT   gene            569272..569745
FT                   /locus_tag="BCQ_0570"
FT                   /note="BC0570"
FT   CDS_pept        569272..569745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11040"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P1"
FT                   /protein_id="ACM11040.1"
FT   gene            569277..569387
FT                   /locus_tag="BCQ_0571"
FT                   /note="BC0571"
FT   rRNA            569277..569387
FT                   /locus_tag="BCQ_0571"
FT                   /product="5S ribosomal RNA"
FT   gene            569399..569473
FT                   /locus_tag="BCQ_0572"
FT                   /note="BC0572"
FT   tRNA            569399..569473
FT                   /locus_tag="BCQ_0572"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            569476..569567
FT                   /locus_tag="BCQ_0573"
FT                   /note="BC0573"
FT   tRNA            569476..569567
FT                   /locus_tag="BCQ_0573"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            569585..569659
FT                   /locus_tag="BCQ_0574"
FT                   /note="BC0574"
FT   tRNA            569585..569659
FT                   /locus_tag="BCQ_0574"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            569665..569740
FT                   /locus_tag="BCQ_0575"
FT                   /note="BC0575"
FT   tRNA            569665..569740
FT                   /locus_tag="BCQ_0575"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            569765..569841
FT                   /locus_tag="BCQ_0576"
FT                   /note="BC0576"
FT   tRNA            569765..569841
FT                   /locus_tag="BCQ_0576"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            569845..569920
FT                   /locus_tag="BCQ_0577"
FT                   /note="BC0577"
FT   tRNA            569845..569920
FT                   /locus_tag="BCQ_0577"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            569930..570005
FT                   /locus_tag="BCQ_0578"
FT                   /note="BC0578"
FT   tRNA            569930..570005
FT                   /locus_tag="BCQ_0578"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            570024..570099
FT                   /locus_tag="BCQ_0579"
FT                   /note="BC0579"
FT   tRNA            570024..570099
FT                   /locus_tag="BCQ_0579"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            570110..570193
FT                   /locus_tag="BCQ_0580"
FT                   /note="BC0580"
FT   tRNA            570110..570193
FT                   /locus_tag="BCQ_0580"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            570201..570274
FT                   /locus_tag="BCQ_0581"
FT                   /note="BC0581"
FT   tRNA            570201..570274
FT                   /locus_tag="BCQ_0581"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            570294..570369
FT                   /locus_tag="BCQ_0582"
FT                   /note="BC0582"
FT   tRNA            570294..570369
FT                   /locus_tag="BCQ_0582"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   gene            570433..570507
FT                   /locus_tag="BCQ_0583"
FT                   /note="BC0583"
FT   tRNA            570433..570507
FT                   /locus_tag="BCQ_0583"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            570513..570587
FT                   /locus_tag="BCQ_0584"
FT                   /note="BC0584"
FT   tRNA            570513..570587
FT                   /locus_tag="BCQ_0584"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            570602..570672
FT                   /locus_tag="BCQ_0585"
FT                   /note="BC0585"
FT   tRNA            570602..570672
FT                   /locus_tag="BCQ_0585"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            570683..570764
FT                   /locus_tag="BCQ_0586"
FT                   /note="BC0586"
FT   tRNA            570683..570764
FT                   /locus_tag="BCQ_0586"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   gene            570944..571936
FT                   /gene="codV"
FT                   /locus_tag="BCQ_0587"
FT                   /note="BC0587"
FT   CDS_pept        570944..571936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codV"
FT                   /locus_tag="BCQ_0587"
FT                   /product="site-specific integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11041"
FT                   /db_xref="GOA:B9J3P2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P2"
FT                   /protein_id="ACM11041.1"
FT   gene            complement(572005..572109)
FT                   /locus_tag="BCQ_0588"
FT                   /note="BC0588"
FT   CDS_pept        complement(572005..572109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11042"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P3"
FT                   /protein_id="ACM11042.1"
FT   gene            574172..574459
FT                   /locus_tag="BCQ_0589"
FT                   /note="BC0589"
FT   CDS_pept        574172..574459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11043"
FT                   /db_xref="GOA:B9J3P4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P4"
FT                   /protein_id="ACM11043.1"
FT   gene            574456..574683
FT                   /locus_tag="BCQ_0590"
FT                   /note="BC0590"
FT   CDS_pept        574456..574683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11044"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P5"
FT                   /protein_id="ACM11044.1"
FT   gene            574673..575359
FT                   /locus_tag="BCQ_0591"
FT                   /note="BC0591"
FT   CDS_pept        574673..575359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0591"
FT                   /product="metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11045"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P6"
FT                   /protein_id="ACM11045.1"
FT                   KEGSNV"
FT   gene            575359..575502
FT                   /locus_tag="BCQ_0592"
FT                   /note="BC0592"
FT   CDS_pept        575359..575502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11046"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P7"
FT                   /protein_id="ACM11046.1"
FT                   TN"
FT   gene            575634..575921
FT                   /locus_tag="BCQ_0593"
FT                   /note="BC0593"
FT   CDS_pept        575634..575921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11047"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P8"
FT                   /protein_id="ACM11047.1"
FT   gene            575936..576781
FT                   /locus_tag="BCQ_0594"
FT                   /note="BC0594"
FT   CDS_pept        575936..576781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11048"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3P9"
FT                   /protein_id="ACM11048.1"
FT                   "
FT   gene            577168..577518
FT                   /locus_tag="BCQ_0595"
FT                   /note="BC0595"
FT   CDS_pept        577168..577518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11049"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q0"
FT                   /protein_id="ACM11049.1"
FT                   KIKLRKEMSPTG"
FT   gene            complement(577789..578379)
FT                   /gene="tnpR"
FT                   /locus_tag="BCQ_0596"
FT                   /note="BC0596"
FT   CDS_pept        complement(577789..578379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="BCQ_0596"
FT                   /product="probable resolvase"
FT                   /note="Code: L; COG: COG1961"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11050"
FT                   /db_xref="GOA:B9J3Q1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q1"
FT                   /protein_id="ACM11050.1"
FT   gene            580071..580247
FT                   /locus_tag="BCQ_0597"
FT                   /note="BC0597"
FT   CDS_pept        580071..580247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0597"
FT                   /product="Antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11051"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q2"
FT                   /protein_id="ACM11051.1"
FT                   HNENKSSPLENIV"
FT   gene            580286..580621
FT                   /locus_tag="BCQ_0598"
FT                   /note="BC0598"
FT   CDS_pept        580286..580621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11052"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q3"
FT                   /protein_id="ACM11052.1"
FT                   YYYAEIL"
FT   gene            580653..580898
FT                   /locus_tag="BCQ_0599"
FT                   /note="BC0599"
FT   CDS_pept        580653..580898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11053"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q4"
FT                   /protein_id="ACM11053.1"
FT   gene            complement(581252..581509)
FT                   /gene="phrA"
FT                   /locus_tag="BCQ_0600"
FT                   /note="BC0600"
FT   CDS_pept        complement(581252..581509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrA"
FT                   /locus_tag="BCQ_0600"
FT                   /product="probable phosphatase rapA inhibitor (phosphatase
FT                   regulator A)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11054"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q5"
FT                   /protein_id="ACM11054.1"
FT   gene            complement(581509..582603)
FT                   /gene="rapA"
FT                   /locus_tag="BCQ_0601"
FT                   /note="BC0601"
FT   CDS_pept        complement(581509..582603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="BCQ_0601"
FT                   /product="possible response regulator aspartate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11055"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q6"
FT                   /protein_id="ACM11055.1"
FT   gene            582825..583997
FT                   /locus_tag="BCQ_0602"
FT                   /note="BC0602"
FT   CDS_pept        582825..583997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11056"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q7"
FT                   /protein_id="ACM11056.1"
FT   gene            584015..584455
FT                   /locus_tag="BCQ_0603"
FT                   /note="BC0603"
FT   CDS_pept        584015..584455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11057"
FT                   /db_xref="InterPro:IPR028185"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q8"
FT                   /protein_id="ACM11057.1"
FT   gene            584794..585042
FT                   /locus_tag="BCQ_0604"
FT                   /note="BC0604"
FT   CDS_pept        584794..585042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11058"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Q9"
FT                   /protein_id="ACM11058.1"
FT   gene            585611..586330
FT                   /locus_tag="BCQ_0605"
FT                   /note="BC0605"
FT   CDS_pept        585611..586330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG0217"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11059"
FT                   /db_xref="GOA:B9J3R0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J3R0"
FT                   /protein_id="ACM11059.1"
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            586403..586912
FT                   /gene="mutT"
FT                   /locus_tag="BCQ_0606"
FT                   /note="BC0606"
FT   CDS_pept        586403..586912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BCQ_0606"
FT                   /product="mutT/nudix family protein"
FT                   /note="Code: LR; COG: COG0494"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11060"
FT                   /db_xref="GOA:B9J3R1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R1"
FT                   /protein_id="ACM11060.1"
FT                   NLIGRL"
FT   gene            587400..588176
FT                   /locus_tag="BCQ_0607"
FT                   /note="BC0607"
FT   CDS_pept        587400..588176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0607"
FT                   /product="penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11061"
FT                   /db_xref="GOA:B9J3R2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R2"
FT                   /protein_id="ACM11061.1"
FT   gene            588364..589014
FT                   /gene="bdbD"
FT                   /locus_tag="BCQ_0608"
FT                   /note="BC0608"
FT   CDS_pept        588364..589014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdbD"
FT                   /locus_tag="BCQ_0608"
FT                   /product="probable thiol-disulfide oxidoreductase
FT                   (disulfide bond formation protein D)
FT                   (disulfideoxidoreductase D)"
FT                   /note="Code: O; COG: COG1651"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11062"
FT                   /db_xref="GOA:B9J3R3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R3"
FT                   /protein_id="ACM11062.1"
FT   gene            589129..589202
FT                   /locus_tag="BCQ_0609"
FT                   /note="BC0609"
FT   tRNA            589129..589202
FT                   /locus_tag="BCQ_0609"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            589504..591051
FT                   /locus_tag="BCQ_0610"
FT                   /note="BC0610"
FT   CDS_pept        589504..591051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0610"
FT                   /product="transposase, IS605 family, OrfA and OrfB fusion"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11063"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R4"
FT                   /protein_id="ACM11063.1"
FT   gene            591301..592443
FT                   /locus_tag="BCQ_0611"
FT                   /note="BC0611"
FT   CDS_pept        591301..592443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0611"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /note="Code: C; COG: COG1600"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11064"
FT                   /db_xref="GOA:B9J3R5"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R5"
FT                   /protein_id="ACM11064.1"
FT   gene            592488..593375
FT                   /locus_tag="BCQ_0612"
FT                   /note="BC0612"
FT   CDS_pept        592488..593375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11065"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R6"
FT                   /protein_id="ACM11065.1"
FT                   TPQMKYKFFHIING"
FT   gene            593434..593922
FT                   /gene="cspR"
FT                   /locus_tag="BCQ_0613"
FT                   /note="BC0613"
FT   CDS_pept        593434..593922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="BCQ_0613"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="Code: J; COG: COG0219"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11066"
FT                   /db_xref="GOA:B9J3R7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R7"
FT                   /protein_id="ACM11066.1"
FT   gene            594050..596119
FT                   /locus_tag="BCQ_0614"
FT                   /note="BC0614"
FT   CDS_pept        594050..596119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0614"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11067"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R8"
FT                   /protein_id="ACM11067.1"
FT   gene            complement(596152..596247)
FT                   /locus_tag="BCQ_0615"
FT                   /note="BC0615"
FT   CDS_pept        complement(596152..596247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11068"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3R9"
FT                   /protein_id="ACM11068.1"
FT                   /translation="MKLLLILGVSLTFLTAIFTSGYNDKPGTHKK"
FT   gene            596513..598408
FT                   /gene="prkA"
FT                   /locus_tag="BCQ_0616"
FT                   /note="BC0616"
FT   CDS_pept        596513..598408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="BCQ_0616"
FT                   /product="probable serine protein kinase"
FT                   /note="Code: T; COG: COG2766"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11069"
FT                   /db_xref="GOA:B9J3S0"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S0"
FT                   /protein_id="ACM11069.1"
FT   gene            598856..600031
FT                   /locus_tag="BCQ_0617"
FT                   /note="BC0617"
FT   CDS_pept        598856..600031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0617"
FT                   /product="Glycosyltransferase"
FT                   /note="Code: S; COG: COG2718"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11070"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9J3S1"
FT                   /protein_id="ACM11070.1"
FT   gene            600192..603224
FT                   /locus_tag="BCQ_0618"
FT                   /note="BC0618"
FT   CDS_pept        600192..603224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0618"
FT                   /product="possible internalin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11071"
FT                   /db_xref="GOA:B9J3S2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S2"
FT                   /protein_id="ACM11071.1"
FT   gene            complement(603620..605170)
FT                   /gene="opuD"
FT                   /locus_tag="BCQ_0619"
FT                   /note="BC0619"
FT   CDS_pept        complement(603620..605170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD"
FT                   /locus_tag="BCQ_0619"
FT                   /product="glycine betaine transporter"
FT                   /note="Code: M; COG: COG1292"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11072"
FT                   /db_xref="GOA:B9J3S3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S3"
FT                   /protein_id="ACM11072.1"
FT   gene            605439..608336
FT                   /gene="colA"
FT                   /locus_tag="BCQ_0620"
FT                   /note="BC0620"
FT   CDS_pept        605439..608336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="colA"
FT                   /locus_tag="BCQ_0620"
FT                   /product="microbial collagenase metalloprotease, peptidase
FT                   M9A family"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11073"
FT                   /db_xref="GOA:B9J3S4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S4"
FT                   /protein_id="ACM11073.1"
FT   gene            608584..609132
FT                   /locus_tag="BCQ_0621"
FT                   /note="BC0621"
FT   CDS_pept        608584..609132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11074"
FT                   /db_xref="GOA:B9J3S5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S5"
FT                   /protein_id="ACM11074.1"
FT   gene            609145..610719
FT                   /locus_tag="BCQ_0622"
FT                   /note="BC0622"
FT   CDS_pept        609145..610719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0622"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="Code: S; COG: COG2268"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11075"
FT                   /db_xref="GOA:B9J3S6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S6"
FT                   /protein_id="ACM11075.1"
FT                   EVEKDKE"
FT   gene            610956..612932
FT                   /gene="cheW"
FT                   /locus_tag="BCQ_0623"
FT                   /note="BC0623"
FT   CDS_pept        610956..612932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BCQ_0623"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11076"
FT                   /db_xref="GOA:B9J3S7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S7"
FT                   /protein_id="ACM11076.1"
FT   gene            613083..614693
FT                   /gene="citS"
FT                   /locus_tag="BCQ_0624"
FT                   /note="BC0624"
FT   CDS_pept        613083..614693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citS"
FT                   /locus_tag="BCQ_0624"
FT                   /product="sensor histidine kinase"
FT                   /note="Code: T; COG: COG3290"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11077"
FT                   /db_xref="GOA:B9J3S8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S8"
FT                   /protein_id="ACM11077.1"
FT   gene            614693..615385
FT                   /gene="citT"
FT                   /locus_tag="BCQ_0625"
FT                   /note="BC0625"
FT   CDS_pept        614693..615385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="BCQ_0625"
FT                   /product="response regulator"
FT                   /note="Code: KT; COG: COG4565"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11078"
FT                   /db_xref="GOA:B9J3S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3S9"
FT                   /protein_id="ACM11078.1"
FT                   RRYFLIPS"
FT   gene            complement(615429..616733)
FT                   /gene="citN"
FT                   /locus_tag="BCQ_0626"
FT                   /note="BC0626"
FT   CDS_pept        complement(615429..616733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citN"
FT                   /locus_tag="BCQ_0626"
FT                   /product="citrate transporter, citM family"
FT                   /note="Code: C; COG: COG2851"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11079"
FT                   /db_xref="GOA:B9J3T0"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T0"
FT                   /protein_id="ACM11079.1"
FT   gene            616986..617240
FT                   /locus_tag="BCQ_0627"
FT                   /note="BC0627"
FT   CDS_pept        616986..617240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0627"
FT                   /product="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11080"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T1"
FT                   /protein_id="ACM11080.1"
FT   gene            617372..617875
FT                   /locus_tag="BCQ_0628"
FT                   /note="BC0628"
FT   CDS_pept        617372..617875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11081"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T2"
FT                   /protein_id="ACM11081.1"
FT                   GGHH"
FT   gene            618267..619037
FT                   /locus_tag="BCQ_0629"
FT                   /note="BC0629"
FT   CDS_pept        618267..619037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0629"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Code: R; COG: COG0666"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11082"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T3"
FT                   /protein_id="ACM11082.1"
FT   gene            619257..619865
FT                   /locus_tag="BCQ_0630"
FT                   /note="BC0630"
FT   CDS_pept        619257..619865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11083"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T4"
FT                   /protein_id="ACM11083.1"
FT   gene            620173..620739
FT                   /gene="glpP"
FT                   /locus_tag="BCQ_0631"
FT                   /note="BC0631"
FT   CDS_pept        620173..620739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpP"
FT                   /locus_tag="BCQ_0631"
FT                   /product="glycerol-3-phosphate responsive antiterminator
FT                   (G3P_antiterm)"
FT                   /note="Code: K; COG: COG1954"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11084"
FT                   /db_xref="GOA:B9J3T5"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T5"
FT                   /protein_id="ACM11084.1"
FT   gene            620703..621833
FT                   /locus_tag="BCQ_0632"
FT                   /note="BC0632"
FT   CDS_pept        620703..621833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0632"
FT                   /product="glycerol-3-phosphate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /note="Code: G; COG: COG3839"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11085"
FT                   /db_xref="GOA:B9J3T6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T6"
FT                   /protein_id="ACM11085.1"
FT   gene            621833..622765
FT                   /locus_tag="BCQ_0633"
FT                   /note="BC0633"
FT   CDS_pept        621833..622765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0633"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein, putative"
FT                   /note="Code: G; COG: COG1175"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11086"
FT                   /db_xref="GOA:B9J3T7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T7"
FT                   /protein_id="ACM11086.1"
FT   gene            622762..623583
FT                   /locus_tag="BCQ_0634"
FT                   /note="BC0634"
FT   CDS_pept        622762..623583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0634"
FT                   /product="SN-glycerol-3-phosphate transport system permease
FT                   protein ugpE"
FT                   /note="Code: G; COG: COG0395"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11087"
FT                   /db_xref="GOA:B9J3T8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T8"
FT                   /protein_id="ACM11087.1"
FT   gene            623605..624981
FT                   /locus_tag="BCQ_0635"
FT                   /note="BC0635"
FT   CDS_pept        623605..624981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0635"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="Code: G; COG: COG1653"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11088"
FT                   /db_xref="GOA:B9J3T9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3T9"
FT                   /protein_id="ACM11088.1"
FT                   "
FT   gene            625382..626086
FT                   /gene="pphA"
FT                   /locus_tag="BCQ_0636"
FT                   /note="BC0636"
FT   CDS_pept        625382..626086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /locus_tag="BCQ_0636"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="Code: T; COG: COG0639"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11089"
FT                   /db_xref="GOA:B9J3U0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U0"
FT                   /protein_id="ACM11089.1"
FT                   ELPSKKVYVIKS"
FT   gene            626299..626970
FT                   /gene="llrF"
FT                   /locus_tag="BCQ_0637"
FT                   /note="BC0637"
FT   CDS_pept        626299..626970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="llrF"
FT                   /locus_tag="BCQ_0637"
FT                   /product="probable response regulator"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11090"
FT                   /db_xref="GOA:B9J3U1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U1"
FT                   /protein_id="ACM11090.1"
FT                   Q"
FT   gene            626982..628217
FT                   /locus_tag="BCQ_0638"
FT                   /note="BC0638"
FT   CDS_pept        626982..628217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0638"
FT                   /product="sensor histidine kinase"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11091"
FT                   /db_xref="GOA:B9J3U2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U2"
FT                   /protein_id="ACM11091.1"
FT                   CFEVIFPKHQRI"
FT   gene            628458..629261
FT                   /locus_tag="BCQ_0639"
FT                   /note="BC0639"
FT   CDS_pept        628458..629261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11092"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U3"
FT                   /protein_id="ACM11092.1"
FT   gene            629275..630024
FT                   /locus_tag="BCQ_0640"
FT                   /note="BC0640"
FT   CDS_pept        629275..630024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG4990"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11093"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U4"
FT                   /protein_id="ACM11093.1"
FT   gene            630261..632243
FT                   /gene="mcpA"
FT                   /locus_tag="BCQ_0641"
FT                   /note="BC0641"
FT   CDS_pept        630261..632243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA"
FT                   /locus_tag="BCQ_0641"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Code: NT; COG: COG0840"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11094"
FT                   /db_xref="GOA:B9J3U5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U5"
FT                   /protein_id="ACM11094.1"
FT   gene            632322..633923
FT                   /locus_tag="BCQ_0642"
FT                   /note="BC0642"
FT   CDS_pept        632322..633923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0642"
FT                   /product="sensory box histidine kinase"
FT                   /note="Code: T; COG: COG3290"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11095"
FT                   /db_xref="GOA:B9J3U6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U6"
FT                   /protein_id="ACM11095.1"
FT                   TTITIEIPKGRDERQI"
FT   gene            633953..634627
FT                   /locus_tag="BCQ_0643"
FT                   /note="BC0643"
FT   CDS_pept        633953..634627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0643"
FT                   /product="response regulator"
FT                   /note="Code: KT; COG: COG4565"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11096"
FT                   /db_xref="GOA:B9J3U7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U7"
FT                   /protein_id="ACM11096.1"
FT                   YV"
FT   gene            634984..636096
FT                   /gene="maeN"
FT                   /locus_tag="BCQ_0644"
FT                   /note="BC0644"
FT   CDS_pept        634984..636096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeN"
FT                   /locus_tag="BCQ_0644"
FT                   /product="Na+/malate symporter"
FT                   /note="Code: C; COG: COG3493"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11097"
FT                   /db_xref="GOA:B9J3U8"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U8"
FT                   /protein_id="ACM11097.1"
FT   gene            636156..637355
FT                   /gene="sfcA"
FT                   /locus_tag="BCQ_0645"
FT                   /note="BC0645"
FT   CDS_pept        636156..637355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfcA"
FT                   /locus_tag="BCQ_0645"
FT                   /product="malate dehydrogenase (malic enzyme) (NAD-malic
FT                   enzyme)"
FT                   /note="Code: C; COG: COG0281"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11098"
FT                   /db_xref="GOA:B9J3U9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3U9"
FT                   /protein_id="ACM11098.1"
FT                   "
FT   gene            complement(637649..638173)
FT                   /locus_tag="BCQ_0646"
FT                   /note="BC0646"
FT   CDS_pept        complement(637649..638173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0646"
FT                   /product="group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11099"
FT                   /db_xref="InterPro:IPR032366"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V0"
FT                   /protein_id="ACM11099.1"
FT                   KYYDQFVITAE"
FT   gene            complement(638289..639215)
FT                   /locus_tag="BCQ_0647"
FT                   /note="BC0647"
FT   CDS_pept        complement(638289..639215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0647"
FT                   /product="probable transporter, DMT family"
FT                   /note="Code: GER; COG: COG0697"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11100"
FT                   /db_xref="GOA:B9J3V1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V1"
FT                   /protein_id="ACM11100.1"
FT   gene            639336..640736
FT                   /locus_tag="BCQ_0648"
FT                   /note="BC0648"
FT   CDS_pept        639336..640736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0648"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Code: KE; COG: COG1167"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11101"
FT                   /db_xref="GOA:B9J3V2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V2"
FT                   /protein_id="ACM11101.1"
FT                   NTAWFRKK"
FT   gene            complement(640771..641283)
FT                   /locus_tag="BCQ_0649"
FT                   /note="BC0649"
FT   CDS_pept        complement(640771..641283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0649"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11102"
FT                   /db_xref="GOA:B9J3V3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V3"
FT                   /protein_id="ACM11102.1"
FT                   LFLDENK"
FT   gene            complement(641429..642892)
FT                   /locus_tag="BCQ_0650"
FT                   /note="BC0650"
FT   CDS_pept        complement(641429..642892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0650"
FT                   /product="sensor histidine kinase"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11103"
FT                   /db_xref="GOA:B9J3V4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V4"
FT                   /protein_id="ACM11103.1"
FT   gene            complement(642958..643629)
FT                   /gene="llrF"
FT                   /locus_tag="BCQ_0651"
FT                   /note="BC0651"
FT   CDS_pept        complement(642958..643629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="llrF"
FT                   /locus_tag="BCQ_0651"
FT                   /product="response regulator"
FT                   /note="Code: TK; COG: COG0745"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11104"
FT                   /db_xref="GOA:B9J3V5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V5"
FT                   /protein_id="ACM11104.1"
FT                   E"
FT   gene            643960..644082
FT                   /locus_tag="BCQ_0652"
FT                   /note="BC0652"
FT   CDS_pept        643960..644082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11105"
FT                   /db_xref="GOA:B9J3V6"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V6"
FT                   /protein_id="ACM11105.1"
FT   gene            complement(644438..644944)
FT                   /locus_tag="BCQ_0653"
FT                   /note="BC0653"
FT   CDS_pept        complement(644438..644944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0653"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11106"
FT                   /db_xref="GOA:B9J3V7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V7"
FT                   /protein_id="ACM11106.1"
FT                   LFLND"
FT   gene            complement(645176..645982)
FT                   /gene="fdhD"
FT                   /locus_tag="BCQ_0654"
FT                   /note="BC0654"
FT   CDS_pept        complement(645176..645982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="BCQ_0654"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="Code: C; COG: COG1526"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11107"
FT                   /db_xref="GOA:B9J3V8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V8"
FT                   /protein_id="ACM11107.1"
FT   gene            646283..649219
FT                   /gene="fdhF"
FT                   /locus_tag="BCQ_0655"
FT                   /note="BC0655"
FT   CDS_pept        646283..649219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="BCQ_0655"
FT                   /product="formate dehydrogenase, alpha subunit, anaerobic"
FT                   /note="Code: R; COG: COG3383"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11108"
FT                   /db_xref="GOA:B9J3V9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3V9"
FT                   /protein_id="ACM11108.1"
FT   gene            649232..649714
FT                   /locus_tag="BCQ_0656"
FT                   /note="BC0656"
FT   CDS_pept        649232..649714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2427"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11109"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W0"
FT                   /protein_id="ACM11109.1"
FT   gene            649906..651741
FT                   /gene="glpQ"
FT                   /locus_tag="BCQ_0657"
FT                   /note="BC0657"
FT   CDS_pept        649906..651741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="BCQ_0657"
FT                   /product="glycerophosphodiester phosphodiesterase
FT                   (glycerophosphoryl diester phosphodiesterase)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11110"
FT                   /db_xref="GOA:B9J3W1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W1"
FT                   /protein_id="ACM11110.1"
FT   gene            652110..653243
FT                   /gene="ald"
FT                   /locus_tag="BCQ_0658"
FT                   /note="BC0658"
FT   CDS_pept        652110..653243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="BCQ_0658"
FT                   /product="alanine dehydrogenase (L-alanine dehydrogenase)
FT                   (NAD-linked alanine dehydrogenase)"
FT                   /note="Code: E; COG: COG0686"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11111"
FT                   /db_xref="GOA:B9J3W2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W2"
FT                   /protein_id="ACM11111.1"
FT   gene            653443..654762
FT                   /locus_tag="BCQ_0659"
FT                   /note="BC0659"
FT   CDS_pept        653443..654762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0659"
FT                   /product="amino acid permease (amino acid transporter)"
FT                   /note="Code: E; COG: COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11112"
FT                   /db_xref="GOA:B9J3W3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W3"
FT                   /protein_id="ACM11112.1"
FT   gene            655065..655442
FT                   /gene="arsR"
FT                   /locus_tag="BCQ_0660"
FT                   /note="BC0660"
FT   CDS_pept        655065..655442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BCQ_0660"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="Code: K; COG: COG0640"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11113"
FT                   /db_xref="GOA:B9J3W4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W4"
FT                   /protein_id="ACM11113.1"
FT   gene            655466..657832
FT                   /locus_tag="BCQ_0661"
FT                   /note="BC0661"
FT   CDS_pept        655466..657832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0661"
FT                   /product="heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11114"
FT                   /db_xref="GOA:B9J3W5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W5"
FT                   /protein_id="ACM11114.1"
FT   gene            complement(658037..659500)
FT                   /gene="pncB"
FT                   /locus_tag="BCQ_0662"
FT                   /note="BC0662"
FT   CDS_pept        complement(658037..659500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BCQ_0662"
FT                   /product="nicotinate phosphoribosyltransferase (nicotinic
FT                   acid phosphoribosyltransferase)"
FT                   /note="Code: H; COG: COG1488"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11115"
FT                   /db_xref="GOA:B9J3W6"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W6"
FT                   /protein_id="ACM11115.1"
FT   gene            659701..660972
FT                   /gene="nprR"
FT                   /locus_tag="BCQ_0663"
FT                   /note="BC0663"
FT   CDS_pept        659701..660972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nprR"
FT                   /locus_tag="BCQ_0663"
FT                   /product="transcriptional activator (transcriptional
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11116"
FT                   /db_xref="GOA:B9J3W7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W7"
FT                   /protein_id="ACM11116.1"
FT   gene            660974..661099
FT                   /locus_tag="BCQ_0664"
FT                   /note="BC0664"
FT   CDS_pept        660974..661099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11117"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W8"
FT                   /protein_id="ACM11117.1"
FT   gene            661266..662966
FT                   /gene="npr"
FT                   /locus_tag="BCQ_0665"
FT                   /note="BC0665"
FT   CDS_pept        661266..662966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npr"
FT                   /locus_tag="BCQ_0665"
FT                   /product="bacillolysin (thermolysin-like metalloprotease,
FT                   peptidase M4)"
FT                   /note="Code: E; COG: COG3227"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11118"
FT                   /db_xref="GOA:B9J3W9"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3W9"
FT                   /protein_id="ACM11118.1"
FT   gene            complement(663030..663578)
FT                   /locus_tag="BCQ_0666"
FT                   /note="BC0666"
FT   CDS_pept        complement(663030..663578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0666"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11119"
FT                   /db_xref="GOA:B9J3X0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X0"
FT                   /protein_id="ACM11119.1"
FT   gene            663976..664494
FT                   /locus_tag="BCQ_0667"
FT                   /note="BC0667"
FT   CDS_pept        663976..664494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0667"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11120"
FT                   /db_xref="InterPro:IPR041436"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X1"
FT                   /protein_id="ACM11120.1"
FT                   IITSYPSDK"
FT   gene            664510..664782
FT                   /locus_tag="BCQ_0668"
FT                   /note="BC0668"
FT   CDS_pept        664510..664782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11121"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X2"
FT                   /protein_id="ACM11121.1"
FT   gene            complement(664814..666076)
FT                   /gene="vanW"
FT                   /locus_tag="BCQ_0669"
FT                   /note="BC0669"
FT   CDS_pept        complement(664814..666076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanW"
FT                   /locus_tag="BCQ_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11122"
FT                   /db_xref="GOA:B9J3X3"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X3"
FT                   /protein_id="ACM11122.1"
FT   gene            complement(666311..667324)
FT                   /gene="lytR"
FT                   /locus_tag="BCQ_0670"
FT                   /note="BC0670"
FT   CDS_pept        complement(666311..667324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytR"
FT                   /locus_tag="BCQ_0670"
FT                   /product="transcriptional regulator, LytR family"
FT                   /note="Code: K; COG: COG1316"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11123"
FT                   /db_xref="GOA:B9J3X4"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X4"
FT                   /protein_id="ACM11123.1"
FT   gene            complement(667515..668693)
FT                   /gene="nupC"
FT                   /locus_tag="BCQ_0671"
FT                   /note="BC0671"
FT   CDS_pept        complement(667515..668693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="BCQ_0671"
FT                   /product="nucleoside permease"
FT                   /note="Code: F; COG: COG1972"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11124"
FT                   /db_xref="GOA:B9J3X5"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X5"
FT                   /protein_id="ACM11124.1"
FT   gene            668783..669169
FT                   /gene="gloA"
FT                   /locus_tag="BCQ_0672"
FT                   /note="BC0672"
FT   CDS_pept        668783..669169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="BCQ_0672"
FT                   /product="lactoylglutathione lyase (glyoxylase I)"
FT                   /note="Code: E; COG: COG0346"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11125"
FT                   /db_xref="GOA:B9J3X6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X6"
FT                   /protein_id="ACM11125.1"
FT   gene            669298..670575
FT                   /locus_tag="BCQ_0673"
FT                   /note="BC0673"
FT   CDS_pept        669298..670575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0673"
FT                   /product="CBS domain protein"
FT                   /note="Code: R; COG: COG1253"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11126"
FT                   /db_xref="GOA:B9J3X7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X7"
FT                   /protein_id="ACM11126.1"
FT   gene            670738..672171
FT                   /gene="aspA"
FT                   /locus_tag="BCQ_0674"
FT                   /note="BC0674"
FT   CDS_pept        670738..672171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="BCQ_0674"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="Code: E; COG: COG1027"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11127"
FT                   /db_xref="GOA:B9J3X8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X8"
FT                   /protein_id="ACM11127.1"
FT   gene            complement(672344..672709)
FT                   /locus_tag="BCQ_0675"
FT                   /note="BC0675"
FT   CDS_pept        complement(672344..672709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11128"
FT                   /db_xref="GOA:B9J3X9"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3X9"
FT                   /protein_id="ACM11128.1"
FT                   NRLTAEELSMLKHPPLK"
FT   gene            complement(672825..674444)
FT                   /gene="lctP"
FT                   /locus_tag="BCQ_0676"
FT                   /note="BC0676"
FT   CDS_pept        complement(672825..674444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BCQ_0676"
FT                   /product="L-lactate permease"
FT                   /note="Code: C; COG: COG1620"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11129"
FT                   /db_xref="GOA:B9J3Y0"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y0"
FT                   /protein_id="ACM11129.1"
FT   gene            675256..675543
FT                   /gene="arsR"
FT                   /locus_tag="BCQ_0677"
FT                   /note="BC0677"
FT   CDS_pept        675256..675543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BCQ_0677"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="Code: K; COG: COG0640"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11130"
FT                   /db_xref="GOA:B9J3Y1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y1"
FT                   /protein_id="ACM11130.1"
FT   gene            675661..675909
FT                   /gene="sspH"
FT                   /locus_tag="BCQ_0678"
FT                   /note="BC0678"
FT   CDS_pept        675661..675909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspH"
FT                   /locus_tag="BCQ_0678"
FT                   /product="small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11131"
FT                   /db_xref="GOA:B9J3Y2"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y2"
FT                   /protein_id="ACM11131.1"
FT   gene            complement(675953..677302)
FT                   /gene="ptr2"
FT                   /locus_tag="BCQ_0679"
FT                   /note="BC0679"
FT   CDS_pept        complement(675953..677302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptr2"
FT                   /locus_tag="BCQ_0679"
FT                   /product="peptide transport protein, POT family"
FT                   /note="Code: E; COG: COG3104"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11132"
FT                   /db_xref="GOA:B9J3Y3"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y3"
FT                   /protein_id="ACM11132.1"
FT   gene            complement(677684..678637)
FT                   /gene="fecB"
FT                   /locus_tag="BCQ_0680"
FT                   /note="BC0680"
FT   CDS_pept        complement(677684..678637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB"
FT                   /locus_tag="BCQ_0680"
FT                   /product="iron(III) dicitrate ABC transporter, periplasmic
FT                   protein"
FT                   /note="Code: P; COG: COG0614"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11133"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y4"
FT                   /protein_id="ACM11133.1"
FT   gene            678800..679804
FT                   /gene="fecC"
FT                   /locus_tag="BCQ_0681"
FT                   /note="BC0681"
FT   CDS_pept        678800..679804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecC"
FT                   /locus_tag="BCQ_0681"
FT                   /product="iron compound ABC transporter, permease"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11134"
FT                   /db_xref="GOA:B9J3Y5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y5"
FT                   /protein_id="ACM11134.1"
FT   gene            679801..680859
FT                   /gene="fecD"
FT                   /locus_tag="BCQ_0682"
FT                   /note="BC0682"
FT   CDS_pept        679801..680859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="BCQ_0682"
FT                   /product="iron(III) dicitrate ABC transporter, permease"
FT                   /note="Code: P; COG: COG0609"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11135"
FT                   /db_xref="GOA:B9J3Y6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y6"
FT                   /protein_id="ACM11135.1"
FT                   YFIYLLYKSRNS"
FT   gene            680872..681693
FT                   /gene="fecE"
FT                   /locus_tag="BCQ_0683"
FT                   /note="BC0683"
FT   CDS_pept        680872..681693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="BCQ_0683"
FT                   /product="iron(III) dicitrate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Code: PH; COG: COG1120"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11136"
FT                   /db_xref="GOA:B9J3Y7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y7"
FT                   /protein_id="ACM11136.1"
FT   gene            complement(681726..682457)
FT                   /locus_tag="BCQ_0684"
FT                   /note="BC0684"
FT   CDS_pept        complement(681726..682457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: QR; COG: COG0500"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11137"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y8"
FT                   /protein_id="ACM11137.1"
FT   gene            682671..683861
FT                   /gene="bioF"
FT                   /locus_tag="BCQ_0685"
FT                   /note="BC0685"
FT   CDS_pept        682671..683861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BCQ_0685"
FT                   /product="8-amino-7-oxononanoate synthase
FT                   (7-keto-8-amino-pelargonic acid synthetase)"
FT                   /note="Code: H; COG: COG0156"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11138"
FT                   /db_xref="GOA:B9J3Y9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Y9"
FT                   /protein_id="ACM11138.1"
FT   gene            683906..684871
FT                   /gene="galE"
FT                   /locus_tag="BCQ_0686"
FT                   /note="BC0686"
FT   CDS_pept        683906..684871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="BCQ_0686"
FT                   /product="NAD-dependent epimerase; possible UDP-glucose
FT                   4-epimerase"
FT                   /note="Code: MG; COG: COG0451"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11139"
FT                   /db_xref="GOA:B9J3Z0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z0"
FT                   /protein_id="ACM11139.1"
FT   gene            684984..685526
FT                   /gene="pyrE"
FT                   /locus_tag="BCQ_0687"
FT                   /note="BC0687"
FT   CDS_pept        684984..685526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BCQ_0687"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="Code: F; COG: COG0461"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11140"
FT                   /db_xref="GOA:B9J3Z1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z1"
FT                   /protein_id="ACM11140.1"
FT                   LFTMDELIEGEKQHAKS"
FT   gene            685606..685935
FT                   /locus_tag="BCQ_0688"
FT                   /note="BC0688"
FT   CDS_pept        685606..685935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0688"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11141"
FT                   /db_xref="GOA:B9J3Z2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z2"
FT                   /protein_id="ACM11141.1"
FT                   QPETK"
FT   gene            complement(685974..687857)
FT                   /locus_tag="BCQ_0689"
FT                   /note="BC0689"
FT   CDS_pept        complement(685974..687857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0689"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="Code: P; COG: COG4548"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11142"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z3"
FT                   /protein_id="ACM11142.1"
FT   gene            complement(687861..688754)
FT                   /gene="norQ"
FT                   /locus_tag="BCQ_0690"
FT                   /note="BC0690"
FT   CDS_pept        complement(687861..688754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norQ"
FT                   /locus_tag="BCQ_0690"
FT                   /product="probable nitric-oxide reductase"
FT                   /note="Code: R; COG: COG0714"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11143"
FT                   /db_xref="GOA:B9J3Z4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z4"
FT                   /protein_id="ACM11143.1"
FT                   EQMTVRELAESYFFEG"
FT   gene            complement(688882..690411)
FT                   /gene="cls"
FT                   /locus_tag="BCQ_0691"
FT                   /note="BC0691"
FT   CDS_pept        complement(688882..690411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="BCQ_0691"
FT                   /product="cardiolipin synthetase"
FT                   /note="Code: I; COG: COG1502"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11144"
FT                   /db_xref="GOA:B9J3Z5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z5"
FT                   /protein_id="ACM11144.1"
FT   gene            690602..690880
FT                   /locus_tag="BCQ_0692"
FT                   /note="BC0692"
FT   CDS_pept        690602..690880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11145"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z6"
FT                   /protein_id="ACM11145.1"
FT   gene            690911..691249
FT                   /locus_tag="BCQ_0693"
FT                   /note="BC0693"
FT   CDS_pept        690911..691249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11146"
FT                   /db_xref="UniProtKB/TrEMBL:B9J3Z7"
FT                   /protein_id="ACM11146.1"
FT                   YQQTTYPY"
FT   gene            691709..693412
FT                   /locus_tag="BCQ_0694"
FT                   /note="BC0694"
FT   CDS_pept        691709..693412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0694"
FT                   /product="sensory box, GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11147"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4R7"
FT                   /protein_id="ACM11147.1"
FT   gene            complement(693444..694841)
FT                   /gene="arcD"
FT                   /locus_tag="BCQ_0695"
FT                   /note="BC0695"
FT   CDS_pept        complement(693444..694841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="BCQ_0695"
FT                   /product="probable arginine/ornithine antiporter protein"
FT                   /note="Code: E; COG: COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11148"
FT                   /db_xref="GOA:B9J4R8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4R8"
FT                   /protein_id="ACM11148.1"
FT                   KDSQKMN"
FT   gene            695292..696002
FT                   /gene="treR"
FT                   /locus_tag="BCQ_0696"
FT                   /note="BC0696"
FT   CDS_pept        695292..696002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="BCQ_0696"
FT                   /product="trehalose operon transcriptional repressor"
FT                   /note="Code: K; COG: COG2188"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11149"
FT                   /db_xref="GOA:B9J4R9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4R9"
FT                   /protein_id="ACM11149.1"
FT                   RLDIFHFSDVARRK"
FT   gene            696140..696568
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0697"
FT                   /note="BC0697"
FT   CDS_pept        696140..696568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0697"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase (PTS system, trehalose-specific IIBC
FT                   component)"
FT                   /note="Code: G; COG: COG1264"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11150"
FT                   /db_xref="GOA:B9J4S0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S0"
FT                   /protein_id="ACM11150.1"
FT   gene            696588..696701
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0698"
FT                   /note="BC0698"
FT   CDS_pept        696588..696701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0698"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase (PTS system, trehalose-specific IIBC
FT                   component)"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11151"
FT                   /db_xref="GOA:B9J4S1"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S1"
FT                   /protein_id="ACM11151.1"
FT   gene            696721..697569
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0699"
FT                   /note="BC0699"
FT   CDS_pept        696721..697569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BCQ_0699"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase (PTS system, trehalose-specific IIBC
FT                   component)"
FT                   /note="Code: G; COG: COG1263"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11152"
FT                   /db_xref="GOA:B9J4S2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S2"
FT                   /protein_id="ACM11152.1"
FT                   K"
FT   gene            697583..699244
FT                   /gene="treC"
FT                   /locus_tag="BCQ_0700"
FT                   /note="BC0700"
FT   CDS_pept        697583..699244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="BCQ_0700"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /note="Code: G; COG: COG0366"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11153"
FT                   /db_xref="GOA:B9J4S3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S3"
FT                   /protein_id="ACM11153.1"
FT   gene            complement(699276..700400)
FT                   /gene="gerKC"
FT                   /locus_tag="BCQ_0701"
FT                   /note="BC0701"
FT   CDS_pept        complement(699276..700400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BCQ_0701"
FT                   /product="probable spore germination protein KC"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11154"
FT                   /db_xref="GOA:B9J4S4"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S4"
FT                   /protein_id="ACM11154.1"
FT   gene            complement(700381..701496)
FT                   /gene="gerKB"
FT                   /locus_tag="BCQ_0702"
FT                   /note="BC0702"
FT   CDS_pept        complement(700381..701496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BCQ_0702"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11155"
FT                   /db_xref="GOA:B9J4S5"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S5"
FT                   /protein_id="ACM11155.1"
FT   gene            complement(701468..702970)
FT                   /gene="gerKA"
FT                   /locus_tag="BCQ_0703"
FT                   /note="BC0703"
FT   CDS_pept        complement(701468..702970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BCQ_0703"
FT                   /product="spore germination protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11156"
FT                   /db_xref="GOA:B9J4S6"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S6"
FT                   /protein_id="ACM11156.1"
FT   gene            703120..703806
FT                   /locus_tag="BCQ_0704"
FT                   /note="BC0704"
FT   CDS_pept        703120..703806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0704"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11157"
FT                   /db_xref="GOA:B9J4S7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S7"
FT                   /protein_id="ACM11157.1"
FT                   LTFMSN"
FT   gene            703830..704801
FT                   /locus_tag="BCQ_0705"
FT                   /note="BC0705"
FT   CDS_pept        703830..704801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCQ_0705"
FT                   /product="putative protein kinase"
FT                   /note="Code: R; COG: COG2334"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11158"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S8"
FT                   /protein_id="ACM11158.1"
FT   gene            705085..706419
FT                   /gene="alsT"
FT                   /locus_tag="BCQ_0706"
FT                   /note="BC0706"
FT   CDS_pept        705085..706419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsT"
FT                   /locus_tag="BCQ_0706"
FT                   /product="sodium/alanine symporter family protein"
FT                   /note="Code: E; COG: COG1115"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11159"
FT                   /db_xref="GOA:B9J4S9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4S9"
FT                   /protein_id="ACM11159.1"
FT   gene            706388..707284
FT                   /gene="glnQ"
FT                   /locus_tag="BCQ_0707"
FT                   /note="BC0707"
FT   CDS_pept        706388..707284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BCQ_0707"
FT                   /product="ABC transporter, ATP-binding protein; probable
FT                   glutamine ABC transporter, ATP-binding"
FT                   /note="Code: E; COG: COG1126"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11160"
FT                   /db_xref="GOA:B9J4T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4T0"
FT                   /protein_id="ACM11160.1"
FT                   SPEQERARLFLSRVLNH"
FT   gene            707297..708127
FT                   /gene="glnH"
FT                   /locus_tag="BCQ_0708"
FT                   /note="BC0708"
FT   CDS_pept        707297..708127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="BCQ_0708"
FT                   /product="ABC transporter, substrate-binding protein;
FT                   probable glutamine-binding protein"
FT                   /note="Code: ET; COG: COG0834"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11161"
FT                   /db_xref="GOA:B9J4T1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4T1"
FT                   /protein_id="ACM11161.1"
FT   gene            708321..708854
FT                   /gene="glnP"
FT                   /locus_tag="BCQ_0709"
FT                   /note="BC0709"
FT   CDS_pept        708321..708854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="BCQ_0709"
FT                   /product="ABC transporter, permease; probable glutamine ABC
FT                   transporter, permease"
FT                   /note="Code: E; COG: COG0765"
FT                   /db_xref="EnsemblGenomes-Gn:BCQ_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACM11162"
FT                   /db_xref="GOA:B9J4T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9J4T2"
FT                   /protein_id="ACM11162.1"
FT                   LVRYLEKRLAKEAV"
FT   gene            708855..709499
FT                   /gene="glnP"
FT                   /locus_tag="BCQ_0710"
FT                   /note="BC0710"
FT   CDS_pept        708855..709499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="BCQ_0710"
FT                   /product="ABC transporter, permease; probable glutamine ABC
FT                   transporter, p