(data stored in ACNUC7421 zone)

EMBL: CP000232

ID   CP000232; SV 1; circular; genomic DNA; STD; PRO; 2628784 BP.
XX
AC   CP000232; AADT03000000-AADT03000086;
XX
PR   Project:PRJNA10648;
XX
DT   13-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Moorella thermoacetica ATCC 39073, complete genome.
XX
KW   .
XX
OS   Moorella thermoacetica ATCC 39073
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacteraceae; Moorella group; Moorella.
XX
RN   [1]
RP   1-2628784
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chertkov O., Saunders E.H., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Anderson I., Richardson P., Ragsdale S.;
RT   "Complete sequence of Moorella thermoacetica ATCC 39073";
RL   Unpublished.
XX
RN   [2]
RP   1-2628784
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chertkov O., Saunders E.H., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Anderson I., Richardson P.;
RT   ;
RL   Submitted (08-DEC-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 383380ca54d0793b89173e0a5614f02a.
DR   BioSample; SAMN02598257.
DR   EnsemblGenomes-Gn; EBG00001179966.
DR   EnsemblGenomes-Gn; EBG00001179967.
DR   EnsemblGenomes-Gn; EBG00001179968.
DR   EnsemblGenomes-Gn; EBG00001179969.
DR   EnsemblGenomes-Gn; EBG00001179970.
DR   EnsemblGenomes-Gn; EBG00001179971.
DR   EnsemblGenomes-Gn; EBG00001179972.
DR   EnsemblGenomes-Gn; EBG00001179973.
DR   EnsemblGenomes-Gn; EBG00001179974.
DR   EnsemblGenomes-Gn; EBG00001179975.
DR   EnsemblGenomes-Gn; EBG00001179976.
DR   EnsemblGenomes-Gn; EBG00001179977.
DR   EnsemblGenomes-Gn; EBG00001179978.
DR   EnsemblGenomes-Gn; EBG00001179979.
DR   EnsemblGenomes-Gn; EBG00001179980.
DR   EnsemblGenomes-Gn; EBG00001179981.
DR   EnsemblGenomes-Gn; EBG00001179982.
DR   EnsemblGenomes-Gn; EBG00001179983.
DR   EnsemblGenomes-Gn; EBG00001179984.
DR   EnsemblGenomes-Gn; EBG00001179985.
DR   EnsemblGenomes-Gn; EBG00001179986.
DR   EnsemblGenomes-Gn; EBG00001179987.
DR   EnsemblGenomes-Gn; EBG00001179988.
DR   EnsemblGenomes-Gn; EBG00001179989.
DR   EnsemblGenomes-Gn; EBG00001179990.
DR   EnsemblGenomes-Gn; EBG00001179991.
DR   EnsemblGenomes-Gn; EBG00001179992.
DR   EnsemblGenomes-Gn; EBG00001179993.
DR   EnsemblGenomes-Gn; EBG00001179994.
DR   EnsemblGenomes-Gn; EBG00001179995.
DR   EnsemblGenomes-Gn; EBG00001179996.
DR   EnsemblGenomes-Gn; EBG00001179997.
DR   EnsemblGenomes-Gn; EBG00001179998.
DR   EnsemblGenomes-Gn; EBG00001179999.
DR   EnsemblGenomes-Gn; EBG00001180000.
DR   EnsemblGenomes-Gn; EBG00001180001.
DR   EnsemblGenomes-Gn; EBG00001180002.
DR   EnsemblGenomes-Gn; EBG00001180003.
DR   EnsemblGenomes-Gn; EBG00001180004.
DR   EnsemblGenomes-Gn; EBG00001180005.
DR   EnsemblGenomes-Gn; EBG00001180006.
DR   EnsemblGenomes-Gn; EBG00001180007.
DR   EnsemblGenomes-Gn; EBG00001180008.
DR   EnsemblGenomes-Gn; EBG00001180009.
DR   EnsemblGenomes-Gn; EBG00001180010.
DR   EnsemblGenomes-Gn; EBG00001180011.
DR   EnsemblGenomes-Gn; EBG00001180012.
DR   EnsemblGenomes-Gn; EBG00001180013.
DR   EnsemblGenomes-Gn; EBG00001180014.
DR   EnsemblGenomes-Gn; EBG00001180015.
DR   EnsemblGenomes-Gn; EBG00001180016.
DR   EnsemblGenomes-Gn; EBG00001180017.
DR   EnsemblGenomes-Gn; EBG00001180018.
DR   EnsemblGenomes-Gn; EBG00001180019.
DR   EnsemblGenomes-Gn; EBG00001180020.
DR   EnsemblGenomes-Gn; EBG00001180021.
DR   EnsemblGenomes-Gn; EBG00001180022.
DR   EnsemblGenomes-Gn; EBG00001180023.
DR   EnsemblGenomes-Gn; EBG00001180024.
DR   EnsemblGenomes-Gn; EBG00001180025.
DR   EnsemblGenomes-Gn; EBG00001180026.
DR   EnsemblGenomes-Gn; EBG00001180027.
DR   EnsemblGenomes-Gn; EBG00001180028.
DR   EnsemblGenomes-Gn; EBG00001180029.
DR   EnsemblGenomes-Gn; EBG00001180030.
DR   EnsemblGenomes-Gn; EBG00001180031.
DR   EnsemblGenomes-Gn; EBG00001180032.
DR   EnsemblGenomes-Gn; EBG00001180033.
DR   EnsemblGenomes-Gn; EBG00001180034.
DR   EnsemblGenomes-Gn; EBG00001180035.
DR   EnsemblGenomes-Gn; EBG00001180036.
DR   EnsemblGenomes-Gn; EBG00001180037.
DR   EnsemblGenomes-Gn; EBG00001180038.
DR   EnsemblGenomes-Gn; EBG00001180039.
DR   EnsemblGenomes-Gn; EBG00001180040.
DR   EnsemblGenomes-Gn; EBG00001180041.
DR   EnsemblGenomes-Gn; EBG00001180042.
DR   EnsemblGenomes-Gn; EBG00001180043.
DR   EnsemblGenomes-Gn; EBG00001180044.
DR   EnsemblGenomes-Gn; EBG00001180045.
DR   EnsemblGenomes-Gn; EBG00001180046.
DR   EnsemblGenomes-Gn; EBG00001180047.
DR   EnsemblGenomes-Gn; EBG00001180048.
DR   EnsemblGenomes-Gn; EBG00001180049.
DR   EnsemblGenomes-Gn; EBG00001180050.
DR   EnsemblGenomes-Gn; EBG00001180051.
DR   EnsemblGenomes-Gn; EBG00001180052.
DR   EnsemblGenomes-Gn; Moth_R0002.
DR   EnsemblGenomes-Gn; Moth_R0003.
DR   EnsemblGenomes-Gn; Moth_R0004.
DR   EnsemblGenomes-Gn; Moth_R0005.
DR   EnsemblGenomes-Gn; Moth_R0006.
DR   EnsemblGenomes-Gn; Moth_R0007.
DR   EnsemblGenomes-Gn; Moth_R0008.
DR   EnsemblGenomes-Gn; Moth_R0009.
DR   EnsemblGenomes-Gn; Moth_R0010.
DR   EnsemblGenomes-Gn; Moth_R0012.
DR   EnsemblGenomes-Gn; Moth_R0013.
DR   EnsemblGenomes-Gn; Moth_R0014.
DR   EnsemblGenomes-Gn; Moth_R0015.
DR   EnsemblGenomes-Gn; Moth_R0016.
DR   EnsemblGenomes-Gn; Moth_R0017.
DR   EnsemblGenomes-Gn; Moth_R0018.
DR   EnsemblGenomes-Gn; Moth_R0019.
DR   EnsemblGenomes-Gn; Moth_R0020.
DR   EnsemblGenomes-Gn; Moth_R0023.
DR   EnsemblGenomes-Gn; Moth_R0025.
DR   EnsemblGenomes-Gn; Moth_R0026.
DR   EnsemblGenomes-Gn; Moth_R0027.
DR   EnsemblGenomes-Gn; Moth_R0028.
DR   EnsemblGenomes-Gn; Moth_R0029.
DR   EnsemblGenomes-Gn; Moth_R0030.
DR   EnsemblGenomes-Gn; Moth_R0031.
DR   EnsemblGenomes-Gn; Moth_R0033.
DR   EnsemblGenomes-Gn; Moth_R0034.
DR   EnsemblGenomes-Gn; Moth_R0035.
DR   EnsemblGenomes-Gn; Moth_R0036.
DR   EnsemblGenomes-Gn; Moth_R0038.
DR   EnsemblGenomes-Gn; Moth_R0043.
DR   EnsemblGenomes-Gn; Moth_R0044.
DR   EnsemblGenomes-Gn; Moth_R0045.
DR   EnsemblGenomes-Gn; Moth_R0046.
DR   EnsemblGenomes-Gn; Moth_R0047.
DR   EnsemblGenomes-Gn; Moth_R0050.
DR   EnsemblGenomes-Gn; Moth_R0051.
DR   EnsemblGenomes-Gn; Moth_R0054.
DR   EnsemblGenomes-Gn; Moth_R0055.
DR   EnsemblGenomes-Gn; Moth_R0063.
DR   EnsemblGenomes-Gn; Moth_R0064.
DR   EnsemblGenomes-Gn; Moth_R0065.
DR   EnsemblGenomes-Gn; Moth_R0066.
DR   EnsemblGenomes-Gn; Moth_R0067.
DR   EnsemblGenomes-Gn; Moth_R0068.
DR   EnsemblGenomes-Gn; Moth_R0069.
DR   EnsemblGenomes-Gn; Moth_R0070.
DR   EnsemblGenomes-Gn; Moth_R0071.
DR   EnsemblGenomes-Gn; Moth_R0072.
DR   EnsemblGenomes-Gn; Moth_R0081.
DR   EnsemblGenomes-Gn; Moth_R0082.
DR   EnsemblGenomes-Gn; Moth_R0083.
DR   EnsemblGenomes-Gn; Moth_R0084.
DR   EnsemblGenomes-Gn; Moth_R0085.
DR   EnsemblGenomes-Gn; Moth_R0086.
DR   EnsemblGenomes-Gn; Moth_R0088.
DR   EnsemblGenomes-Gn; Moth_R0089.
DR   EnsemblGenomes-Gn; Moth_R0090.
DR   EnsemblGenomes-Gn; Moth_R0092.
DR   EnsemblGenomes-Tr; EBT00001757861.
DR   EnsemblGenomes-Tr; EBT00001757862.
DR   EnsemblGenomes-Tr; EBT00001757863.
DR   EnsemblGenomes-Tr; EBT00001757864.
DR   EnsemblGenomes-Tr; EBT00001757865.
DR   EnsemblGenomes-Tr; EBT00001757866.
DR   EnsemblGenomes-Tr; EBT00001757867.
DR   EnsemblGenomes-Tr; EBT00001757868.
DR   EnsemblGenomes-Tr; EBT00001757869.
DR   EnsemblGenomes-Tr; EBT00001757870.
DR   EnsemblGenomes-Tr; EBT00001757871.
DR   EnsemblGenomes-Tr; EBT00001757872.
DR   EnsemblGenomes-Tr; EBT00001757873.
DR   EnsemblGenomes-Tr; EBT00001757874.
DR   EnsemblGenomes-Tr; EBT00001757875.
DR   EnsemblGenomes-Tr; EBT00001757876.
DR   EnsemblGenomes-Tr; EBT00001757877.
DR   EnsemblGenomes-Tr; EBT00001757878.
DR   EnsemblGenomes-Tr; EBT00001757879.
DR   EnsemblGenomes-Tr; EBT00001757880.
DR   EnsemblGenomes-Tr; EBT00001757881.
DR   EnsemblGenomes-Tr; EBT00001757882.
DR   EnsemblGenomes-Tr; EBT00001757883.
DR   EnsemblGenomes-Tr; EBT00001757884.
DR   EnsemblGenomes-Tr; EBT00001757885.
DR   EnsemblGenomes-Tr; EBT00001757886.
DR   EnsemblGenomes-Tr; EBT00001757887.
DR   EnsemblGenomes-Tr; EBT00001757888.
DR   EnsemblGenomes-Tr; EBT00001757889.
DR   EnsemblGenomes-Tr; EBT00001757890.
DR   EnsemblGenomes-Tr; EBT00001757891.
DR   EnsemblGenomes-Tr; EBT00001757892.
DR   EnsemblGenomes-Tr; EBT00001757894.
DR   EnsemblGenomes-Tr; EBT00001757897.
DR   EnsemblGenomes-Tr; EBT00001757898.
DR   EnsemblGenomes-Tr; EBT00001757899.
DR   EnsemblGenomes-Tr; EBT00001757900.
DR   EnsemblGenomes-Tr; EBT00001757901.
DR   EnsemblGenomes-Tr; EBT00001757902.
DR   EnsemblGenomes-Tr; EBT00001757903.
DR   EnsemblGenomes-Tr; EBT00001757904.
DR   EnsemblGenomes-Tr; EBT00001757905.
DR   EnsemblGenomes-Tr; EBT00001757906.
DR   EnsemblGenomes-Tr; EBT00001757907.
DR   EnsemblGenomes-Tr; EBT00001757908.
DR   EnsemblGenomes-Tr; EBT00001757909.
DR   EnsemblGenomes-Tr; EBT00001757910.
DR   EnsemblGenomes-Tr; EBT00001757911.
DR   EnsemblGenomes-Tr; EBT00001757913.
DR   EnsemblGenomes-Tr; EBT00001757916.
DR   EnsemblGenomes-Tr; EBT00001757918.
DR   EnsemblGenomes-Tr; EBT00001757920.
DR   EnsemblGenomes-Tr; EBT00001757921.
DR   EnsemblGenomes-Tr; EBT00001757923.
DR   EnsemblGenomes-Tr; EBT00001757925.
DR   EnsemblGenomes-Tr; EBT00001757927.
DR   EnsemblGenomes-Tr; EBT00001757928.
DR   EnsemblGenomes-Tr; EBT00001757929.
DR   EnsemblGenomes-Tr; EBT00001757930.
DR   EnsemblGenomes-Tr; EBT00001757932.
DR   EnsemblGenomes-Tr; EBT00001757935.
DR   EnsemblGenomes-Tr; EBT00001757937.
DR   EnsemblGenomes-Tr; EBT00001757939.
DR   EnsemblGenomes-Tr; EBT00001757940.
DR   EnsemblGenomes-Tr; EBT00001757942.
DR   EnsemblGenomes-Tr; EBT00001757944.
DR   EnsemblGenomes-Tr; EBT00001757946.
DR   EnsemblGenomes-Tr; EBT00001757949.
DR   EnsemblGenomes-Tr; EBT00001757950.
DR   EnsemblGenomes-Tr; EBT00001757953.
DR   EnsemblGenomes-Tr; EBT00001757955.
DR   EnsemblGenomes-Tr; EBT00001757957.
DR   EnsemblGenomes-Tr; EBT00001757958.
DR   EnsemblGenomes-Tr; EBT00001757960.
DR   EnsemblGenomes-Tr; EBT00001757962.
DR   EnsemblGenomes-Tr; EBT00001757965.
DR   EnsemblGenomes-Tr; EBT00001757967.
DR   EnsemblGenomes-Tr; EBT00001757969.
DR   EnsemblGenomes-Tr; EBT00001757971.
DR   EnsemblGenomes-Tr; EBT00001757973.
DR   EnsemblGenomes-Tr; EBT00001757975.
DR   EnsemblGenomes-Tr; EBT00001757977.
DR   EnsemblGenomes-Tr; EBT00001757979.
DR   EnsemblGenomes-Tr; EBT00001757982.
DR   EnsemblGenomes-Tr; EBT00001757984.
DR   EnsemblGenomes-Tr; EBT00001757985.
DR   EnsemblGenomes-Tr; EBT00001757987.
DR   EnsemblGenomes-Tr; Moth_R0002-1.
DR   EnsemblGenomes-Tr; Moth_R0003-1.
DR   EnsemblGenomes-Tr; Moth_R0004-1.
DR   EnsemblGenomes-Tr; Moth_R0005-1.
DR   EnsemblGenomes-Tr; Moth_R0006-1.
DR   EnsemblGenomes-Tr; Moth_R0007-1.
DR   EnsemblGenomes-Tr; Moth_R0008-1.
DR   EnsemblGenomes-Tr; Moth_R0009-1.
DR   EnsemblGenomes-Tr; Moth_R0010-1.
DR   EnsemblGenomes-Tr; Moth_R0012-1.
DR   EnsemblGenomes-Tr; Moth_R0013-1.
DR   EnsemblGenomes-Tr; Moth_R0014-1.
DR   EnsemblGenomes-Tr; Moth_R0015-1.
DR   EnsemblGenomes-Tr; Moth_R0016-1.
DR   EnsemblGenomes-Tr; Moth_R0017-1.
DR   EnsemblGenomes-Tr; Moth_R0018-1.
DR   EnsemblGenomes-Tr; Moth_R0019-1.
DR   EnsemblGenomes-Tr; Moth_R0020-1.
DR   EnsemblGenomes-Tr; Moth_R0023-1.
DR   EnsemblGenomes-Tr; Moth_R0025-1.
DR   EnsemblGenomes-Tr; Moth_R0026-1.
DR   EnsemblGenomes-Tr; Moth_R0027-1.
DR   EnsemblGenomes-Tr; Moth_R0028-1.
DR   EnsemblGenomes-Tr; Moth_R0029-1.
DR   EnsemblGenomes-Tr; Moth_R0030-1.
DR   EnsemblGenomes-Tr; Moth_R0031-1.
DR   EnsemblGenomes-Tr; Moth_R0033-1.
DR   EnsemblGenomes-Tr; Moth_R0034-1.
DR   EnsemblGenomes-Tr; Moth_R0035-1.
DR   EnsemblGenomes-Tr; Moth_R0036-1.
DR   EnsemblGenomes-Tr; Moth_R0038-1.
DR   EnsemblGenomes-Tr; Moth_R0043-1.
DR   EnsemblGenomes-Tr; Moth_R0044-1.
DR   EnsemblGenomes-Tr; Moth_R0045-1.
DR   EnsemblGenomes-Tr; Moth_R0046-1.
DR   EnsemblGenomes-Tr; Moth_R0047-1.
DR   EnsemblGenomes-Tr; Moth_R0050-1.
DR   EnsemblGenomes-Tr; Moth_R0051-1.
DR   EnsemblGenomes-Tr; Moth_R0054-1.
DR   EnsemblGenomes-Tr; Moth_R0055-1.
DR   EnsemblGenomes-Tr; Moth_R0063-1.
DR   EnsemblGenomes-Tr; Moth_R0064-1.
DR   EnsemblGenomes-Tr; Moth_R0065-1.
DR   EnsemblGenomes-Tr; Moth_R0066-1.
DR   EnsemblGenomes-Tr; Moth_R0067-1.
DR   EnsemblGenomes-Tr; Moth_R0068-1.
DR   EnsemblGenomes-Tr; Moth_R0069-1.
DR   EnsemblGenomes-Tr; Moth_R0070-1.
DR   EnsemblGenomes-Tr; Moth_R0071-1.
DR   EnsemblGenomes-Tr; Moth_R0072-1.
DR   EnsemblGenomes-Tr; Moth_R0081-1.
DR   EnsemblGenomes-Tr; Moth_R0082-1.
DR   EnsemblGenomes-Tr; Moth_R0083-1.
DR   EnsemblGenomes-Tr; Moth_R0084-1.
DR   EnsemblGenomes-Tr; Moth_R0085-1.
DR   EnsemblGenomes-Tr; Moth_R0086-1.
DR   EnsemblGenomes-Tr; Moth_R0088-1.
DR   EnsemblGenomes-Tr; Moth_R0089-1.
DR   EnsemblGenomes-Tr; Moth_R0090-1.
DR   EnsemblGenomes-Tr; Moth_R0092-1.
DR   EuropePMC; PMC2575129; 18631365.
DR   EuropePMC; PMC2988603; 20889794.
DR   EuropePMC; PMC3393501; 22582275.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC3591994; 23316038.
DR   EuropePMC; PMC4135698; 25002540.
DR   EuropePMC; PMC4599089; 26450730.
DR   EuropePMC; PMC4600107; 26350967.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP000232.
DR   SILVA-SSU; CP000232.
DR   StrainInfo; 111654; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Stephen Ragsdale (sragsdale@unl.edu)
CC   Bacteria available from ATCC: ATCC 39073
CC   Contacts: Stephen Ragsdale (sragsdale@unl.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2628784
FT                   /organism="Moorella thermoacetica ATCC 39073"
FT                   /strain="ATCC 39073"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:264732"
FT   gene            complement(90..227)
FT                   /locus_tag="Moth_0001"
FT   CDS_pept        complement(90..227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0001"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18341"
FT                   /db_xref="GOA:Q2RMJ8"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ8"
FT                   /protein_id="ABC18341.1"
FT                   /translation="MVKRTYQPKRRRHKRVHGFLKRMRTRCGREVIKRRRQKGRKRLSA
FT                   "
FT   gene            450..1778
FT                   /locus_tag="Moth_0002"
FT   CDS_pept        450..1778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18342"
FT                   /db_xref="GOA:Q2RMJ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ7"
FT                   /protein_id="ABC18342.1"
FT                   /translation="MAPVQLDLAWQQALTILEKQVSTPALETWFYEARPVTMQGNTLVL
FT                   AVANEFARDYIQSRYYPLIQEALQQVLGRKIIKIQVICFPLSSSNQRQEPELEDPSLPP
FT                   LNPKYTFETFVVGNSNRFAHAACLAVAESPASSYNPLFIYGGVGLGKTHLMQAIGHRVR
FT                   QHLPELRVMYISSEKFTNDLINAIKDKATEQFRTKYRNIDVLLIDDIQFLAKKESTQEE
FT                   FFHTFNHLYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRMAILRK
FT                   KAVAEGINLPDEVMFFIAQKIDSNIRELEGALIRVAAYANFTKKEITPGLAEEILKDVL
FT                   DLARPKPITIRLIQETVANYFNLKVEDLKAKKRTRSVAYPRQIAMYLCRELTESSLPDI
FT                   GKEFGGRDHTTVLHAYDKIRDDLNTDPSLPQVIAQIRQQLRNQ"
FT   gene            1894..3018
FT                   /locus_tag="Moth_0003"
FT   CDS_pept        1894..3018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18343"
FT                   /db_xref="GOA:Q2RMJ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ6"
FT                   /protein_id="ABC18343.1"
FT                   /translation="MHILCPQPQLVNAVQKVYRAVATTTTYHAITGILLQAHENTLTLQ
FT                   GTDLDLGIIYTFPVEVIEEGELLLPARIFTEMVRRLPPTSLSLQSLQDNTVEIAYQQSK
FT                   VQLNSIDASQFPLLPPVEGNFSFTVAITALKDAIRKVTIAAGNDDLRSIFNGVLWELEP
FT                   GENRFNLVATDTHRLAVYHGQPEDSTSNETATALVPCRAMNELARLLPGEDGLVKITIG
FT                   ESQIYAQHEGLTLYTRLLNGKFPHYQQVIPTDHITTIEIATRDLLDTVERATLLARDEN
FT                   KARAHIIILQVGEKSLKITSEAAEIGHLEEELTAEIAGQPLELALNGRYLLETLRVIDT
FT                   ENVILELLAPLKPVVVRPAGQENYFCLILPVRIG"
FT   gene            3081..3266
FT                   /locus_tag="Moth_0004"
FT   CDS_pept        3081..3266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0004"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18344"
FT                   /db_xref="GOA:Q2RMJ5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ5"
FT                   /protein_id="ABC18344.1"
FT                   /translation="MDQFLKWNGVAATGGQAKELITSGLVRVNGQVERRRSHELVPGDE
FT                   VEVKGACFKLTTAPAD"
FT   gene            3229..4341
FT                   /locus_tag="Moth_0005"
FT   CDS_pept        3229..4341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18345"
FT                   /db_xref="GOA:Q2RMJ4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMJ4"
FT                   /protein_id="ABC18345.1"
FT                   /translation="MPALSLQQLQLINFRSYKCLTWDCRPGLNIIFGPNAAGKTNLLEA
FT                   IGYLALARSFRQQQDQQLLTWGASSFQVRGLCHSNGEKIELVINYQQHNKRLTINGNRN
FT                   RLIELLGIFPVIYFGPDDLHLLKGGPAYRRHFLDREISMGDRLYCRNLQDYRRILFQRN
FT                   LLLRAIKAGRGKEGELEPWDIQLLATGKAICEKRSCFLQSLAPRVAATYRDMAGGEELA
FT                   LIYRPGVASQEEWAERLKVGREREVQAGMTLWGPHRDDFTFTLDGHEARYFASQGQQRA
FT                   IVLALKLAEARYYRELLHVMPVLLLDDVFSELDEAHQGALLELLAGADQAFLTTTEVGL
FT                   LPARLIQRSHLWELARGREPRLTSGPVEAQ"
FT   gene            4494..4745
FT                   /locus_tag="Moth_0006"
FT   CDS_pept        4494..4745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0006"
FT                   /product="YaaB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18346"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ3"
FT                   /protein_id="ABC18346.1"
FT                   /translation="MYLHIGNDMVVPYREIIAILDLETAGRSAATREFLEILNSKARKD
FT                   PGAGEIKSCIVTEKEIYYSTISSGTLMKRASMALAMPD"
FT   gene            4828..6732
FT                   /locus_tag="Moth_0007"
FT   CDS_pept        4828..6732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18347"
FT                   /db_xref="GOA:Q2RMJ2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ2"
FT                   /protein_id="ABC18347.1"
FT                   /translation="MDQVRNEYDASQIQILEGLEAVRRRPGMYIGNTGVRGLHQLVFEL
FT                   VDNSIDEALAGFCDRIEVTIHENGSLTVADNGRGIPVDIHEKTGLPAVEVALTILHAGG
FT                   KFGGNGYKVAGGLHGVGLSVVNALSEWLEIKVKRNGKIYHQEYRRGQKVSELKVIGKTK
FT                   GTGTSVTFYPDGEIFEDLVFQDEIIGRRLQELSFLNRGVKIVFRDERNESETTYYHTGG
FT                   LIDFVRHLNKNKTVLFNKPLYFSGEKDDVQAEIAIQYNDGYNELILSYANNIHTVEGGS
FT                   HEIGFKTALTRVINDYARRFNLLKDAEANLSGEDIREGLTAVISVKVLEPQFEGQTKTK
FT                   LGNTEVRGIVDSLVAENLSAYLEENPTIGRRIVDKALNAFRAREAARKARELTRRKNAL
FT                   EITSLPGKLADCTHKDPAMAELFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKAR
FT                   LDKILNNEEIRTIITALGTGIGDDFNINKARYHKTILMADADVDGSHIRTLLLTFFYRY
FT                   MRPLITEGYIYIAQPPLYKVYRGKVERYLYNDAELEKFLKEHEGERWEIQRYKGLGEMN
FT                   PEQLWETTMNPESRTLLQVNLEDAMEADAIFNILMGDRVEPRREFIQQHAHEVRNLDI"
FT   gene            6840..9284
FT                   /locus_tag="Moth_0008"
FT   CDS_pept        6840..9284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0008"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18348"
FT                   /db_xref="GOA:Q2RMJ1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ1"
FT                   /protein_id="ABC18348.1"
FT                   /translation="MAKEGGKYLALETSGKIMPVILEEEMKRSYIDYAMSVIVGRALPD
FT                   VRDGLKPVHRRILYAMYEEGLTPDKPYKKSAVVVGTVLARYHPHGDAAVYETMVRLAQD
FT                   FACRYPLIDGHGNFGSVDGDSPAAMRYTEARLSKLALTMLADIDKDTVDFVDNYDGSLK
FT                   EPVVLPARIPQLLVNGSAGIAVGMATNIPPHNLGEVIDALVLLIDKPDADLKEITKIIK
FT                   GPDFPTAGLIIGREGIRNAYRTGRGSIKVRAKAQVETLSNGKSQIVVTEIPYQVNKARL
FT                   VQSIGDLVREKKIDGIVDLRDESDRTGMRIVIELRRDVQPKVILNQLYKHTQMQENFGV
FT                   IMLALVDGRPRVLNLREMLTLYLDHQKEVITRRTRYLLAQAEARAHIVAGLRIAIQFLD
FT                   EVIRIIRQAPNEPEACRGLMERFQLSDKQAKAIVDMRLGRLTALEREKLEEEWQELQKR
FT                   IAYYQEVLASEARVYAIVRDELLEIKRKFADPRRTQIVLEEENLELEDLIAREDIVVTL
FT                   THRGYIKRQPVDTYRSQKRGGRGIQAMGTREEDIVRDIFVTTTHHYLLFFTNQGRVFRL
FT                   RGHEIPEAGRQARGTPLVNLLYLNKGETITAVIPIRELEEDSYLLMATRKGIVKKTSLG
FT                   EYHTSRRDGLLAINLDEDDDLVGVLRTEGNNEVMLVTRRGKAIRFGEDEVRPMGRAARG
FT                   VRGIALDDDDMVVGLVKVREDAELVVVSERGFGKRTTLEEYRPQGRGGKGIITMNVTDR
FT                   TGPVAAVAVVKLEDELMLISAEGILIRLGVEDISRQGRNTQGVTLMRLEPSDRVVAMAR
FT                   IQ"
FT   gene            9450..10340
FT                   /locus_tag="Moth_0009"
FT   CDS_pept        9450..10340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0009"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18349"
FT                   /db_xref="GOA:Q2RMJ0"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMJ0"
FT                   /protein_id="ABC18349.1"
FT                   /translation="MAAAEVGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVM
FT                   ALERVPADIRAAGGVARMADPTVILRIMDAVTIPVMAKARIGHFVEAQILEALGVDYID
FT                   ESEVLTPADEDFHINKHEFKVPFVCGARNLGEALRRIGEGAAMIRTKGEPGTGNVVEAV
FT                   RHMRRVMSEIRRLQNLPDEELMTFAKEIQAPYELVKQVKELGRLPVVNFAAGGIATPAD
FT                   AALMMQLGADGIFVGSGIFKSSDPRKRARAIVAATTHFREPEVLAEVSRDLGEAMPGIE
FT                   IATIKPEERMQERGW"
FT   gene            10357..10923
FT                   /locus_tag="Moth_0010"
FT   CDS_pept        10357..10923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0010"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18350"
FT                   /db_xref="GOA:Q2RMI9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMI9"
FT                   /protein_id="ABC18350.1"
FT                   /translation="MRIGVLAMQGAFREHIQSLEALGVQGVEIRHANQLEGIAGLIIPG
FT                   GESTTIGKLMVEFNLLEPVRHLAEGGLPVFGTCAGMVLLARDIIGSDQPRLGLMNARVQ
FT                   RNAFGRQVDSFEVDLEIPVLGEEPFHAVFIRAPYIEEIEPPAEALATFKDKIVMVRQGN
FT                   LLATAFHPELTKDLRVHSYFLKMIG"
FT   gene            11247..12023
FT                   /locus_tag="Moth_0011"
FT   CDS_pept        11247..12023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0011"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18351"
FT                   /db_xref="GOA:Q2RMI8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI8"
FT                   /protein_id="ABC18351.1"
FT                   /translation="MFSNERKQKIIEILLQTPSVRVAELSNLFQVSEVTIRRDLQELEA
FT                   AGLLKRTHGGAVSITTASFEPALVEKEEEHLEEKKAIARAAVDLIAEGDTILLDAGSTT
FT                   LQLARLLKANKKQRLTVVTNALNVAWELAFVETIDLILTGGHLRNRTLSAVGPIADNTL
FT                   QGLYVDKVFLATNSLDVERGLTTPNIYEAQTKQKMVKAGCEIIVLADHSKFGRISLGLI
FT                   CPVTAVDRIITDAGAPAEDLARLKERGVEVIVAGGN"
FT   gene            12177..13103
FT                   /locus_tag="Moth_0012"
FT   CDS_pept        12177..13103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0012"
FT                   /product="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18352"
FT                   /db_xref="GOA:Q2RMI7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI7"
FT                   /protein_id="ABC18352.1"
FT                   /translation="MIATITLNPAIDKSIIISKFTIGKTNRARVDRIDPGGKGINVAKV
FT                   LKQLGCQVITSGFLAGNNGRYIAAYLTEQEIMNDFIVIPGETRQNLKIVDPVKKTITEI
FT                   NEPGAEVDESYLKQLKDKVEELAAQCQVIVFSGSLPPGLPDHTYKQLILLAKERGAQTI
FT                   LDTGGKALWKGLEACPTLIKPNKQEVEELLQMEVGGGRLLDAADHLLALGLDVVVISLG
FT                   AEGALLASGNQKLRAHPPAVEANSTVGAGDAMVAVFAYGLERGLPLAETLRLATAVSAA
FT                   TAAAHGSEVGDIELAKNMLHEVKIQEI"
FT   gene            13155..14543
FT                   /locus_tag="Moth_0013"
FT   CDS_pept        13155..14543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0013"
FT                   /product="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIC component (F1P-forming), Frc family"
FT                   /note="TC 4.A.2.1.1; TC 4.A.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18353"
FT                   /db_xref="GOA:Q2RMI6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI6"
FT                   /protein_id="ABC18353.1"
FT                   /translation="MKKIVAVTSCPTGIAHTYMAAEALQKAAKEQGVAIKVETRGSIGV
FT                   ENELTPADIEEAVAVIIAADAKVDEEKFQGKPIVRSSTGEAIKNAKTLIDKTLSLEGKA
FT                   SSRQITDFIREVEQRKSERRSQATGFYKHLMTGVSYMIPFVVAGGIIIALSFIFGIEAF
FT                   KQEGTLAANLMRIGGGSAFALMVPILAGYIAFSIADRPGLAPGIIGGMLATQMGAGFLG
FT                   GIVAGFLAGYVAKFLRDNIKLPAGLEGLKPVLIIPLISTLIVGLLLIYVIGTPVKVIMD
FT                   GLEHWLTSMSRGNAVILGFILGAMMALDMGGPVNKAAYTFAVGLLGSNIYEPQAAVMAA
FT                   GMTPPLGLALATLLFPKKFTSEEREAGKAAAVLGISFITEGAIPFAASDPFRVIPSIVA
FT                   GSAVAGALSMAFNATLRAPHGGIFVLAIPNAVGHLGLYSLSIAIGTLVTALMVSLLKPN
FT                   KEIK"
FT   gene            14562..15026
FT                   /locus_tag="Moth_0014"
FT   CDS_pept        14562..15026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0014"
FT                   /product="PTS system IIA component, Fru family"
FT                   /note="TC 4.A.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18354"
FT                   /db_xref="GOA:Q2RMI5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI5"
FT                   /protein_id="ABC18354.1"
FT                   /translation="MDIRNLISEDLITLDLKARDKQTAIRELAGLLEKCGLITNEDEFL
FT                   QDVLKREAMTTTGIGYGIAIPHAKSKAVKKSAVVFGRSKLGVEWESLDGQPVDMVFLIA
FT                   TPAEQKENEHLKVLSLLSRKLVYEEFRQRLRDSKTIQEILEILNTVVEGD"
FT   gene            15031..15312
FT                   /locus_tag="Moth_0015"
FT   CDS_pept        15031..15312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0015"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18355"
FT                   /db_xref="GOA:Q2RMI4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI4"
FT                   /protein_id="ABC18355.1"
FT                   /translation="MITKELTITNETGLHARPATLFVQTAQSFKSKIGITKGDRQADAK
FT                   SILAVMGLGITKDTSITIWAEGEDEKEAIEALERLVKSNFREGIEDAS"
FT   gene            15302..17011
FT                   /locus_tag="Moth_0016"
FT   CDS_pept        15302..17011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0016"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18356"
FT                   /db_xref="GOA:Q2RMI3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI3"
FT                   /protein_id="ABC18356.1"
FT                   /translation="MLLKGIAISPGKVIGRAHRLIEHANNYSRSFLTSEVEKEKELARL
FT                   AQAFNQAKEQLASLIDKTKREIGLQEAKIFEAHLLLLSDPLLGEKIRTKIQVEGKDAVW
FT                   AVSEATEEIAQEFASLEDEYFRERAVDIRDIGRRLIACLGNGLEEVSDEATNTIIVAEE
FT                   LTPSQTASFSRRTVAGIITEKGGPTSHTAVVARSLGIPAVSGVTNLLDLVKDGDFVFID
FT                   GNNGVIHLNPDVEEIKNLPTNGQNNWREKRCIRNALAKAITRDGHEIEVATNLRNFEEA
FT                   ELALAYGAEGVGLFRTEFLYMNRQEPPGEEEQFLIYRDVLLALKDKPVIVRTLDIGGDK
FT                   HLPYLEQDKEDNPFLGLRGIRLCLKHKDLFKTQLKALLRASSYGNLKLMFPMVTTLEEI
FT                   RQAKTLLEEAREELQVAGIETSINIPIGIMIEVPAAALMADILASEVDFFSIGTNDLTQ
FT                   YTLAVDRDNEKVAVLYDAYHPAVLKFIYQVVDAAHRKGKWVGLCGELGGDSLAAPLLVG
FT                   LGLDEISMSPVFIPAMKERIRALSYEEGRELVRRLLELPGAKEVREVLVKTS"
FT   gene            complement(17068..17646)
FT                   /locus_tag="Moth_0017"
FT   CDS_pept        complement(17068..17646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0017"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18357"
FT                   /db_xref="GOA:Q2RMI2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI2"
FT                   /protein_id="ABC18357.1"
FT                   /translation="MPDGEKNIASRARGMPPFIVMDILEKAKEMEAINGFSKLYAMTGW
FT                   RLGYVIAPPEFIRPLQKLQQNLFICAGSFVQAAGIAALRECDEHVAQMVATYDERRRYL
FT                   LARLKTMGLATRVEPTGAFYALANVKKYTGDSYSFAFEILEKARVAVTPGIDFGRNCEG
FT                   YLRISYANSLENIKEGLDRLAEFLAGKKA"
FT   gene            17764..18378
FT                   /locus_tag="Moth_0018"
FT   CDS_pept        17764..18378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0018"
FT                   /product="phosphatidyl-N-methylethanolamine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18358"
FT                   /db_xref="GOA:Q2RMI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI1"
FT                   /protein_id="ABC18358.1"
FT                   /translation="MDRELTEIIKKRYNRTALFYDWMDRMIPAGLRRRVWQEARGRVLE
FT                   VGVGTGANFPFYPSGCRVTAIDFSPGMLARARQKLHLARVPVDLREMDVQHLEFDAATF
FT                   DTVVATCVFCTVPDPVRGLQEVCRVCRPEGKIVLLEHVRSEHWLLGPLMDALNPLVLYL
FT                   IGSNINRRTVINVRKAGIIIEREENLAGKIVKLIVGRPGKA"
FT   misc_feature    18512..18762
FT                   /note="T-box leader as predicted by Rfam (RF00230);
FT                   Moth_R0001"
FT   gene            18887..20053
FT                   /locus_tag="Moth_0019"
FT   CDS_pept        18887..20053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0019"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18359"
FT                   /db_xref="GOA:Q2RMI0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMI0"
FT                   /protein_id="ABC18359.1"
FT                   /translation="MTDKQILLLPGPTPVPPQVALAMARPAINHRGPEFKALWAEVTSG
FT                   LKDVFQTRAEVVILTASGTGGMEAAVANLISPGEKVLVVTIGAFGERFVQICRAFNVEA
FT                   EVVAFPYGQAADPEVIAERLAADTGHEIKAILVQHNETSTGVLNDIQAISRARGDHPAL
FT                   LIVDSISGLAAADLPMDAWHIDVVIAGSQKAFMLPPGLTMLAVGERAWQAAEKCSNQRF
FT                   YLDIKKARNSGLKGQTPFTPAVPLLYGLQESLRLLKAETLAGSYARHALMRDMVRAGVR
FT                   ALGLKLLADEAIASPAVTAVCVPEGMKPADIINPLRERFGVVVAGGQGAVKDQVFRIGH
FT                   LGYVSFNAILAGLAALEAVLADAGVPVTRGAAVAAASTILSESEAVDK"
FT   gene            20314..21891
FT                   /locus_tag="Moth_0020"
FT   CDS_pept        20314..21891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0020"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18360"
FT                   /db_xref="GOA:Q2RMH9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH9"
FT                   /protein_id="ABC18360.1"
FT                   /translation="MRVLALDGVDARGLAALREAGLEVTTSGKMEEEELKEAIRDCEAL
FT                   IVRSGTRVTAAAINAAKKLKIIARAGVGTDNIDVAAATERGIVVVNAPEGNTIAAAEHT
FT                   IAMMLALARNIPQASAALKQGRWEKKKFVGVELRGKTLGIIGLGKIGREVARRARGLEM
FT                   KVVAFDPYVDSEQAARLEVELVPLETLLAGADFVTVHLPLTKDTRHLLDREKLGLMKQG
FT                   ARVLNVARGGIIDEGALYEALKAGHLAGAALDVFEEEPLGQSPLLELENVIVTPHLGAS
FT                   TREAQVAVAVEVAGDVIRCLQGEPVLNAVNIPVVRGHLAEVLHPYLQLAEKLGSFLSQL
FT                   MESPILTAEICFNGELAGYDLAPLTSSFLKGLLRPLLAEAVNYVNAPLVAKKRGIRIRE
FT                   KKSPEMEYFANLIGVQVQGRRESHRLAGTVNQAGEPRLVNLDGYSVDTIPAGHLLVIPH
FT                   LDRPRIIGPVALAIGDHGVNIAAMQVGRRERGGQAVMLISVDSEVPRAALDAIRQVDGV
FT                   LDVRYISL"
FT   gene            21982..23265
FT                   /locus_tag="Moth_0021"
FT   CDS_pept        21982..23265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0021"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18361"
FT                   /db_xref="GOA:Q2RMH8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMH8"
FT                   /protein_id="ABC18361.1"
FT                   /translation="MLDIRVVRQDPEGVARGLARRGLAAGLEHFLELDARRRNLLVEVE
FT                   GLKNRRNQVSAEVARLKKSGQDATELIASMREVGERIKELDEKVRAVEEELRQEMLKLP
FT                   NIPHASVPDGLSDADNKPVRHWGELPRFKFEPRPHWEIAENLGIVDFERGGKVAGARFV
FT                   FYRGAGARLERALINFMLDLHTIKHGYTEIFPPYMVNSASMLGTGQLPKFAEDMFHVEG
FT                   TDYYLIPTAEVPVTNLYRGEILPGEKLPIYHVAYSACFRAEAGAAGRDTRGLIRQHQFN
FT                   KVELVKFTRPEDSYEELEKLTRDAEEVLQLLGLPYRVVALCAGDLGFSAAKTYDLEVWM
FT                   PGTACYREISSCSNFEDFQARRADIRFRPGPKEKPRLVHTLNGSGVAVGRTVAAILENY
FT                   QQEDGTVLIPPALKPYMGGLTSIQPEQD"
FT   gene            23270..24733
FT                   /locus_tag="Moth_0022"
FT   CDS_pept        23270..24733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0022"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18362"
FT                   /db_xref="GOA:Q2RMH7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH7"
FT                   /protein_id="ABC18362.1"
FT                   /translation="MDPALHALTDQYWYWSLFFFIYGLSFFLMGFGILIRSRWGSNLSL
FT                   GRRLPSLAVFGLLHGATEWGYIFIPARVVAEGWQTLRGALLTGGHALLLALSYTFLLAF
FT                   GLNLMVDTRNWPGWVRTLPAVFLGGWGLIFFLTFPGGGAATGPWLVSGDVTARYLLAVP
FT                   GSILSALAILAQVEELARLRRRSLRFCLIGSAMALFLYTFAGGLMVPPASFFPANVLNT
FT                   GLLMSLGLPAPVLRILSSVLVAYFIFRLLEVYDAEEQRYRETVREREMIWREREKIRRD
FT                   LHDGVIQSIYGLALGLEHSRNLLADNPAAAADRLKVLTGQAEGIINDLRGYLAGLHLGR
FT                   ELPADPVAIIKEQVINLARGTELEIKWQIKGAAQGGLDSEQRDHLYHMVAEICSNIRRH
FT                   ARASRVRVQVDLGGEGFKVTIKDNGTGLLGTVPDHGQGLINLRQRAALAGGWLEIASSP
FT                   GRGTTVTFWLPYSIGGGREGDGHSRYAGR"
FT   gene            24705..25370
FT                   /locus_tag="Moth_0023"
FT   CDS_pept        24705..25370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0023"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18363"
FT                   /db_xref="GOA:Q2RMH6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH6"
FT                   /protein_id="ABC18363.1"
FT                   /translation="MAIRVMLVDDHALVREGLRALLEREGDIEVVGETGSAAGVLALAE
FT                   ESRPEVVVMDLQLGAGRNGVEATRELVEKKPEIKVVILSMYDDEELVFRALESGARGYV
FT                   LKRAGIEELTTAIRLVARGEAYLDPQIARRVIEGLQERLPFTRASRPEGPELTERELEV
FT                   LRLAAEGLTNAEIARRLVISVKTVQAHRANIMQKLGLHDRVDLVKYAIKNGILKLDSG"
FT   gene            25493..26005
FT                   /locus_tag="Moth_0024"
FT   CDS_pept        25493..26005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18364"
FT                   /db_xref="GOA:Q2RMH5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH5"
FT                   /protein_id="ABC18364.1"
FT                   /translation="MLNLLRDRRLSILWTVVRIWLGWQWLQAGLHKLADPKWMETGVAL
FT                   KGYWTKAVGTPGLIHYGWYKAFLNGLLNSGSHTWFAKFVAVGEFLTGVGLILGALTVVA
FT                   LVAGAFMNLNYMLAGTTSTNPVLYTLAIILLLAGSATYYYGVDRFLFNYLRRERKDTLN
FT                   NPVPAHK"
FT   gene            26136..26227
FT                   /locus_tag="Moth_R0002"
FT                   /note="tRNA-Ser1"
FT   tRNA            26136..26227
FT                   /locus_tag="Moth_R0002"
FT                   /product="tRNA-Ser"
FT   gene            26240..26335
FT                   /locus_tag="Moth_R0003"
FT                   /note="tRNA-Ser2"
FT   tRNA            26240..26335
FT                   /locus_tag="Moth_R0003"
FT                   /product="tRNA-Ser"
FT   gene            26450..26526
FT                   /locus_tag="Moth_R0004"
FT                   /note="tRNA-Arg1"
FT   tRNA            26450..26526
FT                   /locus_tag="Moth_R0004"
FT                   /product="tRNA-Arg"
FT   gene            26539..26615
FT                   /locus_tag="Moth_R0005"
FT                   /note="tRNA-Arg2"
FT   tRNA            26539..26615
FT                   /locus_tag="Moth_R0005"
FT                   /product="tRNA-Arg"
FT   gene            26638..27090
FT                   /locus_tag="Moth_0025"
FT   CDS_pept        26638..27090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0025"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18365"
FT                   /db_xref="GOA:Q2RMH4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH4"
FT                   /protein_id="ABC18365.1"
FT                   /translation="MDHHFYMGEALDEARKAFDLGEVPIGAVIVAGGEIIARAGNRRET
FT                   LADPTAHAEIIALRAAARVRGDWRLTGATLYVTLEPCPMCAGALVQARIRQLVYGAPDL
FT                   RSGAVDSVVNLVENPHFDHQVEVIPGIREEECRELIKKFFQMRRDG"
FT   gene            27077..27168
FT                   /locus_tag="Moth_R0006"
FT                   /note="tRNA-Ser3"
FT   tRNA            27077..27168
FT                   /locus_tag="Moth_R0006"
FT                   /product="tRNA-Ser"
FT   gene            27244..28371
FT                   /locus_tag="Moth_0026"
FT   CDS_pept        27244..28371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0026"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18366"
FT                   /db_xref="GOA:Q2RMH3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH3"
FT                   /protein_id="ABC18366.1"
FT                   /translation="MIRNPRLSPIIKWAGGKEKELRYILPNLPSGVRNYYEPFVGGGAV
FT                   FFAVDRPAMYINDKAPELITLYNMIRENNRDFFQTLEALAWSWERLTMVVRDNGTILED
FT                   IYRKYASEVYSGTQLSRAVAELIKTRGQEFREILAPFINPENFFGEIKRNLLNKITRMK
FT                   KIAARKGALASRDILANLEGAFKSAFYMHCRYLYNHTATFGLGPGTATALFYFIREYCY
FT                   AAMFRYNSRGEFNVPYSGISYNDKDFARKIAYLKSREVREHLGKARIFCLDFEEFLRQT
FT                   APGPEDFIFLDPPYDSDFSAYAGMSFGPADQERLAAYLAGACRARFMLVIKNTPFIYDL
FT                   YRDHGFRIRAFNKRYQVSFQNRNDKSARHLMITNY"
FT   gene            28593..28687
FT                   /locus_tag="Moth_R0007"
FT                   /note="tRNA-Ser4"
FT   tRNA            28593..28687
FT                   /locus_tag="Moth_R0007"
FT                   /product="tRNA-Ser"
FT   gene            28823..28925
FT                   /gene="ffs"
FT                   /locus_tag="Moth_R0008"
FT   ncRNA           28823..28925
FT                   /gene="ffs"
FT                   /locus_tag="Moth_R0008"
FT                   /product="4.5S RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            29099..30868
FT                   /locus_tag="Moth_0027"
FT   CDS_pept        29099..30868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0027"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18367"
FT                   /db_xref="GOA:Q2RMH2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMH2"
FT                   /protein_id="ABC18367.1"
FT                   /translation="MAQYQALYRQWRPRTFAEVVGQEHITRTLRNALRTGRLVHAYLFC
FT                   GPRGTGKTSTAKILARAINCLAPREGEPCNECANCRRILAGNSLDVLEMDAASNRGIDE
FT                   IRNLIEKIPLGPVEGRYKVYIIDEVHMLTQEAFNALLKTLEEPPAHAVFILATTEPRKV
FT                   LPTILSRCQRFDFHPLTVQAIAGRLQEVAAANGVEIEPGALSLLSRKAAGGLRDALSLL
FT                   DQILASGTRGPVTAGQVAVTLGTARLDTLLALTDALATGDGAGVLNLVDKALASGIEPR
FT                   RLLEDLLDHTRNLLLLKVDPGAGSLTGLLPEEVEQVAAQARQFDHHRLLDLMERLQQGG
FT                   AALRRSNQPRVILEMTLAGFLVAPGPSLEGLARRVAELEARLAALEGSAPSRTREKVAT
FT                   RNQGEGGRPPVAPGSRADAGGQERGNSGPLEAPGAGSPAGRARVINRSREFPQAAGRDR
FT                   AGLAGPETATGLEPGSPASPGLELAVVQEHWPEVLAAARRESIQLQAFLREGEPVAIDG
FT                   DTLTLAVKADFHRGMLEQPGNRQKVEKALAAVFGRPLKVVITSGKPSPPGDTGDTLTRL
FT                   VNFFGADKVEIKD"
FT   gene            30893..31207
FT                   /locus_tag="Moth_0028"
FT   CDS_pept        30893..31207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18368"
FT                   /db_xref="GOA:Q2RMH1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMH1"
FT                   /protein_id="ABC18368.1"
FT                   /translation="MGMGNMNKMMKQMQKMQAQVARLQEELGERTVEASAGGGVVKVTA
FT                   NGRQELVNIKIDPAAVDPEDVEMLQDLILAAVNEALHQSQEMVTREMAKITGNIRLPGF
FT                   "
FT   gene            31211..31810
FT                   /locus_tag="Moth_0029"
FT   CDS_pept        31211..31810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0029"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18369"
FT                   /db_xref="GOA:Q2RMH0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMH0"
FT                   /protein_id="ABC18369.1"
FT                   /translation="MYYPEPLNKLITALGRLPGIGPKTAQRLAFHLLKVPASEARDLAA
FT                   AILEARQKTIYCSICGNFTDRDPCRLCSDPERDHSCICVVEEARDIIALEKTRQYRGLY
FT                   HVLQGAISPVDGIGPEQLRVKELLARLHDGKVKEVILATNADVEGESTALYLDKLLKTL
FT                   GVKVTRLAYGLPVGGDLEYADEVTLARAFAGRHELE"
FT   gene            31896..32114
FT                   /locus_tag="Moth_0030"
FT   CDS_pept        31896..32114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18370"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG9"
FT                   /protein_id="ABC18370.1"
FT                   /translation="MELGPREELEKMAEAIREAREEWLAAQRFFAEVTEPDLVDQAIYR
FT                   LEAAERRYMYLWKVVRNRGQALHNFDL"
FT   gene            32127..32402
FT                   /locus_tag="Moth_0031"
FT   CDS_pept        32127..32402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0031"
FT                   /product="SigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18371"
FT                   /db_xref="GOA:Q2RMG8"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG8"
FT                   /protein_id="ABC18371.1"
FT                   /translation="MAGDTIQLLFAALFLLFLIYLLGSIFLKPLKLVLKIIINSFFGLL
FT                   ILWAFNFFGAYFHFFIPLNWLTVLIAGFLGLPGLVLLIFLRLVLGA"
FT   gene            32710..33186
FT                   /locus_tag="Moth_0032"
FT   CDS_pept        32710..33186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18372"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG7"
FT                   /protein_id="ABC18372.1"
FT                   /translation="MGWETGQVTGWGEAGTVLYPAVRWALRREGSVIIDVGYGVAGART
FT                   LHLLEDVEENPDLRVLAVINTTRPATATVPAIIDHVRSLGRVDGLINNTHLGDETTAAL
FT                   VQEGAGMVTTAARELGIPVVATAVVEELAFFLGERDREGNPVRVLHRYMPRAFW"
FT   gene            33358..34449
FT                   /locus_tag="Moth_0033"
FT   CDS_pept        33358..34449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0033"
FT                   /product="Pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18373"
FT                   /db_xref="GOA:Q2RMG6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG6"
FT                   /protein_id="ABC18373.1"
FT                   /translation="MAAKPIEGEQRAFMTGNEVVAWAALAAGADIMYGYPITPQNEIMH
FT                   YWTRMAPRYDRGFLQTEDEISAGFTTVGGVLAGKRAFTATAGPGNVLMQEAMSMAEMMR
FT                   LPTVVVVTQRGGPSTATVIYSQQELNLTCFGGNGEGLRIVYSTSSHQDLFNYTIKAFNT
FT                   AWKYRFPTFVLGDGYQSKMREPVTIYDPATRGIVMEECRPMVGLPGIAGIDREPAHLRN
FT                   TYNLEDELYDRLSASIKDYQAMLPEVVEWEAYAVDDAEFLVIAHGVVSRAARAAVDSLR
FT                   EAGIKAGYFRPITLRPFPEEALQPLAARAQRILVVESAHGQLERQVRASLYGLETPVSG
FT                   YLRPGMGITPEEIIGAVQQTIRS"
FT   gene            34454..35248
FT                   /locus_tag="Moth_0034"
FT   CDS_pept        34454..35248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0034"
FT                   /product="2-oxoglutarate synthase"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18374"
FT                   /db_xref="GOA:Q2RMG5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG5"
FT                   /protein_id="ABC18374.1"
FT                   /translation="MALAAQPQMPRVWRAETKPHKFCPGCGHGIILKALGEAIDALNIQ
FT                   ERTIFGCDIGCSLLSWDFFNLDTIQTHHGRTTPVLVGMKRVRPELVVVSYMGDGGAYAI
FT                   GAQHLVSSAVRNDLVTIIVVNNTQYGMTGGQMAPTTLPGQKTETTPYGRDVKLTGRPML
FT                   GPELVAAVAPPGAYVARGSIANVVQLKNFIQKGLLNQIEGRGIAFIEALSACPTNWRTN
FT                   AAETWRFIEKEMAAYFPTGELRTPGEVKNGQVGEGTPDAPEH"
FT   gene            35232..35804
FT                   /locus_tag="Moth_0035"
FT   CDS_pept        35232..35804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0035"
FT                   /product="2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18375"
FT                   /db_xref="GOA:Q2RMG4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG4"
FT                   /protein_id="ABC18375.1"
FT                   /translation="MPLNIKIALAGEGGQGVQSIAEILTEAAYRAGHQALYIPNFGVEQ
FT                   RGGVSVAFVQVSEQPVSAPKFTTGDIVVALSYRAVERVKQYTGAATTLVYDASLEDEVR
FT                   KVYGDKPGKLAVPALEIAQKEMHPRVFNVIILGVLVGLTGFLKQQEVKEALERQLGHKF
FT                   AQDPSLRDLNYRALERGYQLVSRREAQ"
FT   gene            35801..36094
FT                   /locus_tag="Moth_0036"
FT   CDS_pept        35801..36094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0036"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18376"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG3"
FT                   /protein_id="ABC18376.1"
FT                   /translation="MSVAFKAITTENGKGIFHLFPALCKGCGLCIEKCPVDTIGWAKQL
FT                   GAFGTPVVEPGHGKPCIACKKCQLVCPDAAIWIERRNGKDRSDSLTSLPERH"
FT   gene            36529..37916
FT                   /pseudo
FT                   /locus_tag="Moth_0037"
FT   gene            37930..39288
FT                   /locus_tag="Moth_0038"
FT   CDS_pept        37930..39288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0038"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18377"
FT                   /db_xref="GOA:Q2RMG2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG2"
FT                   /protein_id="ABC18377.1"
FT                   /translation="MRREIIANLEKIVGRENCQVEEAVRRQHGFSKTALPEAVLYPQDS
FT                   QQVAAILKVAAAEGIPVVPWGAGTMARRGLLPLNGGLAINLTAMNKILEYDYENMTAFV
FT                   EAGVTLKDLQATLKTHNLYWPVEPVDGDTSTVGGCVAAGASGPSKLGYGDAKFHILGLE
FT                   VVLSTGEIIRTGGKTVKNVQDYDNTRFIAGSWGSLGIITRVMLKLRPLPEKEITVFLSF
FT                   KELEAAIEAARIIRSDTLPTALELMDGVAMKILARAGYRPNGEGPGILANFNGFTEQVD
FT                   AQADYLQGKFKGTLILEGEAAAGAWQARRQIWPTFAGEGGAILASAAVPFTALGEFLKG
FT                   ARAELDRSRKGAAMVAHFGNGHIHILLDQAPEAFNGVRGVVDQLSARAENLGGFLVVDN
FT                   IDDLEFTRRRVEARGRAIFELLGRVKAAFDPRGIMAPNSKVLAYVLVDNRAAS"
FT   gene            39307..40602
FT                   /locus_tag="Moth_0039"
FT   CDS_pept        39307..40602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18378"
FT                   /db_xref="GOA:Q2RMG1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG1"
FT                   /protein_id="ABC18378.1"
FT                   /translation="MVKTFRQREEDIVRCNRCGFCEEVCPTYKATGEEFSLARGRNRLM
FT                   RQSMEGKLDLTKEPEINQHIYSCLLCGACVAACPSSVITDTLIKTARAEITRAKGQPFP
FT                   IRMALRGVLANQRRLTLGAKVLRFYQRSGARWLARHIGFLNLMGSLGKAEGLLPAIPEK
FT                   TLRVQLPQLLKKPMKPRHKVAYFAGCMINNFFTAVGEATLRVYQENDIEVVVPTSNCCG
FT                   IPHEAYGDIEMQIKLAKENLDAFSRYEVEAIVTDCASCAHGLHSYAELLQDDPHYGPLA
FT                   AQLAAKVKDASQYLVEIGFKKEMGPVNATVTYHDPCHAARGLKVKEQPREILKSIPGVK
FT                   FVEMNESDWCCGGAGSYNVTHYELSRKILARKMDNFKKTGAEYLATSCPACLMQLAHGL
FT                   DVYRLSGKAIHVMQILDQAYQNRAVRSKAKAG"
FT   gene            40737..41513
FT                   /locus_tag="Moth_0040"
FT   CDS_pept        40737..41513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0040"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18379"
FT                   /db_xref="GOA:Q2RMG0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMG0"
FT                   /protein_id="ABC18379.1"
FT                   /translation="MILLWHRRRISNFLIPVLLFFLGLMLGAWLADCQPLAALVGRTNR
FT                   LLPIYSVGTTEKKVALSFDATWGAEYTPKLLATLKQHGVKTTFFLTNIWLKKYPDVARQ
FT                   IAADGHEIGLHSASHPHFTALSPAEMEKELQENSRMVTEVTGYKAELFRPPFGDYNDTV
FT                   IRTVERLGYRAIQWDVDSLDWQEQMTATDIYNRVVKGIKPGSIVLFHNNGRYTADVLGP
FT                   LLDKLKADGYQVVPVGQLILKGDYYVDHAGVQRAGR"
FT   sig_peptide     40737..40850
FT                   /locus_tag="Moth_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.592 at
FT                   residue 38"
FT   gene            41660..43069
FT                   /locus_tag="Moth_0041"
FT   CDS_pept        41660..43069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0041"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18380"
FT                   /db_xref="GOA:Q2RMF9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF9"
FT                   /protein_id="ABC18380.1"
FT                   /translation="MKTQGQAPLWEALLNYRQQGLNSWHTPGHKDGAYTLPLWRDFLGA
FT                   ALALDLTEVPGLDNLACPGGAIAAAQERAARFYGAARTFFLVNGASAGLMAVILATCRP
FT                   GDEVLLPRYAHRAVFNGLILSGARPVYLATEWLASPGLPLGVAPESLAGTLREHPGARL
FT                   LLLVHPTYEGVVPRSEELIALAHAHGVAVLADAAHGAHFGLAPGLPPSPLDLGADFVVQ
FT                   SSHKTLAALTQAAMLHLREEAAAARVAAALNLLQTTSPSYLLLASLDTARLLAEERGRQ
FT                   DWGLTVARATAARARLDRAGLPPLAMADVTGPAASGLDVTRLLLPTAPLGRRGTEVAAT
FT                   LRRAGQEVELAGEDYIVVIITPGDGEEKIEALVTALLALPRSDSRQPAALAPAPPVRIP
FT                   ETALTPREAWLAPRRELPLGEATGKIAAELISPCPPGLALTVPGEVLTPEVLERLRDLR
FT                   GPSGRVLVVDG"
FT   gene            43166..43789
FT                   /locus_tag="Moth_0042"
FT   CDS_pept        43166..43789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0042"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18381"
FT                   /db_xref="GOA:Q2RMF8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF8"
FT                   /protein_id="ABC18381.1"
FT                   /translation="MGRGLFITLEGPDGSGKTTQMDRLEEYLHRRGLAVERTREPGGTL
FT                   LSEAIRRLLLEPSYSPVDARAELFLYAAARAQHVAERIRPALAAGKIVLCDRFSDSTLA
FT                   YQGYGRQLGAELVERLNDLATGNLRPDITFLIDVPVAIGLGRHSGGSDRLEQEDLEFHR
FT                   RVRQGYLDLARREPRRVHLIDGTPSPDVVWEEIKEILDARLERL"
FT   gene            43942..44796
FT                   /locus_tag="Moth_0043"
FT   CDS_pept        43942..44796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0043"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18382"
FT                   /db_xref="GOA:Q2RMF7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF7"
FT                   /protein_id="ABC18382.1"
FT                   /translation="MTAHQQLKQALLAGKLAHAYLLVGGSEEGRRAEAIYLATALNCRY
FT                   LQGGEPCGSCHSCRQMAGGNHPDFYLLEPRGTNLKIAQIRELEARLALQAFQGGVKVAV
FT                   LAGADTMTEAAANCLLKTLEEPPEGTYLILLAAQPDPLLPTIRSRCQEIHLEGAMAISQ
FT                   AGTGYWARLVAADLPVIMEEILPELEKEADLPAVLTGMALACRDQLVWQLTGSATLLLK
FT                   PGEPPTPFLAPSRLWACFWTIQDTLAALEHNANHRLALEVMMFKLYTQFSGEAIHGGEP
FT                   SPA"
FT   gene            44932..45651
FT                   /locus_tag="Moth_0044"
FT   CDS_pept        44932..45651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0044"
FT                   /product="Signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18383"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF6"
FT                   /protein_id="ABC18383.1"
FT                   /translation="MIVETARGLELGEVVIAPRQVEETEVVQPLRPVLRPATQADLEQV
FT                   AVNRQKEKDAFAICQQKIQEHGLPMKLIDVEFTFDVSKIIFYFTAEGRVDFRELVKDLA
FT                   AIFRTRIELRQIGVRDEAKMLGGLGCCGRPICCATFMGDFDPVSIRMAKEQNLSLNPTK
FT                   ISGLCGRLMCCLRYENDAYEDARHRLPRCGAMVRTPAGCGRVTGINILKERVTVEIPEQ
FT                   GSMEFPLEAIEGECHEH"
FT   gene            45641..45958
FT                   /locus_tag="Moth_0045"
FT   CDS_pept        45641..45958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18384"
FT                   /db_xref="GOA:Q2RMF5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF5"
FT                   /protein_id="ABC18384.1"
FT                   /translation="MSTNLPEDTGGMLTVALAGLEGQLNEVLKETRRLRARVAALEEEN
FT                   QRLRAMILAAGEGESGRQQLVRLYNEGYHVCPPHFARVRGNEGCLFCQSFLEKKGLLPD
FT                   G"
FT   gene            45951..46874
FT                   /locus_tag="Moth_0046"
FT   CDS_pept        45951..46874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0046"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18385"
FT                   /db_xref="GOA:Q2RMF4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF4"
FT                   /protein_id="ABC18385.1"
FT                   /translation="MASLYLVGTPIGNLEDITFRALRVLKEVDLIAAEDTRHTRELLTH
FT                   YGIHTPLTSYHRHNLASKTPYLLGLLREGKDIALVSDAGLPGISDPGEELVRATVAAGL
FT                   PVVPVPGANAALTALVASGLPAGRFAFEGFLPRAGKERRERLAALVGEERTLIFYEAPH
FT                   RLTATLDDLAATLGPRQVAIGRELTKKFETIWRGTLPEAREYFRDNPPRGELTLVVAGA
FT                   PPAPRPAYDPARAAAEVADLEASGLDRKEAMARVARIYGQSRREIYRACLQAREGGQGG
FT                   SGGLGEPATARGGSLPGDKAVSPSGD"
FT   gene            complement(46918..47175)
FT                   /locus_tag="Moth_0047"
FT   CDS_pept        complement(46918..47175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0047"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18386"
FT                   /db_xref="GOA:Q2RMF3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF3"
FT                   /protein_id="ABC18386.1"
FT                   /translation="MIKSTGIVRKVDELGRVVIPIELRRTLGIDERDALEIYVDHEKII
FT                   LKKYEPACVFCGNAEDIVNFHGKNVCRECLEAMSQQAKAV"
FT   gene            47363..49318
FT                   /locus_tag="Moth_0048"
FT   CDS_pept        47363..49318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0048"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18387"
FT                   /db_xref="GOA:Q2RMF2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF2"
FT                   /protein_id="ABC18387.1"
FT                   /translation="MGDKVFYVTTPIYYPSDKLHIGHALTTTMADTLARYKRLRGYDVY
FT                   FLTGSDEHGQKIQRKAREANLEPIQYVDRIVATFQELWRRLNISYNDFIRTTEPRHARV
FT                   VQALLQKIYDQGDIYKSTYEGWYCTPCETFWTERQLVDGNCPDCGRPVELVKEESYFFR
FT                   MSKYADRLLQYIKDHPDFIQPVTRRNEMISFIEGGLEDLCISRTTFDWGIPVPMDPKHV
FT                   IYVWFDALTNYISALGYGTADDHLFRKYWPAAVHLVGKDIVRFHTIIWPIILMAAGIEP
FT                   PRQVFGHGWLLVDGGKMSKSRGNVVDPMILIDRYGSDAIRYFLLREMPYGADGYYSEEA
FT                   LINRYNTDLANDFGNLLSRTTAMIEKFNGGVIDPPSAPEPLDEELKNLAAGIPDEVDNA
FT                   LNHYEFARALAAIWRLVNRANKYIEETAPWALARDPGQKQRLQTVLYNLAEAVRQATIM
FT                   VGPFMPGVPDRVWDQLGLKDVPAALTWESLATWGGIPAGTRVRRGEALFPRIDLKEGEI
FT                   PVAEKATEPVKVAEAAPAGGAVARPGEEEITIEEFARIKLRVALVLEAEKVANADKLLK
FT                   LRVRVGNEERTIVAGIARYYQPEELVGKKVVIVANLKPARLRGIVSQGMVLAAVDDESL
FT                   SLVTPERAIKDGAQVR"
FT   gene            49319..50089
FT                   /locus_tag="Moth_0049"
FT   CDS_pept        49319..50089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0049"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18388"
FT                   /db_xref="GOA:Q2RMF1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF1"
FT                   /protein_id="ABC18388.1"
FT                   /translation="MVELIDSHAHLNDPAFAGDLDQVMARLEQAGVVGLVNAGYDVPSS
FT                   RLAVEQAHSRGYIYAAVAVHPHDALNFDEEAAAIIRGLARDSRVVAIGETGLDYYRNLS
FT                   PRRRQQEVFRWHLDLARSLRLPVIIHDRDAHEDTLRILQQAAPYPAGGVLHCFSGSWEM
FT                   ARQCLDLGFYISFAGPVTFKNAVKPRAVAARIPLERLLIETDCPYLTPEPHRGQRNEPA
FT                   YVGLVAAALASARGQTVEEITAATTANARKLFGI"
FT   gene            50335..51303
FT                   /locus_tag="Moth_0050"
FT   CDS_pept        50335..51303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18389"
FT                   /db_xref="GOA:Q2RMF0"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMF0"
FT                   /protein_id="ABC18389.1"
FT                   /translation="MFLLRQPSAGRGRKLVLLACLVAGLQSLFLVGWTSKKVDIYADGQ
FT                   ARQVTVNQWLVGDFQSRSQENLRIGDWILPLPGGWFWPGLKLFMARGTPVAAEVAGQNI
FT                   WPREPASVASELLNREGITLGPGDRVETNLGSEDPHQYIRVIRVEDSIEVQQQPVDPPV
FT                   VRRPDRYLPPGQEKVVQEGQPGVRYYKYQVRKENGVEVERRLVDTWVEIQPSPKIVAYS
FT                   SRAYPEVTARAGDTLMVIATAYTHTGNRTATGIWPYRGVVAVDPRVIPLGTRLYVEGYG
FT                   YAVAQDTGGLIKGKRIDLFMDSAGEAMRWGRRQVTVRILGD"
FT   sig_peptide     50335..50463
FT                   /locus_tag="Moth_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.708) with cleavage site probability 0.370 at
FT                   residue 43"
FT   gene            51538..52425
FT                   /locus_tag="Moth_0051"
FT   CDS_pept        51538..52425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18390"
FT                   /db_xref="GOA:Q2RME9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME9"
FT                   /protein_id="ABC18390.1"
FT                   /translation="MSYTWKKVTLEVDGQRIATRTFAPTVGEFLSQQHITLGAEDAVTP
FT                   ALDAPVTRDIVITIKRAVPVKINADGREKEILTPPDTVANVLNKAGVTLNPADRVIPDL
FT                   NATIAAGDTIKVIRVTVKTETVSKEINYRVERRPEPQLEKGITRLLQEGVKGLQEETYR
FT                   VILEDGQEVKRELVSTKTLKEPVPEIVAVGAMDTASRGGQSFRFERVFWATATAYTHSG
FT                   APTATGAYPRVGTIAVDPAVVPLGTRLYVEGYGYGIAQDIGSAIKGDRIDVFLDTEADT
FT                   RRWGVRRVKVYVLR"
FT   gene            52537..53403
FT                   /locus_tag="Moth_0052"
FT   CDS_pept        52537..53403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0052"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18391"
FT                   /db_xref="GOA:Q2RME8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RME8"
FT                   /protein_id="ABC18391.1"
FT                   /translation="MDSVATPGRTLALVREKGLVPRKSRGQNFLVDANIVRKIARAAEV
FT                   GPGDTVVEIGPGLGALTQELAARAGLVIAIEIDRELFAALEETLAGRDNVRLVAGDALK
FT                   VDFDRLVAGILGTGEGRLPTYKVVANLPYYITTPILMHLLTSRFRIAELVLMVQAEVGY
FT                   RMLARPGGKDYGALSVVVQYYTEPAVVLKVPRTVFYPRPEVDSLVLKLTCRTRPVVQVE
FT                   DEDFFFRVVRAAFNQRRKTILNALGSLGFEKSKIMEALAGAGIDPRRRGETLGMEEFAS
FT                   ISRTLQH"
FT   gene            53415..53900
FT                   /locus_tag="Moth_0053"
FT   CDS_pept        53415..53900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0053"
FT                   /product="Protein of unknown function DUF458"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18392"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME7"
FT                   /protein_id="ABC18392.1"
FT                   /translation="MEPVYFTSPTRGRLTEDEMFADMMQFVDANPEAQYKIIIGSDSQA
FT                   RVRTCFVTAVIVHQVGRGARYYYRKKYQRKITSLRQKIFYETALSLETASFIAQRLAAN
FT                   GHADLNVEIHLDIGPNGETRDLIREIVGMVVGSGFAAKIKPYSCGASKVADKYTKSG"
FT   gene            complement(54141..54926)
FT                   /locus_tag="Moth_0054"
FT   CDS_pept        complement(54141..54926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0054"
FT                   /product="Cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18393"
FT                   /db_xref="GOA:Q2RME6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME6"
FT                   /protein_id="ABC18393.1"
FT                   /translation="MAIKRKDHTRWRLFLLVTFLLTGLLAFAGTAAAATYTVQPGDTLY
FT                   LIGQRYGISAWDLQKANNLDSTWIYPGQTLWVPDGGGNTYVVQPGDTLFFIGQRYGVTA
FT                   DQIMAANGLSSDIIYPGQTLRIPNGTRTATASRGTSYGYSSSDLDLLAHLVYGEARGEP
FT                   YAGQVAVAAVAINRTRDGRFPSTIAGVIYDVDAFTSVNDGQFYLTPDATAYQAAREALR
FT                   GYDPSGGALYFWNPAEVPADSWVWTRTIITTIGNHVFAR"
FT   sig_peptide     complement(54825..54926)
FT                   /locus_tag="Moth_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            complement(55010..55849)
FT                   /locus_tag="Moth_0055"
FT   CDS_pept        complement(55010..55849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0055"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18394"
FT                   /db_xref="GOA:Q2RME5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME5"
FT                   /protein_id="ABC18394.1"
FT                   /translation="MFAAVIPACNEAGRLVRVIKNLWALPLDLFIPVLNGCRDATLAEV
FT                   LNFTGSRAKIIYFPEALGPDVPRAIGTLYALDQGARGLLYVDGDMVGNFNREAALLLEA
FT                   LERNVDLALCNCYPEVKPRHPLAGAVLYYRGLLNQELGLWSDIGYATPSHGPHAISRRL
FT                   LLQIPLADLAVPPLTLVHATRTGCNVSVAVTLDHIYLGSRQRLDPHAETMAVTLIGDCI
FT                   QAIKTARGETPDRSTAGCNYLGYDHARRRDILVRVLSGQRPLMIMSSFHNAPSLATI"
FT   gene            56019..56894
FT                   /locus_tag="Moth_0056"
FT   CDS_pept        56019..56894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18395"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME4"
FT                   /protein_id="ABC18395.1"
FT                   /translation="MARKSYGKDIFFKVKALTITDKGTTTAILRGLDVRLVADAPLDDL
FT                   ELQPAEEVLRYRHDDIQRHNLCIRRILQRRAVEKEALFTRSEEATAREKSADRQATPEN
FT                   FFEVPGRVLHLDGDEEYLDKCLHAYEQLKLPAHGVYVPEEQQANKVKDLLQEYTPDILV
FT                   LTGHDGLLRERSNFSDLDSYRHSKHFLAAVKAARALRPGHDDLVIFAGACQSHYEALLK
FT                   AGATFASSPLRVLIHAYDPVFVVERVAYTSIEKTLAPAEIIKDTITGNEGVGGVEIKGK
FT                   LRLGYPSSPY"
FT   gene            57038..57313
FT                   /locus_tag="Moth_0057"
FT   CDS_pept        57038..57313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0057"
FT                   /product="Protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18396"
FT                   /db_xref="GOA:Q2RME3"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME3"
FT                   /protein_id="ABC18396.1"
FT                   /translation="MNGKEVLATIREDLEARVGQKVKLRANRGRKKILERTGVLEKTYP
FT                   NIFVIRLEEQKSPERRISFSYTDVLTNTVELMVEGDYGDKKLGAKP"
FT   gene            57432..58235
FT                   /locus_tag="Moth_0058"
FT   CDS_pept        57432..58235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0058"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18397"
FT                   /db_xref="GOA:Q2RME2"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME2"
FT                   /protein_id="ABC18397.1"
FT                   /translation="MVVCVKQVPDTAEVRINPRTNTLVRAGVPAIINPYDAHAVEAAVQ
FT                   LKEKYGGQVTALSMGPPQAEEVLRRALGMGADRAILLSDRAFAGSDTLATSYILAAAIR
FT                   AIGRETPVDLVFCGKQAIDGDTAQVGPGIATRLGFTQLTYVMAIDGVDLEKGQIQVQRK
FT                   LEGKREVIRGRLPALLTVVKDLNELRYASLPALIRAARATITTWSKDDLDLDPASIGLK
FT                   GSPTSVRRIFAPPARPGGELIPGDPRQAAAILVAKLVQTKIIADK"
FT   gene            58252..59277
FT                   /locus_tag="Moth_0059"
FT   CDS_pept        58252..59277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0059"
FT                   /product="Electron transfer flavoprotein alpha and
FT                   beta-subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18398"
FT                   /db_xref="GOA:Q2RME1"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME1"
FT                   /protein_id="ABC18398.1"
FT                   /translation="MTTVSNAEYRGVWVFIEQVAGEPAPVSWELLGAGRQLADALGVEL
FT                   AGVLLGQGVAGLVSEAWAYGADRVYLVEDPVLGPYRTAPYARALVELVQRYRPEILLLG
FT                   ATSLGRDLSGAVATALGTGLTADCTGLNIDPATRLLEQTRPAFGGNVMATILCQRHRPQ
FT                   MATVRPRVMPLPPRQEGRQGELVRVGIALKEEEALATVLKVIEEKGKAIYLDRAEIIVA
FT                   GGRGLGSRENLRLLEELAGVLGGTLGASRAAVEAGWLPPEYQVGQTGITVRPKVYFAIG
FT                   ISGAIQHLVGMQNSEVIVAINKDPEAPIFKVATYGIIGDFQEVVPALTEEFRRQLAARS
FT                   A"
FT   gene            59328..60626
FT                   /locus_tag="Moth_0060"
FT   CDS_pept        59328..60626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0060"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18399"
FT                   /db_xref="GOA:Q2RME0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RME0"
FT                   /protein_id="ABC18399.1"
FT                   /translation="MAERFEVVVVGAGPAGLAAALTLARAGVEVIVFERGEHPGSKNVM
FT                   GGVLYRHPTETVVPGFYHQAPLERPVVEQRLWLLTEEAALTLGYKDMVFAGEPFNAFTV
FT                   LRARFDRWLADQAVAAGALLINETVVEDLLWENERVVGVRTGREGGDVRAEVVILAEGA
FT                   NSLLTQKAGLKPDGINTNQLAVAVKEIIALPREKIEDRFNLEEGQGCTIELLGEATKGM
FT                   LGTAFIYTNKDSLSVGVGVLLASLVRRRLNPNDLLEHLKSHPMVRPLLAGGESKEYQGH
FT                   LIPEGGYQAVPKLYGNGVLVVGDAAMLVNGIHREGSNLALTSGLLAARTILAAREKGDY
FT                   SEANLAPYRQALEESFVLKDLKKYQRAPFFFDQNPQFFTLYPGLLSRAAREFLTVDNVP
FT                   KREKQKRILREITTSRSRFQIARDLYNLWRVMG"
FT   sig_peptide     59328..59408
FT                   /locus_tag="Moth_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.678) with cleavage site probability 0.580 at
FT                   residue 27"
FT   gene            60626..60904
FT                   /locus_tag="Moth_0061"
FT   CDS_pept        60626..60904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0061"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18400"
FT                   /db_xref="GOA:Q2RMD9"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD9"
FT                   /protein_id="ABC18400.1"
FT                   /translation="MRLEDKLFLNRYQTDKHPHLRIKDREVCRHCEGKPCTFICPARVY
FT                   VWNEREERIETAYEGCVECGTCRYGCAHDNIDWRYPRGGFGILYKYG"
FT   gene            61051..61479
FT                   /locus_tag="Moth_0062"
FT   CDS_pept        61051..61479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0062"
FT                   /product="Ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18401"
FT                   /db_xref="GOA:Q2RMD8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD8"
FT                   /protein_id="ABC18401.1"
FT                   /translation="MTIDQIINLLNLDLSWEYAAMIQYIQHASLLTGPEYFAIIDEELQ
FT                   HAQDEHEHAVRLTDKIQYLGGFPTVNVQEIKTSLSNVEMLRQDLQAEYDALHRYLQRIE
FT                   QLEALKLYDVAQVIREIALVEQGHIIDLEKSLGIQKVR"
FT   gene            61613..62551
FT                   /locus_tag="Moth_0063"
FT   CDS_pept        61613..62551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0063"
FT                   /product="Glycoside hydrolase, family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18402"
FT                   /db_xref="GOA:Q2RMD7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD7"
FT                   /protein_id="ABC18402.1"
FT                   /translation="MALQERQLENNWYYVPDPSGLASLRSYGGLLRYVLPFWFGVTENG
FT                   GLVDQADTGGLAAIRRYNLPVLAIVHNYSSPQYGPLIHRLLTTEGLRQALVQNILNLMY
FT                   RWDFAGVNIDFEFVPPEDRPYLTSFLNQLGQTLKGAGFLTTISVPAELRDNPRHPFSGA
FT                   FSYPNLAAASDQVYILAYDEHFATPGPIASTSFIRQVLDYAVTVIPREKIRLGMAVYGY
FT                   DWAEGARVPVTLSHSQVLDLARRVGASIYYDPNAQESTFTYVEDNTPHVVWFEDVRSFS
FT                   VRLGLVREYNLPGIAVWRLGLEDQRIWELRG"
FT   gene            complement(62680..66195)
FT                   /locus_tag="Moth_0064"
FT   CDS_pept        complement(62680..66195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0064"
FT                   /product="Pyruvate:ferredoxin (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18403"
FT                   /db_xref="GOA:Q2RMD6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="PDB:6CIN"
FT                   /db_xref="PDB:6CIO"
FT                   /db_xref="PDB:6CIP"
FT                   /db_xref="PDB:6CIQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMD6"
FT                   /protein_id="ABC18403.1"
FT                   /translation="MPKQTLDGNTAAAHVAYAMSEVATIYPITPSSPMAEIADEWAAHG
FT                   RKNIFGKTLQVAEMQSEAGAAGAVHGSLAAGALTTTFTASQGLLLMIPNMYKIAGELLP
FT                   CVFHVAARALSTHALSIFGDHADVMAARQTGFAMLSSASVQEVMDLALVAHLATLKARV
FT                   PFVHFFDGFRTSHEVQKIDVIEYEDMAKLVDWDAIRAFRQRALNPEHPHQRGTAQNPDI
FT                   YFQSREAANPYYLATPGIVAQVMEQVAGLTGRHYHLFDYAGAPDAERVIVSMGSSCEVI
FT                   EETVNYLVEKGEKVGLIKVRLFRPFSAEHFLKVLPASVKRIAVLDRTKEPGSLGEPLYE
FT                   DVQTVLAEHGKNILVVGGRYGLGSKEFNPSMVKAVFDNLAATTPKNKFTVGITDDVTHT
FT                   SLEIKEHIDTSPKGTFRCKFFGLGSDGTVGANKNSIKIIGDHTDMYAQGYFVYDSKKSG
FT                   GVTISHLRFGKQPIQSAYLIDQADLIACHNPSYVGRYNLLEGIKPGGIFLLNSTWSAEE
FT                   MDSRLPADMKRTIATKKLKFYNIDAVKIAQEIGLGSRINVIMQTAFFKIANVIPVDEAI
FT                   KYIKDSIVKTYGKKGDKILNMNFAAVDRALEALEEIKYPASWADAVDEAAATVTEEPEF
FT                   IQKVLRPINALKGDELPVSTFTPDGVFPVGTTKYEKRGIAVNIPQWQPENCIQCNQCSL
FT                   VCPHAAIRPYLAKPADLAGAPETFVTKDAIGKEAAGLKFRIQVSPLDCTGCGNCADVCP
FT                   AKVKALTMVPLEEVTAVEEANYNFAEQLPEVKVNFNPATVKGSQFRQPLLEFSGACAGC
FT                   GETPYVKLVTQLFGDRMIIANATGCSSIWGGSAPACPYTVNRQGHGPAWASSLFEDNAE
FT                   FGYGMALAVAKRQDELATAISKALEAPVSAAFKAACEGWLAGKDDADRSREYGDRIKAL
FT                   LPGEISQASGEVKDLLLDIDRQKDYLTKKSIWIIGGDGWAYDIGYGGLDHVLASGANVN
FT                   VLVLDTEVYSNTGGQSSKATQTGAVARFAAGGKFTKKKDLGLMAMSYGYVYVASVAMGA
FT                   SHSQLMKALIEAEKYDGPSLIIAYAPCINHGINMTYSQREAKKAVEAGYWPLYRYNPQL
FT                   AQEGKNPFILDYKTPTASFRDFLMGEIRYTSLKKQFPEKAEQLFAKAEADAKARLEQYK
FT                   KLAEG"
FT   gene            complement(66390..67670)
FT                   /locus_tag="Moth_0065"
FT   CDS_pept        complement(66390..67670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18404"
FT                   /db_xref="InterPro:IPR032256"
FT                   /db_xref="InterPro:IPR032257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD5"
FT                   /protein_id="ABC18404.1"
FT                   /translation="MFRRLLACFLILLSLSLAGCRAEKQPVTATASFKEFKSNIVGLEF
FT                   YVNQPSGDPKQVINLNDKQLARRFLDFLGQLPVTNPPPDSWTGARDFLAFKFTHNGEIL
FT                   ASKQYPYYHQDNGPGYLELEDGWHQVPAAFNSRLATLAQYPEATSNVDPADVAFLKQYG
FT                   WTIFYKIKTYSGRLPDKLLHESGEYPVALYYAYNNELSKDVGLDLTPYLGKNVQINLYK
FT                   LEEPLPAFMKPRQDAGRAVIVRDGDKIVGAWLDAGGPDAFACSLKGRRLEEITGKSWGE
FT                   WVDQYIDHRNEQEKLISQMNPEKVIETYYEAIDHKDPRTAHACETRRRLVTYLFRNMDN
FT                   NRLYNYSYATNDADEINNITRARVIRIQPYQGPGPEQPDVKKYMVEVDINVRRVITYDS
FT                   GRQVRFFTLRRETPTTGWRIDDISTGP"
FT   sig_peptide     complement(67575..67670)
FT                   /locus_tag="Moth_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.749 at
FT                   residue 32"
FT   gene            67876..68202
FT                   /locus_tag="Moth_0066"
FT   CDS_pept        67876..68202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0066"
FT                   /product="transcriptional regulator, ModE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18405"
FT                   /db_xref="GOA:Q2RMD4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD4"
FT                   /protein_id="ABC18405.1"
FT                   /translation="MQVRYKLWLEEGEHVFGEGLFELLQEIDRLGSINQAARSLKMSYR
FT                   QAWGQVKKAEERLGQRLLFTRIGGETGGGAELTPEGRSLVQRYRQFKNEAAGAIETAFQ
FT                   RYFG"
FT   gene            68473..69375
FT                   /locus_tag="Moth_0067"
FT   CDS_pept        68473..69375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0067"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18406"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD3"
FT                   /protein_id="ABC18406.1"
FT                   /translation="MAKIRRMWLVLLATLILLLTFTGCGQGTKTGDKQQTPLAAGPVNK
FT                   NLILATTTSTMDSGLLDVLIPMFEEKSGYIVKPNAVGTGQALAMGDQGNADVLLVHAPA
FT                   DEVKLVQKGTVINRQLVMHNDFIIVGPPSDPAGIRGVKKAADAFKKIAAKQAIFVSRGD
FT                   DSGTHKKEKDIWKEAGINPQGKWYQEAGAGMGQTLNIASEKGGYTLTDRGTYLALKKNL
FT                   NLDIMLEGEKTLLNIYHVMQVNPEKFPGMKINSEGAKAFVDFMVAPETQKVIGDFGKDK
FT                   FGQSLFFPDAGKDENTLGQ"
FT   sig_peptide     68473..68550
FT                   /locus_tag="Moth_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.385 at
FT                   residue 26"
FT   gene            69447..70184
FT                   /locus_tag="Moth_0068"
FT   CDS_pept        69447..70184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0068"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18407"
FT                   /db_xref="GOA:Q2RMD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD2"
FT                   /protein_id="ABC18407.1"
FT                   /translation="MEAIWQGLVQAFLLIIKLDPGVMEVVTLTLKVCGLATAISILIGV
FT                   PLGIFLALKAFPGRQVVVSLVNTGMGMPPVVVGLVVSFLLWRSGPLGYFGLIYTPAAMV
FT                   IAQALIAAPLITGLTMAAIQQLPRGLKIQVLALGATPGQLYWTLLKEARLGILAAVIAG
FT                   FGGVISEVGAATMVGGNIMHQTRVLTTATVMEVSRGHFDVAMALSFILLGLSFAVTFAL
FT                   TVLQQRERTGKANKRRFLRFFRS"
FT   gene            70213..71283
FT                   /locus_tag="Moth_0069"
FT   CDS_pept        70213..71283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0069"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18408"
FT                   /db_xref="GOA:Q2RMD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD1"
FT                   /protein_id="ABC18408.1"
FT                   /translation="MGISICARDVRVIKGGRQVLAVDDLEIGPGEVWGLIGPNGAGKST
FT                   LLQVLALLEKPATGEVWFAGRKVDYRRILPWRRQLAVVFQESLLLNTTVFNNVATGLRF
FT                   RGLPRPVIKERVERWLKALQIEDLADRPARGLSGGEAQRVSLARALALEPRVLFLDEPF
FT                   AALDAPTRAALLEELHHILEATGITAVFVTHDFTELPFLADRVAALQEGRIVQTGTPEA
FT                   ILWHPASIQLAAFVGIANLLPGEASLNGAGPARVRLRGGTTILAGTRVKGRVVACLRPE
FT                   EINICGFQEGKQGANILRGRIVRVVPLGGQYRVEVDCGLELVALAGAAQIRRSFMVPGR
FT                   EVMVTFPPEAVHLIPA"
FT   gene            71329..72018
FT                   /locus_tag="Moth_0070"
FT   CDS_pept        71329..72018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0070"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18409"
FT                   /db_xref="GOA:Q2RMD0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMD0"
FT                   /protein_id="ABC18409.1"
FT                   /translation="MIKLPKILVVDDEPAIVELVKFNLEQAGFTTITASDGAEALQKAE
FT                   AEKPDLIILDVMLPKVDGFEVCRSLRARGSMPILMLTARREEVDRVLGLELGADDYLTK
FT                   PFSPRELVARVRAILRRVAEKQQQNDGIITVGDLVINPASHLVTVRGKPVDLTLKEYQL
FT                   LQLLAENRGRVFSREALLERLWEGEYYGDTRTIDVHIRHLREKIEANPSNPRYIITVRG
FT                   VGYKFRD"
FT   gene            complement(72015..72308)
FT                   /locus_tag="Moth_0071"
FT   CDS_pept        complement(72015..72308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18410"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC9"
FT                   /protein_id="ABC18410.1"
FT                   /translation="MARELFLKNYMEDCVWELLDQVLKRDPEACRCDTCRHDIVALALN
FT                   QLPPRYVVREQGAIYSKIAMLEAQHRADIYSALTRALMIVKKAPRHGQEDRS"
FT   gene            72508..73365
FT                   /locus_tag="Moth_0072"
FT   CDS_pept        72508..73365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0072"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18411"
FT                   /db_xref="GOA:Q2RMC8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMC8"
FT                   /protein_id="ABC18411.1"
FT                   /translation="MDVLTLPAYGKINLTLKVLGRRSDGYHNLSTIFQSIALADRLTFS
FT                   RCREGIRLETSGLPVPQGPENLAYRAAARLQSRYGFPGVRITLKKQIPLAAGLAGGSAD
FT                   AAATLIGVNALFNLGLTPGQLAREGAALGSDVPFCVIGGTALGRGRGEELSLLPPLPTL
FT                   WLVLVKPSFGVSTAAVYRGWDASPGQTPMEAPDEERALAAIRRGDRAGIMASLGNDLEA
FT                   VTCRLYPEVMAIKMRLLAEGAERAVMCGSGPAVFGVAADGETARRIASRLQETYPETIV
FT                   TRTL"
FT   gene            73381..74079
FT                   /locus_tag="Moth_0073"
FT   CDS_pept        73381..74079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0073"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18412"
FT                   /db_xref="GOA:Q2RMC7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC7"
FT                   /protein_id="ABC18412.1"
FT                   /translation="MKNLLSGKLENYKPLREIVFEALREAIINGQLKAGERLMEVQLAE
FT                   EMGVSRTPVREAIRKLELEGFVVMIPRKGAYVADFSTKDIADVFEIRSALEALAAALAC
FT                   ERITEEELDELERLLIRVADCTAANDLETLVEVDTQFHDVLYKASRNDRLVQIINNLRE
FT                   QIQRFRTISMGTPGRMRETLEEHKQLVEAITERNVELAQRIAQEHIENAENRMMEAIRE
FT                   EMRSGGGRKA"
FT   gene            74092..74844
FT                   /locus_tag="Moth_0074"
FT   CDS_pept        74092..74844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18413"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC6"
FT                   /protein_id="ABC18413.1"
FT                   /translation="MQVDAIILAGDKEGRALLPIGTRPMISWVVAALEASPSIRRLAVS
FT                   GLPELETILPPDVILVPAGQTTVESALNGAAAFPGAEWLLMVTADIPLLKPAAVEDFLQ
FT                   RCQERPADFYYPIVSREASEASYPGVKRTYVRLREGTFTGGNMVLIKASALNDCASQGQ
FT                   KLVRLRKSPLALSRLIGLGFILKFLTRQLTIAEAEERFSHLLGAKGVGVITPYPEIGID
FT                   VDKESDLELARGVLGGEAPVSPHNGGRY"
FT   gene            75036..76418
FT                   /locus_tag="Moth_0075"
FT   CDS_pept        75036..76418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0075"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18414"
FT                   /db_xref="GOA:Q2RMC5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMC5"
FT                   /protein_id="ABC18414.1"
FT                   /translation="MADTVAVILAAGQGKRMHSRRPKVLHRIAGRCLVEHVLAAVGEAG
FT                   IKKQIVVIGHGAEEVREALGPEYTYVLQEQQLGTGHALARAREAAGTAATVLVLCGDTP
FT                   LLRPATLARLLKEHRDRQAAVTILTAVLDDPTGYGRIIRDGQGMVAGIVEERDANPVEK
FT                   AIREINTGIYCFEAAYLWPFLEQLQPNNDQGEYYLTDVVGLACRENLPVQAVAAGDPEE
FT                   ILGVNDRAQLAKAGAILRRRINMGLMQAGVTIIDPETTYIDATVRIGPDTIIYPGTFLE
FT                   GNTIIEEGCSLGPGTTLRDCQVGKGSHVIHTVALESEIGPGCQVGPFAYLRPGTVLDAR
FT                   VKVGDFVEIKASRIGAGSKVPHLTYLGDTTVGTGVNIGAGTITCNYDGEKKWPTVIEDG
FT                   AFIGSNSNLVAPVRVGAGALVGAGSTITEDVPAGSMALARGRQVNLSGRSKKSSEKRQE
FT                   KG"
FT   gene            76460..77428
FT                   /locus_tag="Moth_0076"
FT   CDS_pept        76460..77428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0076"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18415"
FT                   /db_xref="GOA:Q2RMC4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC4"
FT                   /protein_id="ABC18415.1"
FT                   /translation="MEVIKKQMETESGRLKIFTCNANPKLAEEIGAYLGVPLGAAKVKR
FT                   FSDGEISVVIDESVRGEDVFVIQPTCEPVNDNLMELLIMIDALRRASARRITAVIPYYG
FT                   YARQERKTRARDPISAKLVANLITAAGAHRVLTMDLHAAAIQGFFDIPVDHLTAVPILA
FT                   DYFNSKGFEKAVIVSPDLGGVTRARNFAERIGAEIAIIDKRRPAPNVAEIMNLIGDVKN
FT                   KTVIMIDDLIDTAGTICLGAKALMEQGACAVYACCTHPVLSGPARERLMASPLQEVVVC
FT                   NTIPVPEGKEIPKLHRLSVAPLLGEAIIRIHEDLSVSKLFD"
FT   gene            complement(77425..78087)
FT                   /locus_tag="Moth_0077"
FT   CDS_pept        complement(77425..78087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18416"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC3"
FT                   /protein_id="ABC18416.1"
FT                   /translation="MFYTSKKLMGMPVVSLADGHQLGRIKRLLIDHSKMAIAAFTVDRK
FT                   GWFKEQPVVPYSHVKSVGSHAVTVDEASAVVKLSSLPELEALAKHPLPLLGARVITEEG
FT                   TVLGTVEDFRFDPQDGKIHYLDIKSGLLHGARSLETDQIITCGRDALIARAGAEEALQK
FT                   SGGLLSVKLQDACKSAGKTFDSAGTITRKVGETVNRYWQRLPFSQKKNDGPPPGENS"
FT   gene            78187..78813
FT                   /locus_tag="Moth_0078"
FT   CDS_pept        78187..78813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0078"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18417"
FT                   /db_xref="GOA:Q2RMC2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMC2"
FT                   /protein_id="ABC18417.1"
FT                   /translation="MQAQTLEVTMRPEVGKQAARRLRRQGKLPGIIYGKKIANLAVIIP
FT                   ARQLEHILATEGENALLKLVVSGDGQNKEFTAVIREVQRHPLKGNLTHVDFYQVSMEDK
FT                   LRATVPVILEGEARGVKEGGILQHGVREIEIESLPADLPESIVVDVSHLGVGEHLTVGE
FT                   IKVPAGVKILSEPDTVIATVVTTRAVETETEEETTTGESPAQPAE"
FT   gene            79061..79633
FT                   /locus_tag="Moth_0079"
FT   CDS_pept        79061..79633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0079"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18418"
FT                   /db_xref="GOA:Q2RMC1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RMC1"
FT                   /protein_id="ABC18418.1"
FT                   /translation="MALVLMVVGLGNPGPRYATTRHNAGFMVVDLLADDLGITLDRTRE
FT                   QALTGQGLVGNNRVLLVKPQTYMNNSGQAVAPLARWYGIAPEAILVIHDDLDLAPGRLR
FT                   LRRGGSSGGHRGLQSIITHLGTTAVPRLKIGIGRPPLGQNVIDYVLKPFSEGDWELIRP
FT                   VLLEAARAARFLLEGGSMDEAMNRFNH"
FT   gene            79716..80147
FT                   /locus_tag="Moth_0080"
FT   CDS_pept        79716..80147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18419"
FT                   /db_xref="GOA:Q2RMC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMC0"
FT                   /protein_id="ABC18419.1"
FT                   /translation="MFFVKTLLVGLSAALCAWLLNRLLLHLGVHGVPALLGPVIEETLK
FT                   TGLALAAGASLAGVHSTFGLIEGLWELPAGTPPGAPAAPVRGYPGAWIGPALAAWGGHS
FT                   FFGLLVLLTYTRTGHPGTAWAMGLLAHLAWNRAVLALHR"
FT   sig_peptide     79716..79811
FT                   /locus_tag="Moth_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.857) with cleavage site probability 0.721 at
FT                   residue 32"
FT   gene            80294..83845
FT                   /locus_tag="Moth_0081"
FT   CDS_pept        80294..83845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0081"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18420"
FT                   /db_xref="GOA:Q2RMB9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB9"
FT                   /protein_id="ABC18420.1"
FT                   /translation="MYNNSILQIIRDSEQFYAIAGGLRRGAGEVQLYGLPEGMKGLWLA
FT                   AMLDEFNPILVVTPGSEEAQRLAADIESFWPGEGIDYLPPSELLPLEVYTPSPELAAQR
FT                   LKVLTNLVSGRTRILVVPVEDLLRKLPPPDTLRHSLQSLEVGQIIDREALLQKLTGLGY
FT                   RREEVVEAPGQLAVRGGIIDIFPLGAEEPVRLELFGDEIDSLRRFDPVSQRSVADLRAI
FT                   VVGPAQEVLPPPDLGPGLETLKAEFSQTYATLRQRQPQAARELKDRVQELIAMLEAGSW
FT                   PGGSSQLQPFFYPRQATLFEYFQRQPLLVLDDPARLLEEMRRREQQRLGIFTDMLAAGL
FT                   ALPSQGQAYLDSADLERLWQRYQRLYFSLLPRRVPGSNPRPAVGISAQTIPAFQGKLGL
FT                   VVEELTRWRREGYRIILMVADPNRVVALRQALAEQGIEALTHPEARDTLGRGEVIMVSG
FT                   RLRQGFTWPEMRLAIIGDTEIYGPIRRPRRVKTPREGSKISSFTDLKEGDYVVHVHHGI
FT                   GRYLGLQQLDVGGVKKDYLLIQYAGKDRLYVPVDQVSLVQKYVGGEGHVPRLYRLGGNE
FT                   WNKVKSRVQEAVQEMAQELLDLYARREAIPGHAFGPDTPWQREFEEAFPYTETPDQLRA
FT                   IAEVKADMEKPRPMDRLLCGDVGYGKTEVAMRAAFKAVMDGMQVAVLVPTTILAQQHYE
FT                   TFKARFAPFPVKIAVLSRFCSPREQKVVVEALKRGEVDIVIGTHRLLSSDVNFKNLGLV
FT                   IIDEEQRFGVAHKEKLKQLRYSVDVLTMTATPIPRTLHMSLAGVRDMSMIETPPEDRFP
FT                   VQTYVVEYNPELVREAIRRELDRGGQVFIVHNRVQDIDRFAYHIQQLVPEARVGIGHGQ
FT                   MGEEELENVMLDFISGRYDVLVSTTIVENGLDIQNANTLIVDESDNFGLAQLYQLRGRV
FT                   GRTNRLAYAYFTYRPDKVLGEIAEKRLAAIREFTAFGSGYKIALRDLQIRGAGNFLGPE
FT                   QHGHMVAVGFDLYCQLLEEAVRKLKEQRGEGVPRPALAEPQATPIELSVDTFLGDNYIP
FT                   EATLKMELYHRLMNAGDLAAVEDIAAEMEDRYGPPPPEARNLLALTRVRILAREVGVIS
FT                   VNQKNREVELSFGQHTGLRGEKLLQLNQYFPRKLAFSSAGGLTIRVRVMGLSQEELLDL
FT                   LEKVLTRIKYLVTEAAS"
FT   gene            83857..84768
FT                   /locus_tag="Moth_0082"
FT   CDS_pept        83857..84768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0082"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18421"
FT                   /db_xref="GOA:Q2RMB8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB8"
FT                   /protein_id="ABC18421.1"
FT                   /translation="MLSDDLTRLWQGLKPGLLSILTKLFRAAVIMVAALVLYRLISRFI
FT                   HRIFQVARRDPQREKTLETLLSSAVRYLIYTVAAMMALNQFVNITPIIAGAGVVGLAIG
FT                   FGAQSLVKDIITGFFIIFEDQFHVGDLVEINGQVTGTVEELGLRMTTVREWSGKKFYIA
FT                   NSEIKTVRNYNRDELRAIVTVTFPFEEDPRRIRTVLEQVCREVEREYHEEFIPDPSGQG
FT                   LAEPPQIYGVTDIDKTDKGGQFTITARTRTGALWTVERALREKIWQACRDNGIRLAYPT
FT                   RVYVGNQPGGEEVPAGSNSPML"
FT   gene            84931..85482
FT                   /locus_tag="Moth_0083"
FT   CDS_pept        84931..85482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0083"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18422"
FT                   /db_xref="GOA:Q2RMB7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB7"
FT                   /protein_id="ABC18422.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEVI
FT                   LKKYSPIGELGDFAKEYADSLHEAIGHIACIADRDNIIAVAGAPKKEFLDKPIGQAIER
FT                   VMEERKPLLANSPSEDLFPIDGEGEAYKFTAEVIAPIIAEGDPIGAVILCSREPGVKMG
FT                   DMELKLAETAAGFLAKQMEQ"
FT   gene            85566..87038
FT                   /locus_tag="Moth_0084"
FT   CDS_pept        85566..87038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0084"
FT                   /product="MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18423"
FT                   /db_xref="GOA:Q2RMB6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB6"
FT                   /protein_id="ABC18423.1"
FT                   /translation="MAGKVIVTGLGPGDPAQVPEAVLKALAGADKIYLRTAHHPAVAAL
FT                   EVRGLKWETFDSFYEEAADFEELYQRIASFLLTAVAKTDKKLAYAVPGHPLVAERSVAL
FT                   LLEKAPAAGVDLEIIPAMSCLDALYATLKIDPALGLTVADALTFTVAGLDPARGLILTQ
FT                   VYNRRVAGEIKLDLMTVYPDEYPVTVVRGAGLPDGERVATVPLYTIDRLEWLDHLTSLY
FT                   LAPYPEGRDRTLAGLEAIMARLRSPEGCPWDREQTHITLKRYLVEETYEVLEAIDAGDM
FT                   NKLCEELGDLLLQVVFHARLAEEEGDFTLADCLEGICAKMRRRHPHVFGQAVLNTAGEV
FT                   LARWDQIKATERREKGEEAPSVLSVPRGLPALLKALKVQEQAARVGFDWPRIEEVWTKV
FT                   EEELDELKKAVAGAGVEEQAAEMGDLLFSLVNLARWLQIEPEAALQATVAKFARRFNYI
FT                   EKAALKGGRDIEDLSLAEMDALWEEAKKIRPS"
FT   gene            87120..87395
FT                   /locus_tag="Moth_0085"
FT   CDS_pept        87120..87395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0085"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18424"
FT                   /db_xref="GOA:Q2RMB5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB5"
FT                   /protein_id="ABC18424.1"
FT                   /translation="MNKMDLIASVAEKTDLTKKDAEKVVNAVLASIEEALAQGEKVQLV
FT                   GFGTFEIKERAARVGRNPRTGEEIQIAATRAPVFKAGKALKDAVAR"
FT   gene            87453..87722
FT                   /locus_tag="Moth_0086"
FT   CDS_pept        87453..87722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0086"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18425"
FT                   /db_xref="GOA:Q2RMB4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB4"
FT                   /protein_id="ABC18425.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVCDGGGVEVNRRPAKASTEVKPGD
FT                   VLTLKLGNRWQTVEVLATPEHIAANQARETYRVLAEGQAENPEK"
FT   gene            87793..88722
FT                   /locus_tag="Moth_0087"
FT   CDS_pept        87793..88722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0087"
FT                   /product="sporulation protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18426"
FT                   /db_xref="GOA:Q2RMB3"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB3"
FT                   /protein_id="ABC18426.1"
FT                   /translation="MARGFKLVAVLLNILLLSQLFAGCRAPARKPAAQEPIISLYVNQT
FT                   GEVKRMKIEDYLPGVVAAEMDPTWPLNALAAQAILARTFTMKKIQEGGVKAHGTDASTS
FT                   VEEFQAYDPTKINDNVRRAVEMTRGEVVKYNGNYINAWFYASGGSRTASSAIEGLNFRS
FT                   EPAPYIQSVPDPGMAITTAENKSWTASFSNAELAAAVRRITGQDPGPITSVRVAARGPS
FT                   GRATQLRIGRLTVDVPALRLALGNDRLRSTLITGITTSGGRVTFKGEGYGHGVGMSQWG
FT                   ARALAQQGKSPQDIIKYFFKDIQLVKAW"
FT   sig_peptide     87793..87894
FT                   /locus_tag="Moth_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.864) with cleavage site probability 0.678 at
FT                   residue 34"
FT   gene            88792..89058
FT                   /locus_tag="Moth_0088"
FT   CDS_pept        88792..89058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18427"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB2"
FT                   /protein_id="ABC18427.1"
FT                   /translation="MADGQHQLSIINREKLVISGVLQVLNYDEEEILLETTLGYLVIKG
FT                   SNFNISNLSLETGNLELSGRVNNLSYSEGKGARGKGLMQRLFK"
FT   gene            89055..89531
FT                   /locus_tag="Moth_0089"
FT   CDS_pept        89055..89531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18428"
FT                   /db_xref="GOA:Q2RMB1"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB1"
FT                   /protein_id="ABC18428.1"
FT                   /translation="MIPVLDQWQIFLALAGAGMVLAFAFDCYRVGRYFWRPRSLATMVG
FT                   DALFWLLFTLLTFILLMLINWGEVRAYTFLALVLGALLYGLFLSRSTRRCLYAGGRILG
FT                   SALALGRRLLNRTVLVVLLPGRLALNFLAWPRKTLQFIWRRWRRPGGPGGSAGG"
FT   gene            89642..89884
FT                   /locus_tag="Moth_0090"
FT   CDS_pept        89642..89884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0090"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18429"
FT                   /db_xref="GOA:Q2RMB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMB0"
FT                   /protein_id="ABC18429.1"
FT                   /translation="MQIEIRGAEKLSFRERQVVALKEMGLSNEEVARRLGLSASSVATL
FT                   YHRARTKGYQVVIVLPGETLGIFAEEEDEQGNPSA"
FT   gene            89859..90203
FT                   /locus_tag="Moth_0091"
FT   CDS_pept        89859..90203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0091"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18430"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA9"
FT                   /protein_id="ABC18430.1"
FT                   /translation="MSKVIRLPKKRRLWPELIIILVAVYLLYSFAHLGLALYQTNLQIQ
FT                   AYENQKAALLQENARLRQEIQELNSDSYIEKVAREELGLVKPGERVIMSAQPGQVRPYK
FT                   PPEPGHQFRD"
FT   gene            90284..90676
FT                   /locus_tag="Moth_0092"
FT   CDS_pept        90284..90676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0092"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18431"
FT                   /db_xref="GOA:Q2RMA8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA8"
FT                   /protein_id="ABC18431.1"
FT                   /translation="MSIAVGTVLEGVVSGITKFGAFVELPGGLTGLVHISEVADTYVKD
FT                   VNDYVKEKDRVRVKVINIDEKGKIGLSIKRANPDYVERRGPRHSRQAASASFEDKLARF
FT                   MKESEERIQDLKRHTDSKRGGRGTRY"
FT   gene            90757..91647
FT                   /locus_tag="Moth_0093"
FT   CDS_pept        90757..91647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0093"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18432"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA7"
FT                   /protein_id="ABC18432.1"
FT                   /translation="MTLYAALDIGSNSVRLLLGEVAGEHVKPRRAELRSTRLLAGATGG
FT                   WLQEEPVRRTAAAVAELAGLARGYHPAGMACIATSAAREARNPEILTAAVATGAGLDVI
FT                   IIDGSVEARLTYRGALAGLTVPVDNPLVIDIGGGSTEFSWREGGEVQFTSVRVGAVRVM
FT                   EESLDREAIRSLLAPVLARVRKSRPGFIIGTGGTITTLAALELALPTYRPELVHGLVLP
FT                   AGRVEDWRRRLAALPLEARRNLPGLQPERADIIVAGVTILEIILAGLGAANLQVSEADL
FT                   LWGLLLAMARGERLK"
FT   gene            91644..92210
FT                   /locus_tag="Moth_0094"
FT   CDS_pept        91644..92210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0094"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18433"
FT                   /db_xref="GOA:Q2RMA6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA6"
FT                   /protein_id="ABC18433.1"
FT                   /translation="MKLVVAVTGATGAVYAVRLLEALRATGSEVHLVLSRWAGETLRLE
FT                   TDTTVDTLRGLATRCYQENDLAAPVASGSFQHQGMVVVPCSMKTLAGIAHGYAANLIMR
FT                   AADVTIKEGRKLILVPRETPLSPIHLENMLTLARLGVVIMPPMPAFYYRPRTVDDVVNH
FT                   LVARILDHLGLEQDLVPRWGSPGED"
FT   gene            92267..93703
FT                   /locus_tag="Moth_0095"
FT   CDS_pept        92267..93703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0095"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18434"
FT                   /db_xref="GOA:Q2RMA5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA5"
FT                   /protein_id="ABC18434.1"
FT                   /translation="MAHQDLQAYLAYLEAHKLLHRVKVEVDPIFEIAAISDRVVKRGGP
FT                   ALLFERVKGSTLPVATNLFGSIDLVKAALEVTDLEEPARRLRALLELPADSGGWLDKLR
FT                   FLPRLAELGRYLPRRVKEAPCQEVRVEPPSLEELPVLQLWPGDGGRFLTLPLVFTHDPL
FT                   TGRRNVGMYRMQVFDAVTTGMHWHIHKDGAEHLRRSGDRLEVAVALGADPAVIYAATAP
FT                   LPPGLDEMLLAGFLRREPVEMVPALTVNIDVPARAEIILEGYVDPGETRLEGPFGDHTG
FT                   YYSPADNYPVFHLTCLTRRRRAVYPATVVGPPPMEDAYLGKVTERLFLPLIQLQLPEVV
FT                   DINFPPAGVFHNCVIVAIRKAYPGQARKVMHALWGMGQMMFTKLIIVVDADVNVHDLQE
FT                   VAWRVLGNIDPRRDAVIVDGPVDILDHAAPRRGFGSKMGLDATRKLPEEGASRPWPEEA
FT                   RAAREVLELIDRRWQEYGLA"
FT   gene            93690..94547
FT                   /locus_tag="Moth_0096"
FT   CDS_pept        93690..94547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0096"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18435"
FT                   /db_xref="GOA:Q2RMA4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA4"
FT                   /protein_id="ABC18435.1"
FT                   /translation="MVWRKIRIFLAMIKFEHTIFALPFAYLGAFIAAGGRPTAAQLGWI
FT                   TLAMFGARTAAMSLNRLIDRHIDALNPRTADRALPRGLISVTEVWLYTILSFGLLFFAA
FT                   TRLNWLCVELMPIAVLVLVIYSYTKRWTWACHFALGLADALAPVGAWVAIRAAIDLPAV
FT                   ILGLGMGTWVAGFDIIYACQDYDFDRRYGIHSIPARFGKERALVIARYLHAFSIVMLAG
FT                   VGYLLHLGWLYFLGVLLAAVILTYEHRLVSPEDLSRLNLAFLNMNGYLSVLMFVFTLLA
FT                   LTLE"
FT   sig_peptide     93690..93809
FT                   /locus_tag="Moth_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.784) with cleavage site probability 0.391 at
FT                   residue 40"
FT   gene            94586..95572
FT                   /locus_tag="Moth_0097"
FT   CDS_pept        94586..95572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0097"
FT                   /product="NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18436"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA3"
FT                   /protein_id="ABC18436.1"
FT                   /translation="MKIRGLALLLLLLFLVPVVSGCGSPASSGSSQEESLKLGLIPVED
FT                   NFPFFVAEKEGLFTKAGLKVELVPFNSARDRDLALQSGSIDGEVADIVATALLRKGGTP
FT                   VKIVSLTMGATPAEGRFALLARPGADISSPGQLKGRTVGISENTIIEYVADGLLREGGV
FT                   DPGSVQKVAVPQIPERLQLLLGGKLDAALLPDPFASLAARKGARVILDDTKINRNLSQV
FT                   VLIFREEAIKHKTPAIKKLLQVYAGAASLIARNPSAYRELFIEKARIPAELRDTYLAPQ
FT                   YSPPQLPRQEEVAAVMDWMVAKKLLAAPYKYEELVDPDLVNPGGNNR"
FT   sig_peptide     94586..94672
FT                   /locus_tag="Moth_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.486 at
FT                   residue 29"
FT   gene            95569..96309
FT                   /locus_tag="Moth_0098"
FT   CDS_pept        95569..96309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0098"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18437"
FT                   /db_xref="GOA:Q2RMA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA2"
FT                   /protein_id="ABC18437.1"
FT                   /translation="MIRVTGVSYTYINNGARVSALEDINLTIPAGQACVLIGPSGCGKT
FT                   TLLYLLAGLLKPTRGEIRINGARVTRPRRQTAIILQDYGLLPWKTVWKNAALGLALRGC
FT                   SRQRQQEILEPLLAALGLSGLEKRYPAQLSGGQKQRVAIARALSLEPDTLLMDEPFSAL
FT                   DALTREGLQQTLVDIRRQRCLTTVLVTHNIEEAVFLGQQIVVLTAAPGRLKAVLENPEA
FT                   GTPDYRFSETFHRNCSRVRQLLQK"
FT   gene            96607..97368
FT                   /locus_tag="Moth_0099"
FT   CDS_pept        96607..97368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0099"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18438"
FT                   /db_xref="GOA:Q2RMA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA1"
FT                   /protein_id="ABC18438.1"
FT                   /translation="MRRAFVDMPFKHKIVAYLGSILFLFGCWWLLARGINNPGLPEPRL
FT                   ALQGLARFWPELARHLYFSVYRVVVSLALALLLAVPLGLWAGRNRAVDSFLAPMVYLLY
FT                   PVPKVALLPVAMVLLGIGDGAKMLIIFLVIFNQILITTRDAARKIPDQLLLSVASLGAG
FT                   KASLFRQVILPACLPDIITASRVSLGSAISVLFLSETIAGNSGLGYFILDGLFRADYGA
FT                   MFAGILTMAGMGLVLYILLHLFEYLLCPWER"
FT   gene            97527..97949
FT                   /locus_tag="Moth_0100"
FT   CDS_pept        97527..97949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18439"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RMA0"
FT                   /protein_id="ABC18439.1"
FT                   /translation="MRGINCIAGRGRYRVSCRVFVTGEGLIAHLLGGEKPHVGAVALGI
FT                   PRPSLRGEGASATTSVLTLTGHKDDEVARPAATTLAAACQAPVVVVAGIHLDGATPGEL
FT                   VQLQENARRAVAGVLKYLKGVRRTPGPSGSGHQPPR"
FT   gene            complement(97882..98766)
FT                   /locus_tag="Moth_0101"
FT   CDS_pept        complement(97882..98766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0101"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18440"
FT                   /db_xref="GOA:Q2RM99"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM99"
FT                   /protein_id="ABC18440.1"
FT                   /translation="MNPALAHGPCPCNDTDSRVLELTEPPLTGLDVSDLQLRLAQMGYY
FT                   FGPLNGIYNKTTQRAVINFQREHHLTPLGRVGPATWKELARGIAVAHQAPAGPPPGKNL
FT                   KIVIDTERLVLTILVDGRVFQKYPVAIGKYTSPSPVGEWKIVDKAYESGGAFGTRWMGL
FT                   NVPWGNYGIHGTNRPWSIGWAASAGCFRMFNEDIETIYPWIPVGTPVVVKGPYTMPTGP
FT                   LKPGQGSPEVITLQARLREKGFYLFGPTDGDYGLMTELAVKEFQLYHGLTATGVADART
FT                   LRALGFDVPLSDT"
FT   gene            98947..99378
FT                   /locus_tag="Moth_0102"
FT   CDS_pept        98947..99378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0102"
FT                   /product="Protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18441"
FT                   /db_xref="GOA:Q2RM98"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM98"
FT                   /protein_id="ABC18441.1"
FT                   /translation="MWLALLIALVSGIAMAFQGSLNSALAKITGLLQATLVVHLTATLA
FT                   VGVLLFFPLSDGHLGRIWQCPWYLWLGGLIGVVITYGVVASIPRVGVALATTAIIVGQV
FT                   TTALIIDHLGLFGLDKIPFTWWKAAGLILLATGARLMLN"
FT   sig_peptide     98947..99027
FT                   /locus_tag="Moth_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.919 at
FT                   residue 27"
FT   gene            99445..99521
FT                   /locus_tag="Moth_R0009"
FT                   /note="tRNA-Met1"
FT   tRNA            99445..99521
FT                   /locus_tag="Moth_R0009"
FT                   /product="tRNA-Met"
FT   gene            99530..99604
FT                   /locus_tag="Moth_R0010"
FT                   /note="tRNA-Glu1"
FT   tRNA            99530..99604
FT                   /locus_tag="Moth_R0010"
FT                   /product="tRNA-Glu"
FT   gene            99766..101808
FT                   /locus_tag="Moth_0103"
FT   CDS_pept        99766..101808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0103"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18442"
FT                   /db_xref="GOA:Q2RM97"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM97"
FT                   /protein_id="ABC18442.1"
FT                   /translation="MSGQTRAHSMRQQTGVLAGSEFFLDVLLLGAVFFLVRAALLEELF
FT                   PFGPAVIIAVGARRRLLWPAVVVAAVSAWLAGLPQVYSRLLIFLFLGLACTLYPSLNQR
FT                   GPLTRATLAPVAITLVRGLGLTLWQPSFYGWVQVIFEALLAWGLSLGLLETATARRQEE
FT                   RLLGGGLFLLGLLLGLQGWQVSGLSIQGIISRYILLLAALAGGAGTGAAAGAAVGFLPS
FT                   LSALITPSLAGLMAFTGLVAGSLKNLGKPGVISGFLLAHLVLANYFLGSDGVQAALRES
FT                   GLAVLFLVATPPLLVYYFREFLAVPVAAQQAPADTSPRDNLKVALKSLAQNLKFHGFNE
FT                   SPLETVRQVARAACRGCPAGKVCWELEGEQMLNTLQELLHRGSQGPLTLAALPEWLASR
FT                   CNRGRELLAALTTRAGKGQPQPLEDGLTNWLASIFDNLAVMVENRGIKKENSAGSGTGQ
FT                   PALKISVGMAATPRHRAEVTGDAFVAATLEPGRQLLILGDGMGAGREAADASGTALELL
FT                   QDLLAAGFSPELALRTVNMVLLLRTTRENFTTIDLAMVNCHNGQTEFYKLGACPSFIQG
FT                   KDGVKILRSHSLPVGILEDLQVEALKEELQEGDLLVMVSDGVLEAHRDLNEKEKWVSKA
FT                   LQRAGDARPQEIADRLLKQARALAGGNPPDDMTVVVARVEKAASA"
FT   gene            101911..103278
FT                   /locus_tag="Moth_0104"
FT   CDS_pept        101911..103278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0104"
FT                   /product="tRNA(Ile)-lysidine synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18443"
FT                   /db_xref="GOA:Q2RM96"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM96"
FT                   /protein_id="ABC18443.1"
FT                   /translation="MLDRVRQTIQDYHLLVPGDKVVVGVSGGPDSLALLHSLMTLQEEY
FT                   GYTLQVAHLNHGLRPEAAADAEYVRDLATGWGLPVTVAQRDVLAYRQEHHLSIEAAARE
FT                   VRYNFFQEVAAAVGATRIAVGHQAEDQAETVLLNLLRGSGLTGLKAMLPRRGRLIRPLL
FT                   FVTRAEIEAYCRDNGLHPRRDFTNEDPAYRRNKIRHQLLPLLAREYNPAIVATLGRTAL
FT                   ILQEDEALLADLAHRALEGIIKRREGETLVLDRQGWQDLAPALQRRVLRLAAATLGRRV
FT                   SFNQVEKARAVAREGGTLTWPGRLSIRARGAELHLQLPGKSAGKVSFSYQLQVPGLTPL
FT                   PEVGKAIRAEIAPPPRAFKPGREDEAWLDRAKLKQPLLVRNWLPGDCFRPLGMKGTKKL
FT                   QDYFIDRHLPAARRPLIPLVISEGRIAWVAGLGLAEDFKVTPATRETLHLKLEPWP"
FT   gene            103373..105310
FT                   /locus_tag="Moth_0105"
FT   CDS_pept        103373..105310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0105"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18444"
FT                   /db_xref="GOA:Q2RM95"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM95"
FT                   /protein_id="ABC18444.1"
FT                   /translation="MNRIFKNLAIYLLIVLLAVSVIRLSTPPEKPAQEWDLTRFYQAVD
FT                   QDQVREVTLTPQDNIIKVDGVLKDNTKFTVNALSSTPLTDRLISKGVRIKTQPSPQPPW
FT                   WTSLLGSLLPILLLVGLVFFMMQQTQGGGSRVMQFGKSRARLHTDDKRKVTFEDVAGAD
FT                   EVKEELEEVVEFLKNPRKFNELGARIPKGVLLFGPPGTGKTLLARAVAGEAGVPFFSIS
FT                   GSDFVEMFVGVGASRVRDLFEQAKKNSPCIVFIDEIDAVGRQRGAGLGGGHDEREQTLN
FT                   QLLVEMDGFNANEGIIIIAATNRPDILDPALLRPGRFDRQIVVDIPDVNGRKDILKVHV
FT                   RGKPLDETVDLDVLARRTPGFTGADLANLVNEAALLAARRGKHKISMEEMEDSIERVIA
FT                   GPEKKSRVISDYEKRLVAFHEAGHALLGHYLPHTDPLHKVSIIPRGRAGGYTLLLPKED
FT                   RRYMTKSQIIDQVTMLLGGRVAEALVLKEISTGAQNDLERATELVRKMITEFGMSEELG
FT                   PLTFGRRQETVFLGRDIARDRNYSEAVAFSIDKEARHIIDECYNRAKEMLQKHLAELHL
FT                   VARALMEKETLEAEEFTAIIEAYDREHGVPENSSDAGKPAAAGGQDTGKDTPGNTLIKL
FT                   TFLQGLKGVW"
FT   gene            105311..105730
FT                   /locus_tag="Moth_0106"
FT   CDS_pept        105311..105730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0106"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18445"
FT                   /db_xref="GOA:Q2RM94"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM94"
FT                   /protein_id="ABC18445.1"
FT                   /translation="MAVERTFSMIKPEGVRRGLVGAILARLEQKGYRIVALKMLRLTPE
FT                   MAAAHYAEHRDKPFYQDLINHITSGPVVAMVLEGPGVIAGLRRLMGATNPQEAAPGTIR
FT                   GDFALETSDNVIHGADSPASAEREIALYFTPAELG"
FT   gene            105834..106343
FT                   /locus_tag="Moth_0107"
FT   CDS_pept        105834..106343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0107"
FT                   /product="3H"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18446"
FT                   /db_xref="GOA:Q2RM93"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM93"
FT                   /protein_id="ABC18446.1"
FT                   /translation="MKTKERRQKILELLDNNLPQKGTDLAAALGVSRQVIVQDIAVLRA
FT                   AGVNILATPQGYLLPGRENLCRRTFACRHDLAGLEQELLLMVDYGGKVIDVIVEHPLYG
FT                   EIRGYLMLSSRYEVRKFVTDLKASDARPLYTLTGNGVHLHTVEASRQELLDTIEDRLAR
FT                   AGFLLK"
FT   gene            106362..106808
FT                   /locus_tag="Moth_0108"
FT   CDS_pept        106362..106808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18447"
FT                   /db_xref="GOA:Q2RM92"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM92"
FT                   /protein_id="ABC18447.1"
FT                   /translation="MPGFLEYTLYLSTDDVRVAHHLARILNQKGGRDVVARGQESERGA
FT                   AVVVRIFGWQEFSLVRVLETVRAGARNYNVQVTGGNLSPAPVEALLAVVQHALLLDRLP
FT                   LIAGATPREPLREASEKGRCQYRLMFVYLLLSFLYTAKNVVCFL"
FT   gene            106977..108656
FT                   /locus_tag="Moth_0109"
FT   CDS_pept        106977..108656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0109"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18448"
FT                   /db_xref="GOA:Q2RM91"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4IOJ"
FT                   /db_xref="PDB:4IOK"
FT                   /db_xref="PDB:4IOL"
FT                   /db_xref="PDB:4IOM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM91"
FT                   /protein_id="ABC18448.1"
FT                   /translation="MSKVPSDIEIAQAAKMKPVMELARGLGIQEDEVELYGKYKAKISL
FT                   DVYRRLKDKPDGKLILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGPS
FT                   FGIKGGAAGGGYAQVVPMEDINLHFTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRT
FT                   ITWRRVIDLNDRALRNIVIGLGGKANGVPRETGFDISVASEVMACLCLASDLMDLKERF
FT                   SRIVVGYTYDGKPVTAGDLEAQGSMALLMKDAIKPNLVQTLENTPAFIHGGPFANIAHG
FT                   CNSIIATKTALKLADYVVTEAGFGADLGAEKFYDVKCRYAGFKPDATVIVATVRALKMH
FT                   GGVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINAFPTDTEAELNLLYELC
FT                   AKAGAEVALSEVWAKGGEGGLELARKVLQTLESRPSNFHVLYNLDLSIKDKIAKIATEI
FT                   YGADGVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNFTITVREVR
FT                   LSAGAGFIVPITGAIMTMPGLPKRPAACNIDIDADGVITGLF"
FT   gene            108857..110065
FT                   /locus_tag="Moth_0110"
FT   CDS_pept        108857..110065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0110"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18449"
FT                   /db_xref="GOA:Q2RM90"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM90"
FT                   /protein_id="ABC18449.1"
FT                   /translation="MSWHDEIEVITVADAATAARLMQEVGADAGGIDLMLPKACFYCLK
FT                   LKDVPARAANILKQEILARGGEAAMAAGVAGWSVDKTDVLIFATRRQLELLVAKLPVQG
FT                   FGLDKLAAGIKTTLANWERNDVRKIGCPRGPLVLGKRTLVMGIVNVTPDSFSDGGQFYD
FT                   PGAAVEHAHQLVAEGVDIIDVGGESTRPGHEPVSAAEEWRRLEPVLTRLTREIKVPISV
FT                   DTYKASTARRALEMGVDIINDIWGFRADPEMARVCGQYQAAVVLMHNQEGTSYKDLMFD
FT                   ILTFLRQSIRMAEDNGVPPEKIIVDPGIGFGKDLDQNLEVMGRLEEFKVLGKPVLLGTS
FT                   RKSMIGRTLDLPVDQRLEGTAATVALGIARGVDIVRVHDVRAMVRVARMTDAIVRRKKG
FT                   STR"
FT   gene            110178..110702
FT                   /locus_tag="Moth_0111"
FT   CDS_pept        110178..110702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0111"
FT                   /product="Phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18450"
FT                   /db_xref="GOA:Q2RM89"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM89"
FT                   /protein_id="ABC18450.1"
FT                   /translation="MNIRRWVQAGDYYLFYYVNQRLQCSFLDRVMPFFTILGSAAFALF
FT                   FSLATAILGREQARAAGWQAFFALTGSHLMVRLFKNWVGRCRPYLALPGARYLARPWQD
FT                   YSFPSGHTAASFSLAIIFALNFPALTLPLVALAGLTGISRMYVGMHYPTDVLGGATMGA
FT                   LFAYIVHSWPW"
FT   gene            110811..111734
FT                   /locus_tag="Moth_0112"
FT   CDS_pept        110811..111734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0112"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18451"
FT                   /db_xref="GOA:Q2RM88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM88"
FT                   /protein_id="ABC18451.1"
FT                   /translation="MQRGTGTMTATRRKQLYREYLGHYLTFACAALLIVITVAIVVFIA
FT                   LQGLATFFANHINPWQFLFSTKWQPDRPLSEGGPLVGTLAFTVGSIAVSLLAVLIGGPL
FT                   SIVAAVFMVEIAPRWGRRVLQPAVEILAGIPSVVYGWIGLSLLVPFLRRELHTLGFSLL
FT                   AGCLVLAVMIIPTVVSLTADSLRSLSRDLKEAAYALGSTRWQTISRVLLPAARPGIMTA
FT                   IVLGLARAFGEALAVQMVIGNTRSLPTSILSPMTTLTSAITIDMGYTIPGTAWNNALWS
FT                   MSLLLLLITFGFIILIRLVGKGRVYR"
FT   gene            111731..112663
FT                   /locus_tag="Moth_0113"
FT   CDS_pept        111731..112663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0113"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18452"
FT                   /db_xref="GOA:Q2RM87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM87"
FT                   /protein_id="ABC18452.1"
FT                   /translation="MKARLVDHVATFFFWLGAGIILVLLGVLVGYVLFKGGKWLDLAFI
FT                   TRPPENLKAGGGVGPQLFNSFYLLVLSMLFTIPLGVGAGIYLAEYAGSGDVNPALALPR
FT                   SKRATNYLLAALNLSIETLASLPSIVVGLFGLLVFVVSTGWGYSLMAGALALTVLNLPV
FT                   MVRISLEALQAVPRDLKEASLALGASRWETIWKVVLPAAFPGLVTGGIITAGRVFGEAA
FT                   ALLYTAGMSSPVLDFSDWNPLHPNSPLNPFRPAATLAVHIWKINSEGLIPDVRRVADGS
FT                   AALLIIVVLVFNLLARWLGNVLYRRMTAS"
FT   gene            112686..113444
FT                   /locus_tag="Moth_0114"
FT   CDS_pept        112686..113444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0114"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18453"
FT                   /db_xref="GOA:Q2RM86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM86"
FT                   /protein_id="ABC18453.1"
FT                   /translation="MAQPKITINNLNFYYGSNRALKDVNLEIQAHAVTALIGPSGCGKS
FT                   TFLRTLNRLNDLIDGVRISGEILLDGQNIYAPEVDVVALRKRVGMVFQRPNPFPMSIYD
FT                   NIAYGPRIHGITSRRELDGIVERSLKAAALWDEVAGRLRHSALGLSGGQQQRLCIARLL
FT                   AVEPEVVLMDEPSSALDPISTLKIEELIHNLKEKYTIVIVTHNMQQAARVSDYTAFFLN
FT                   GEMVEYDETEIIFTKPRDKRTEDYITGRFG"
FT   gene            113515..114219
FT                   /locus_tag="Moth_0115"
FT   CDS_pept        113515..114219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0115"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18454"
FT                   /db_xref="GOA:Q2RM85"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM85"
FT                   /protein_id="ABC18454.1"
FT                   /translation="MEGNKLTGGLAMASTTRQGFQNSLEELQQNILRMGSIVEQTIAKS
FT                   VECLAKQDDKMAAEVVEGDVVVDDLELLIENQCLKLIATQQPMAKDLRKIAAGFKIITD
FT                   LERMADYSVDIARTAQRILATGQPLIKPLIDIPRMAELAQVMVKQSLDAYVREDTELAY
FT                   RVARADDQIDSLHNQVFRELLVLMMEDPKTINQATHLLFVSRYLERIADHATNIAEDAI
FT                   YLVTGERKELND"
FT   gene            complement(114256..115476)
FT                   /locus_tag="Moth_0116"
FT   CDS_pept        complement(114256..115476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0116"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18455"
FT                   /db_xref="GOA:Q2RM84"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM84"
FT                   /protein_id="ABC18455.1"
FT                   /translation="MKASMKLPFAILCTVPFIMVLGNSMLVPLLPLMRSSLNVTLVQVS
FT                   LFITAFSLPAGIVIPFAGFLSDCYGRKTIMAPALIIYGAGGILAGLAAWLVASPYYLIL
FT                   GSRILQGIGAGGTYQLAMALASDIFQSNERTKALGLLEAANGLGKVVSPIAGAALGLLL
FT                   WFAPFFVYGILAIPIGLAVWFLVREPEQGNKNKTDFHSYFHNLGQVLQEKGLSLMASIL
FT                   AGMIVLFILFGVLSYVSDLLEGRYGVTGIRIGLLIAIPVGTMALTSYLSGSYLQKTAGN
FT                   FLKIVIIAGLVLEAAALVIMGFFANIYIFFLAMILMGFGTGIVLPAVNTLITSASARER
FT                   GGITCLYGSARFFGVALGPPAFGLAMTLGKLPLFLGAAVLVGIIAFLTIAFIQTEKMLP
FT                   PELLPGH"
FT   sig_peptide     complement(115366..115476)
FT                   /locus_tag="Moth_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.850) with cleavage site probability 0.377 at
FT                   residue 37"
FT   gene            115551..115826
FT                   /locus_tag="Moth_0117"
FT   CDS_pept        115551..115826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18456"
FT                   /db_xref="GOA:Q2RM83"
FT                   /db_xref="InterPro:IPR020390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM83"
FT                   /protein_id="ABC18456.1"
FT                   /translation="MFFFLPDKHVLAMAAMRVLSSLIELTAAMLMLKLNQVEAALKINA
FT                   TLALVGPTIMMLVMALGLWGLAGKIHPEKMLAIILGVGLIFYGVRH"
FT   gene            115954..116769
FT                   /locus_tag="Moth_0118"
FT   CDS_pept        115954..116769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0118"
FT                   /product="phosphosulfolactate synthase"
FT                   /EC_number="4.4.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18457"
FT                   /db_xref="GOA:Q2RM82"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM82"
FT                   /protein_id="ABC18457.1"
FT                   /translation="MQYKDQSAWRDVLEFPIGGRQQKPRRTGKTMVIDKGLGLTEFKDL
FT                   LEVAAPYIDFIKLGFGTSVFYPADILREKIRLARSHAVDIFPGGTFFEVAVLQGRLSLY
FT                   LQTARELGYTFIEISDGTIDLSRTLRYAALRQARAAGFGVITEVGKKDPRDALSDTHIL
FT                   SQIAMDLEAGADYVIVEGRESGQGVVIYDSRGVVKEDTLAYLIEGIGDLDRIIWEAPQK
FT                   QQQQVLIINLGANVNLGNVQPGDVLALEALRVGLRGDTLRTTLVREGVS"
FT   gene            116880..117629
FT                   /locus_tag="Moth_0119"
FT   CDS_pept        116880..117629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0119"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18458"
FT                   /db_xref="GOA:Q2RM81"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM81"
FT                   /protein_id="ABC18458.1"
FT                   /translation="MIGGKDMEIEVFTTLNGIPDETINSKTIIVIDVLRATTTITAALA
FT                   AGCLEIIPVLTPEEAIEMRERLEDDRVLLGGERNALKIPGFDLGNSPLEYTADVVAGKR
FT                   LIITTTNGTRAIRRAASGRQVLLGAMINGPAVARVAAAGAADITIICAGTRDRFSLEDF
FT                   LTAGLLVDELGNQGDFTLRDGARVARDYYRLHREDPEAAMKASYHGQLLAGLGMEDDVE
FT                   YCAQVDITTIVPVYSSGIIKSPDRGTE"
FT   gene            117703..118158
FT                   /locus_tag="Moth_0120"
FT   CDS_pept        117703..118158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0120"
FT                   /product="Protein of unknown function DUF441"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18459"
FT                   /db_xref="GOA:Q2RM80"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM80"
FT                   /protein_id="ABC18459.1"
FT                   /translation="MSAATVILILLMLLGILGRSNVIAAAAAFLLLLQFTSLQRFYPIL
FT                   ERRALEAGLIFLVVSVLVPFASGRVAPRDMLQSFVSLPGLIAIASGIIATHMNCQGLEL
FT                   LQRFPQMMIGMVIGSIIGVAFFGGIPVGPLMAGGIAALLVHLMAWLR"
FT   sig_peptide     117703..117780
FT                   /locus_tag="Moth_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.709 at
FT                   residue 26"
FT   gene            118435..119244
FT                   /locus_tag="Moth_0121"
FT   CDS_pept        118435..119244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0121"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18460"
FT                   /db_xref="GOA:Q2RM79"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM79"
FT                   /protein_id="ABC18460.1"
FT                   /translation="MAQRSRVTLPQLQAMKERGERITMVTAYDYPSSLLADRAGMDMIL
FT                   VGDSLGMVVLGYSSTVPVTMDEMIHHTKAVVRANPAALVVADLPFLSYQTSVPDAVYNA
FT                   GRLIKEGGADAVKLEGGQAVVPTVRAIVNAGIPVMGHLGLTPQSAVQLGGFRVQGRSEA
FT                   EGEKIAADAAALVEAGVFALVLECVPADLARRITAALPVPTIGIGAGPDCDGQVLVYHD
FT                   LLGLFDRFRPKFVKQYANLAEATVAALEKYRDEVRQGKFPDQEHSFK"
FT   gene            119259..119969
FT                   /locus_tag="Moth_0122"
FT   CDS_pept        119259..119969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18461"
FT                   /db_xref="GOA:Q2RM78"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM78"
FT                   /protein_id="ABC18461.1"
FT                   /translation="MLNYLDLILLIILARGAWRGYRLGLVNLLAGWISYLVAGLVSAIY
FT                   SRPLAEIVNQTWHLTGRWGGELASRLPLPGAVLNQPLSTPAIRQTESFLSGLPLPGPVQ
FT                   QNLLGALDRASGGTVGQVLAGQIAFLGLELLILVVLFYGSFFLLRHIARRFSPGTRGTV
FT                   EMADRGLGLLLGVLGPAFGLALAIGILRSLFTIPSMTAAPVFLPLVRQLHSSGVAAILG
FT                   DFYDWLATLLHTLI"
FT   gene            120040..121470
FT                   /locus_tag="Moth_0123"
FT   CDS_pept        120040..121470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0123"
FT                   /product="Peptidase M18, aminopeptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18462"
FT                   /db_xref="GOA:Q2RM77"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM77"
FT                   /protein_id="ABC18462.1"
FT                   /translation="MAEREESRGKKLQKELGLPRKSAWERLEPGTREKVFAFAEGYKGF
FT                   LSRAKTEREAIRAALEAARGRGFISLNDIPSGRGLDPGSRFFLTWRDKVMLLGIAGTAP
FT                   LEEGIRLVGAHVDAPRLDLKPMPLYEKDGLAMFKTHYYGGIKKYQWTALPLALHGVIML
FT                   RDGRRVEVVIGEDAGDPIFSVSDLLPHLAKEQMKKNMEEALSGDDLNLVVGSLPFEGEE
FT                   ELKDKIRLAILQLLNQRYGLVEEDFITAELELVPAGPARDLGLDRSLVGAYGQDDRVCA
FT                   YTALQAVLELENPGHTALVLLVDKEEIGSTGNTGAHSRFLEYALTELAARMGSASIVNV
FT                   GRIMANSQAISADVTAGVDPTYENYFDMYNASFLGYGVVLNKYSGSRGKYDANDASAEF
FT                   MGRLRDIFNHNRVIWQSGELGKVDAGGGGTIAKFLAYFGLDVADCGPALLSMHAPLEIA
FT                   SKVDIYMAYRAYGAFLAS"
FT   gene            121583..122164
FT                   /locus_tag="Moth_0124"
FT   CDS_pept        121583..122164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0124"
FT                   /product="SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18463"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM76"
FT                   /protein_id="ABC18463.1"
FT                   /translation="MEKVVDARGLACPQPVIQTKKAMESLGPETELVTIVDNEVARDNV
FT                   LKLARSMAWEAEVKEQGSDYYIRIRKGAMPTTGVSLTAGQVLLVGSATLGRGSEELGSI
FT                   LMRNFFYSLSEAEVLPRRVLFFNSGVQLCCQGSPVLDSLLALEQKGVELLACGTCLDYY
FT                   HLKDKLCVGSVTNMYTIVEHLMAAEKVISL"
FT   gene            122178..123038
FT                   /locus_tag="Moth_0125"
FT   CDS_pept        122178..123038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0125"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18464"
FT                   /db_xref="GOA:Q2RM75"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM75"
FT                   /protein_id="ABC18464.1"
FT                   /translation="MLWPGWRRRDRQHLITDLEQCRGRIGRGLRRQLSLLDPLELAPLL
FT                   IAAWPRLGPDIRSQLVSLAEEEGFVDRWLELLARGRAGARVTAATILGEMEVGRALGPL
FT                   LEALGEREEGVQLAATAALIRLRDPRCLEPLLAALAEPRRWPPARVAEILLALGPVSIP
FT                   PLLALLKQSAPELAVRVIAILGLFKDPRTLPDLEDCLQRGPAPVREAAARALGEMGLAR
FT                   AAPLLQLALADPEAGVRAAAARALGRLKYRQARKQLQACLDDGAWEVRAAAAAALQEVA
FT                   AAREI"
FT   gene            123043..123285
FT                   /locus_tag="Moth_0126"
FT   CDS_pept        123043..123285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0126"
FT                   /product="Protein of unknown function DUF951"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18465"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM74"
FT                   /protein_id="ABC18465.1"
FT                   /translation="MSFYVLQRGNRRFSEENCSMDFHIGDIVQTKKTHPCGSDRWEILR
FT                   VGMDFRLRCLGCGRLILIPRVKAEKSIKKVLPKPS"
FT   gene            complement(123272..123781)
FT                   /locus_tag="Moth_0127"
FT   CDS_pept        complement(123272..123781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18466"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM73"
FT                   /protein_id="ABC18466.1"
FT                   /translation="MLRVGIIACRDYWKKGCPGYQAHILCFLAREKHQGPLGELEGANI
FT                   VAMQPCPGCPGTGRLALARRMIAHDRVDCFVFPSCLFFNNHCPTAASHARAIEAATGRP
FT                   VLLGSYLEAARARSCASVIIKPGDIPSITECRQRLLNLNYLQYLYDRQASAPRKALQIL
FT                   TLLKMA"
FT   gene            124051..124347
FT                   /locus_tag="Moth_0128"
FT   CDS_pept        124051..124347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0128"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18467"
FT                   /db_xref="GOA:Q2RM72"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM72"
FT                   /protein_id="ABC18467.1"
FT                   /translation="MRNYEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGK
FT                   KRMAYEVRKYREGYYVLVEFKGTPAVAQELERVLKISDDVIRYLITRLEEEAS"
FT   gene            124371..124835
FT                   /locus_tag="Moth_0129"
FT   CDS_pept        124371..124835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0129"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18468"
FT                   /db_xref="GOA:Q2RM71"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM71"
FT                   /protein_id="ABC18468.1"
FT                   /translation="MLNRVILIGRLTRDPELRYTASGVAMTTFTLAVDRNFVNQQGERG
FT                   TDFIRITVWRKLAETCANHLGKGRLVAVDGRLQTRTYETPDGQKRSVTDVVAEDVRFLD
FT                   WPKEGRGPAGSGPVAGPGTGGGMETAGSGFNQDFSDLGTEVEIGEDDLPF"
FT   gene            125071..125298
FT                   /locus_tag="Moth_0130"
FT   CDS_pept        125071..125298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0130"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18469"
FT                   /db_xref="GOA:Q2RM70"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM70"
FT                   /protein_id="ABC18469.1"
FT                   /translation="MRRDKKRSRKRVCSFCVDKIEQVDYKDVNRLRRYISERGKILPRR
FT                   ISGNCAHHQRQLTRAIKRARALALLPYTAE"
FT   gene            125384..126370
FT                   /locus_tag="Moth_0131"
FT   CDS_pept        125384..126370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0131"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18470"
FT                   /db_xref="GOA:Q2RM69"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM69"
FT                   /protein_id="ABC18470.1"
FT                   /translation="MAEGRVTALAEGALMAALTVVLVLTGYFIPPLQLLTNIIWTVPIV
FT                   VLIVRQNLRLGVMATFIAGVVIALFTGPLNATLLFVQFAALGLVYGYLFKIKAGAGRTI
FT                   VIGALVALLSLLLTLALTFKLTGLPVGGLIQEFEGTVNYAMEFYRRAGILDHLAGQGLT
FT                   PDQIQASLQGMINLLKLLLPGILMTASLLAAFANYLVAEKVLQRLGLKAAGLPPFRYWQ
FT                   LPWYAVWGVIAGLALWQLGDYYHLALASRVGVNILYVYLPLLAGNGLAAVTFIFYHLRL
FT                   APFFKAVLVLVALMYFPVALVSLVTLGLFEPFFGFRRHLRPPADKGE"
FT   gene            126376..126828
FT                   /locus_tag="Moth_0132"
FT   CDS_pept        126376..126828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0132"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18471"
FT                   /db_xref="GOA:Q2RM68"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM68"
FT                   /protein_id="ABC18471.1"
FT                   /translation="MKVILTADVAKLGNRGTLVEVSEGYARNYLLPRGLAVEATAGRLK
FT                   ELDLEKKRREKKENQELENARRQAARLDGAVVKITTRAGETGKLFGSVTNKEIAEAIKN
FT                   TFQISLDRRKIDLKEPIKALGSYEVTLKLHPTVQAHLRVQVVAEGS"
FT   gene            126833..128800
FT                   /locus_tag="Moth_0133"
FT   CDS_pept        126833..128800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0133"
FT                   /product="Endopeptidase La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18472"
FT                   /db_xref="GOA:Q2RM67"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014252"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM67"
FT                   /protein_id="ABC18472.1"
FT                   /translation="MNKNAGAAININDVDLLPILANDFNLMSRQVGALFNVLCDIYGTD
FT                   KVVLKASKLEALDLMRSEALPERVLALQKLVYEDPTITDVPSESDIPAILVAIQEEIAE
FT                   FIARRTVEDKLEQRIAEKMQERHEEYVQEIRRQVLKEGSGPENAQTLKKLAILEKLSHT
FT                   SLSRTIMEALRPRRLEEIVGQEQAVQSILAKLASPYPQHMIIYGPPGVGKTTAARLALE
FT                   EARKISSSPFKASAPFVEVDGTTLRWDPREVTNPLLGSVHDPIYQGARRDLAENGVPEP
FT                   KLGLVTEAHGGVLFIDEIGEMDPLLLNKLLKVLEDKRVEFDSSYYDPNDESVPQYIKKL
FT                   FTEGAPADFILIGATTREPEEINPALRSRCAEVFFEPLTPADVETIVREGAGRLGVKLE
FT                   PAVPGLIAEYTIEGRKAINILAEAYGLSLYQQQRKKGRRRRLITVANVMQVIQNARLTP
FT                   YVTVRAKDTPEVGRVLGLAVAGFVGSVLEVEAMAFPAREAGKGSIRFNETAGSMARDSV
FT                   FNAAVVYRLLTGDDLANYDVHVNVVGGGNIDGPSAGLAIIAAIISAIQERPVRQDVAVT
FT                   GEISIRGKVKPVGGVMEKIYGAKQAGMKLVILPAENAAEVPDSLQGIAIQPVATVEEAL
FT                   DYLLMGPGEGRGRRRNRTGA"
FT   gene            128807..130141
FT                   /locus_tag="Moth_0134"
FT   CDS_pept        128807..130141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0134"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18473"
FT                   /db_xref="GOA:Q2RM66"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM66"
FT                   /protein_id="ABC18473.1"
FT                   /translation="MAAEIERVPPQSIEAEQSVLGAIMLDREALYAVLETLKVDDFYRE
FT                   AHRMIYRAILDLNERGEAVDLLTVTEELRRRGELEAAGGVAYLTSLTGDVPSVANAGYY
FT                   ARLVAEKAALRSLVQAASQITEMAFSESGSVDQILDEAERLIFEVAGGRHRSGFVPIKN
FT                   VLLQTFEQLERLSTHKGEVTGVPTFHDLDRLLSGLQPSDLIICAARPGMGKTSFCLNIA
FT                   QQVAVKEKLPVAIFSLEMSREQLVQRMLAAEAMVEQQRLRTGYLTEDDWARLVNAAGIL
FT                   GEAPIYIDDTPAISALEVRAKARRLQSETGLGLVVVDYLQLMQAHRRVDSRQQEIALIS
FT                   RAMKALARELNVPVMVLSQLNRGVEQRQDKRPVMADLLESGAIEADADVIIFLYRPQYY
FT                   DPDTDKKGIAEVIVAKHRNGPVGTVEMAFLPEYTKFVDLAPEPAG"
FT   gene            130293..130853
FT                   /locus_tag="Moth_0135"
FT   CDS_pept        130293..130853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0135"
FT                   /product="Appr-1-p processing"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18474"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM65"
FT                   /protein_id="ABC18474.1"
FT                   /translation="MEAIIAGTLLQLLQGDIVDQEVEAVVNAANTGLWGGSGVDGAIHR
FT                   AGGPAIAEECRRIREEQGGCPVGQAVITSGGFLKARYVIHTVGPIWRGGREGEDELLAS
FT                   AYRSSLQLAREKGIKSLAFPSISTGAYRFPLERAAGIALTTVKDFLTANPGIFSEVRFV
FT                   LFSQPVLAVYEKTLAGVLDAGPQ"
FT   gene            130880..131968
FT                   /locus_tag="Moth_0136"
FT   CDS_pept        130880..131968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0136"
FT                   /product="Protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18475"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM64"
FT                   /protein_id="ABC18475.1"
FT                   /translation="MRTGTASLPLHGGHCPPWLFERMQRLGPAILEVIVQEYGPQEVLR
FT                   RLSDPHWFQAFGCVLGFDWHSSGLTTTLCGALKEGLRGREKDLGLVIAGGKGRTSRQTP
FT                   HEIETAVDRLALTSLEPEDLVYASRMAAKVDNTALQDGYQLYHHVFIFTFDGQWAVVQQ
FT                   GMNETSRLARRYHWLGEGMQDFACEPHAAVCCDARETALNMVARESEASRQVVTELVRQ
FT                   QPAKVVAEFSRILEKDLPNLALPWRHDVPRAGYLNKALLKVYDVQPRDFAGVLGIEGVG
FT                   PKTIRALAMVAEVAYGAPASFRDPVRYSFSHGGKDGHPYPVDRQVYDRTINVLEQALAA
FT                   AKIGRTDKIQALKRLSRLANGS"
FT   gene            complement(132010..133293)
FT                   /locus_tag="Moth_0137"
FT   CDS_pept        complement(132010..133293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0137"
FT                   /product="Hybrid cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18476"
FT                   /db_xref="GOA:Q2RM63"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM63"
FT                   /protein_id="ABC18476.1"
FT                   /translation="MFCYQCEQTAGGSGCTRVGVCGKNEDIASLQDTIIIGLKGIAAYA
FT                   YHAGELGARDPEVDAFMHEALFTTLTNVDFDLNRHIETALKVGAMNLRVMELLDRAHVE
FT                   RFGAPEPTKVSTGTKAGPGILVTGHDLLDLYELLRQTEGTGINVYTHGEMLPAHAYPEL
FT                   KKFPHLVGNYGSAWQNQKKEFEDFPGAILGTTNCVLIPKESYRERMFTCGIAGLPGVTH
FT                   IKNRDFTPVIEKAKSLPPLEEKAGGELTTGFHHQAVLKLAGQIIDAVKAGKIRHFFLVG
FT                   GCDGAKPGRNYYTEFVEKVPKDCVVLTLGCGKYRFNHLDLGDIDGIPRLLDMGQCNNAY
FT                   SALQVALALADAFKCSVNELPLSLVLSWFEQKAVAILLTLLHLGVRNIRIGPSLPAFLT
FT                   PGVLKVLQEKYNLKPITTPEQDLKEILG"
FT   gene            complement(133438..134694)
FT                   /pseudo
FT                   /locus_tag="Moth_0138"
FT   misc_binding    complement(134847..134950)
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059); Moth_R0011"
FT   gene            135149..135664
FT                   /locus_tag="Moth_0139"
FT   CDS_pept        135149..135664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0139"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18477"
FT                   /db_xref="GOA:Q2RM62"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM62"
FT                   /protein_id="ABC18477.1"
FT                   /translation="MPLDEGNCELAYLGLGSNLGNREENLKQAVALLDAIVGIEVERLS
FT                   SWYETAPVGKIDQGWFLNGVARIKTTMPARELLRAVMAVEQRLGRVRRERWGPRTIDID
FT                   ILLYDDIKVTEPDLEIPHPRMLERAFVLIPLAEIAPDLLLPDGRRAADAAREGFPGQEV
FT                   LPYKGTRC"
FT   gene            135822..136745
FT                   /locus_tag="Moth_0140"
FT   CDS_pept        135822..136745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0140"
FT                   /product="NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18478"
FT                   /db_xref="GOA:Q2RM61"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM61"
FT                   /protein_id="ABC18478.1"
FT                   /translation="MMRVGIIGAGAVGTGMGLLLSRRGYTIAGVSSRTMASAERAAARL
FT                   NCPAFADPETVARRSEIVFITTTDRAIGPVATAIAGRGGFCPGQTVIHMSGSLTSAVLD
FT                   PARQAGALALALHPLQSCADADMAVANLPGSVFSLEGDREALPLGERLVNDLEGEYFII
FT                   SPEAKPLYHAAACVASNYLVSIVDLSYRLMQAAGMAPDMVARALAPLIEGTWGNIKEKG
FT                   VPRALTGPITRGDVATIASHLQAMAARAPELEEIYRAVGRYTIGVAGRKGSLNARRAAL
FT                   LGQLLANSRGKSPVRVPGRSPNKKRS"
FT   gene            136886..137737
FT                   /locus_tag="Moth_0141"
FT   CDS_pept        136886..137737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0141"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18479"
FT                   /db_xref="GOA:Q2RM60"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM60"
FT                   /protein_id="ABC18479.1"
FT                   /translation="MELLQTIAAVRNYVAAARQRGLSIGLVPTMGYLHEGHLSLARAAR
FT                   QQNDVVIMSIFVNPTQFGPNEDFARYPRDLERDRELAAGAGVDAVFAPAVEEMYPAGYA
FT                   TYVQVEGLTEVLCGASRPGHFRGVTTVVSKLFNIVQPDRAYFGQKDYQQALVIKRMVRD
FT                   LNFPIEIITIPTVREADGLALSSRNKYLTPEQRRSALSLHRALHLGSDLIKAGEREAAV
FT                   VRRAMEKEITAWPETRIDYVAISDADTLKPLEKIAGRVLLALAVWVGNTRLIDNVVLEV
FT                   ND"
FT   gene            137737..138123
FT                   /locus_tag="Moth_0142"
FT   CDS_pept        137737..138123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0142"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18480"
FT                   /db_xref="GOA:Q2RM59"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM59"
FT                   /protein_id="ABC18480.1"
FT                   /translation="MWRIMMKSKLHRATVTAADLNYIGSITIDSDLMAAADILPNEKVQ
FT                   VVDNNNGARLETYAIPGPAGSGVICANGAAARLVQPGDIIIIIAYGIFDDREARTYQPR
FT                   VIFLDARNKITAVKKGEQPGQVWV"
FT   gene            138280..139128
FT                   /locus_tag="Moth_0143"
FT   CDS_pept        138280..139128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0143"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18481"
FT                   /db_xref="GOA:Q2RM58"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM58"
FT                   /protein_id="ABC18481.1"
FT                   /translation="MAIEGSKQQVLEFLRRHRGEYISGEDLSRDLAISRTAVWKHIQSL
FT                   RQEGYRIDAQTRRGYCLLATPDCFYPEEVTAGLETAWLGRTLYYYDEVGSTNQVAKELA
FT                   DDGAPEGTVIVAECQTGGRGRRGRSWISPARKGIWFSVILRPRVAPAQAPQLTLLAAVA
FT                   VVAAVRERTGLPLGIKWPNDLLAGGRKVCGILTEIKAEIDAVEYIVLGIGLNANLEAGD
FT                   FSPEVSPQATSLYLELGRPVERLPLFQRILSCLEKWYERWQDEGFAPVREAWKEASITL
FT                   G"
FT   gene            139450..140019
FT                   /locus_tag="Moth_0144"
FT   CDS_pept        139450..140019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0144"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18482"
FT                   /db_xref="GOA:Q2RM57"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM57"
FT                   /protein_id="ABC18482.1"
FT                   /translation="MRTRDIALVALFAALVAVLAQVSIPLPFTPVPITGQVLGVLLTGA
FT                   ILGKNKGALAMLVYLLLGLIGLPVFARGGAGLAVFASPSGGYLWGYPIGVYIMGMILET
FT                   GKGEPGYPRLIAGMLLCLVVVYLLGTLQLTAILHVNLVKGLFLGVIPFIPLDLAKLVVA
FT                   ALAGRQVRRALRQAGFLVSREARRES"
FT   sig_peptide     139450..139557
FT                   /locus_tag="Moth_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.577 at
FT                   residue 36"
FT   gene            140019..140381
FT                   /locus_tag="Moth_0145"
FT   CDS_pept        140019..140381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18483"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM56"
FT                   /protein_id="ABC18483.1"
FT                   /translation="MRIRAHHLLCALQFRGYGYSEAFVRRVSRVIALWRHRPGLILTIT
FT                   RSHDAWCRACPNRDTSNCRQAAARDARVLACLGLAPGARLEVAAAQDLVHRKIDSRAAT
FT                   YICTGCRWLDGGYCRW"
FT   gene            140756..141520
FT                   /locus_tag="Moth_0146"
FT   CDS_pept        140756..141520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0146"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18484"
FT                   /db_xref="GOA:Q2RM55"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM55"
FT                   /protein_id="ABC18484.1"
FT                   /translation="MLLAIDVGNTNIVLGIFAGHELKCHWRVASDRQKTADEYGLILRQ
FT                   LAHYQGLDLKEIQGVVLASVVPTLTQVLTEMITKQLGHQPLVIGPGVKTGMPIRFENPR
FT                   EVGADRIVNGVAVYELYGGPAIVVDFGTATTFDAISEKGEYLGGAIAPGIGIATDALFA
FT                   RAAKLPRVELVRPPRLIGKNTVACMQAGIMYGFIGQVEGIITRMQAEMGGKAIVVATGG
FT                   LAGLIGPEVNCIDRVDPMLTLEGLRIVYERNT"
FT   gene            141504..142508
FT                   /locus_tag="Moth_0147"
FT   CDS_pept        141504..142508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0147"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18485"
FT                   /db_xref="GOA:Q2RM54"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM54"
FT                   /protein_id="ABC18485.1"
FT                   /translation="MSATLKIGPVTLAAPLIMAPMAGYTDRVFRLLAREAGAALTYTEM
FT                   ISAQGLIYNNKNTHALLDLKGEPGPVAVQLFGREPEIMAAATRIAVAAGAAIIDLNMGC
FT                   PTPKIVKNGEGSALMRDLPRAAAIVAAMVRAAGPVPVTVKMRLGWDEDSINVVEAARAV
FT                   VYAGAAAVAIHGRTRSQFYSGRADWSYFRRVKEAVDVPVIGNGDVRTARDAVTMLAETG
FT                   CDGVMVGRGAVGNPWLLTAIRAVLEGRPEPPPVDVRTRMTMACRHLKLLVELKGETTAV
FT                   KEMRKHLACYFRGLPGAARLRQQINTLTTAAEVIAAIKAYLRDYPCQDYNFLL"
FT   gene            142550..143077
FT                   /locus_tag="Moth_0148"
FT   CDS_pept        142550..143077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0148"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18486"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM53"
FT                   /protein_id="ABC18486.1"
FT                   /translation="MDLIRIGDKLISRRKINATLERIFTLRCQGFSQQEAARQVGVDRS
FT                   FVSRLETLGEVRRGRRIAVVGFPIANKAEVEAILRQEGVEYILLLTDAERWDFVRQKNG
FT                   LDLFNSLMEIITRLRDYDVVIIIGSDYRIKVSEALLGREVVGYGIGTSPIQGDRTVDVE
FT                   ELRRLVHQLGRD"
FT   gene            143228..144130
FT                   /locus_tag="Moth_0149"
FT   CDS_pept        143228..144130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18487"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM52"
FT                   /protein_id="ABC18487.1"
FT                   /translation="MKRVVSISLGSSKRDHQVETEFLGEKFRIERIGTDGDMERMITMI
FT                   RELDGRVDAFGLGGMDLYIRVGSRRYLLRDAARVARAARITPMVDGGGLKDTLERRVIA
FT                   CLDREGVINFRGKKVLMVSAVDRFGMAEALDAAGADLICGDLIFGLGIPIPIRSLTNFQ
FT                   RVAYLLAPIVRLLPFKILYPTGKEQEKIDNRYQHYYEDAEIVAGDFLFIRRHLPPELPG
FT                   RIIITNTVTAADIEELRRRGIKTLITTTPEFNGRSFGTNVMEGVLLTLSGKTPDTVTPD
FT                   DYNRLLDQLNFKPRIVNLT"
FT   gene            144256..145338
FT                   /locus_tag="Moth_0150"
FT   CDS_pept        144256..145338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0150"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18488"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM51"
FT                   /protein_id="ABC18488.1"
FT                   /translation="MHKFAFMIHPLDIHDVTRKFPVARHLPPALLEKAVRYLPPIKASH
FT                   ITGVRSAYAETEGWFVACSLTSRQMLSLPQDLVIKKLIRTGRLAEKLGAEILGLGAMTS
FT                   VVGDAGITIARHLNIAVTTGNSYTVATALEATAKAAAMMDIDLTRAEIAIMGATGSIGA
FT                   VCARILARNCRHLTLIARNEEKLARLAHQIKEETGLKARVTNHSREALRRADVIITVTS
FT                   AVDTVIEPEDLKPGAVVCDVARPRDVSRRVAEVRDDVLVIDGGVVQVPGDVDFHFNFGY
FT                   PPGLSYACMAETMILALEGRIENFTLGRELTVEQIDTINRLAAKHGFQVAGFRSFELPV
FT                   SEEQVAAIRERARQRAALAR"
FT   gene            145599..146081
FT                   /locus_tag="Moth_0151"
FT   CDS_pept        145599..146081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0151"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18489"
FT                   /db_xref="GOA:Q2RM50"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM50"
FT                   /protein_id="ABC18489.1"
FT                   /translation="MAEKETLLTANGLKKLEEELEYLKTVKRQEVAERLKQAIEFGDIS
FT                   ENSEYEDAKNEQAFIEGRILTLEKKLRNAKVIVASEVPDDVVSLGSRVTLKDLDEGEEI
FT                   QYEIVGSMEADPAENRISNESPVGKALLGHHTGETVTIQVPAGNLRYQILNIAKVH"
FT   gene            146086..147555
FT                   /locus_tag="Moth_0152"
FT   CDS_pept        146086..147555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0152"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18490"
FT                   /db_xref="GOA:Q2RM49"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM49"
FT                   /protein_id="ABC18490.1"
FT                   /translation="MKLEAENDLMAVRLEKLHQLQEAGIEPYGGPFEVTHSTTAIRERF
FT                   DELEGQEVALAGRLLAIRSHGKASFADLQDREGRLQLYIRLDNVGPGIYELFQKLDIGD
FT                   IVGVRGKVFRTHRGEISVEVRQLTLLCKSLRPLPEKWHGLKDVDLRYRQRYLDLIVNPE
FT                   VKQVFITRARIIRAIRSFLDNRGFLEVETPTMHPIAGGAAARPFITHHNALDIDLYLRI
FT                   ALELHLKRLLVGGLEKVYEMGRIFRNEGISTKHNPEFTMLELYQAYADYYVMMDLLEEM
FT                   VAYVAREALGTTVVTYQGDRLDLTPPWPRLTMLEAIKKYYGVDFDQLPTAEDARRAAIS
FT                   LGLEIEPGMERGKIINEVFEATVEPHLIQPTFILDYPVAISPLAKRKKENPDFTYRFEA
FT                   FIAGRELANAFSELNDPIDQRRRFEAQMAERAAGDEEAHMMDEDFLQALEYGMPPAGGM
FT                   GIGIDRLVMVLTDSPSIRDVILFPTMRPKEE"
FT   gene            147998..149552
FT                   /locus_tag="Moth_R0012"
FT   rRNA            147998..149552
FT                   /locus_tag="Moth_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            149668..149744
FT                   /locus_tag="Moth_R0013"
FT                   /note="tRNA-Ile1"
FT   tRNA            149668..149744
FT                   /locus_tag="Moth_R0013"
FT                   /product="tRNA-Ile"
FT   gene            149830..149905
FT                   /locus_tag="Moth_R0014"
FT                   /note="tRNA-Ala1"
FT   tRNA            149830..149905
FT                   /locus_tag="Moth_R0014"
FT                   /product="tRNA-Ala"
FT   gene            149966..152937
FT                   /locus_tag="Moth_R0015"
FT   rRNA            149966..152937
FT                   /locus_tag="Moth_R0015"
FT                   /product="23S ribosomal RNA"
FT   gene            153004..153118
FT                   /locus_tag="Moth_R0016"
FT   rRNA            153004..153118
FT                   /locus_tag="Moth_R0016"
FT                   /product="5S ribosomal RNA"
FT   gene            153169..153243
FT                   /locus_tag="Moth_R0017"
FT                   /note="tRNA-Asn1"
FT   tRNA            153169..153243
FT                   /locus_tag="Moth_R0017"
FT                   /product="tRNA-Asn"
FT   gene            153354..154109
FT                   /locus_tag="Moth_0153"
FT   CDS_pept        153354..154109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0153"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM48"
FT                   /protein_id="ABC18491.1"
FT                   /translation="MYDLRVVVEEIRGFCDLPMHPGDYFEVRGGRIYIPAGKYMCLWAL
FT                   QSLMPMLPVKQRQINETNDWIPHTHRIVCPDPNGLVIFRIDRLDPGQGESQGKEGRLES
FT                   PAGDSAAPIPPRLLVNEKICSGCRACELACSLYHEDAFAPELARLWVEKDEPEGLDRPH
FT                   VCRQCGNAACVKACPEGALSRDARTRAVILDRARCTGCGSCARACPFQALRLHPRESYP
FT                   LTCDLCGGDPRCVQRCATGALRFGRAGDR"
FT   gene            154142..156037
FT                   /locus_tag="Moth_0154"
FT   CDS_pept        154142..156037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0154"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18492"
FT                   /db_xref="GOA:Q2RM47"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM47"
FT                   /protein_id="ABC18492.1"
FT                   /translation="MYGYCGRVLRIDLTAERITIEPLPREWARNYLGGRGLNIKRLYTE
FT                   VPREADPLGPENKLIIGVGPLNGTFFPGAARVNFTARSPQTGILGDSNAGGFFGPELKY
FT                   AGFDQVILEGQAGRPVYIFIHDGFAEIKSAGHLRGLDVWQTQAAIRQELGDSRVQVAAI
FT                   GPAAENGVRFAGIFCNLVRAAARTGMGTVLASKGVKAIAVRGRQPLALADPRGFADLVQ
FT                   AIDREIYDHWEYQTRVLLGTTKLVHALNEAGCLATRHFTTGRFEAAEDVSGERLAETVK
FT                   LKSKACFACTIPCSRFFRIKEGPYRGLASEGPEFEGLAGFSSRVGNPDLDFALQAVDCC
FT                   NRLGMDVITTSEVISFVMELYARGMLTSSEADGLDLTWGNKETILSLINKIARREGFGD
FT                   ILADGVRAAARRLGKGEDLAMHIKGLEVFQADPRGLKGYALGLAVASRGGDHLRSEPSF
FT                   EFYEDPEAGRRRFGAPEAAFRLEYKGKGRVVKYYEERCALADSLNACKNTLVNMEILPY
FT                   EQAAALLRAAVGWDYTPEELRQIGERIVNLERAYIVSLGIRRADDTLPRRFLEEPLPEG
FT                   SGPSTGQVVELEPMLDEYYTARGWNRDTGIPEPEKLAALGLQEALADLRSRGILP"
FT   gene            156034..156315
FT                   /locus_tag="Moth_0155"
FT   CDS_pept        156034..156315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18493"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM46"
FT                   /protein_id="ABC18493.1"
FT                   /translation="MTTIKVQYFGVPRLLTGKARDVFSFPGDGVTLEAILARIGEAYGP
FT                   QVLRECRRYLIVAHDPHTGRQHRVSPGAEGCLLSNGWTLQFITPITGG"
FT   gene            156365..157753
FT                   /locus_tag="Moth_0156"
FT   CDS_pept        156365..157753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0156"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18494"
FT                   /db_xref="GOA:Q2RM45"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM45"
FT                   /protein_id="ABC18494.1"
FT                   /translation="MSIAAARTRSQAGQKVGLRRDLGIWESYATLIGVLIGSGIFVVTG
FT                   QAGAVAGPSVPLAYLVMYPIVICTAVAYMVFLSTPLGERPGGAYIHISRTFGTYYPGYI
FT                   AMWLKWVAFMGALGVLSLGFGQYVTFFIPGANPVLVGSLVLLFFYFINLFGVRIYGWAQ
FT                   VAMFLVLMIAVLVLVIPGLPAVNLSYYRPLFPFGLKGFLAAIPPLFLSYAGFESLAQTA
FT                   GETREARRSLPRVFLVGLSITVVIYFAMSFVAFGNLPYQQLAHSRSAMADVAARYLPFG
FT                   AAAIVAVGAMMAFTTSINGTLMVPPRVLMVLAEDRMIPGFLAHINPRFRTPDVALTIST
FT                   GVALALLWTKTLDYILAVTLQAMFILYIVHGIALICLPFVNPRLYKTALVRLHPALLVI
FT                   SGLISIAAMLLFSYAMIIAAWRLLLLWVAVGTGIYLYSRYQGRREGFDYQRRLVEEWCD
FT                   EAEA"
FT   gene            157881..158945
FT                   /locus_tag="Moth_0157"
FT   CDS_pept        157881..158945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18495"
FT                   /db_xref="InterPro:IPR019712"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM44"
FT                   /protein_id="ABC18495.1"
FT                   /translation="MAAAGIRPLVTLGYFLFQGFPGVNRELAGWRRRAAAIPDPRLREQ
FT                   ALASLTLKKFHCQGGSVYAAWPRRHCRELLRAIVALQTISDYLDNLCDRAGILDEEAFR
FT                   QLHLAVTDALIPGGAGHDYYAAYPYHRDGGYLRALVRACRESLAALPGYELVREEALYL
FT                   ADLYCRLQATKHTYPDRRRERLQVWLRPLLGQIPAPLYWWELAAATGSTLGIFALMALA
FT                   ARGETQARDVAGVKAAYFPWIGGLHILLDYLIDQEEDRAGGDLNFCAFYRDGAEAGRRL
FT                   NYFLQESLVAARNLPDPAFHLLVVRGLPAFYLSDGIASRQEQLPARQAILRTAGPFSRN
FT                   LYRLCRVLRRAGVV"
FT   gene            complement(158942..159904)
FT                   /locus_tag="Moth_0158"
FT   CDS_pept        complement(158942..159904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0158"
FT                   /product="Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18496"
FT                   /db_xref="GOA:Q2RM43"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM43"
FT                   /protein_id="ABC18496.1"
FT                   /translation="MNLAETRRVLAEAVAATDPRLQELLDYALEGGKGLRPTLVFLCAR
FT                   FGIYDALEAGRVAAAIELVHLASLVHDDILDGAAVRRNRPALYRAYGTVPAVLTGDYLF
FT                   ATAFGLLAKGKKAVLYTVTEAIRSMCSGEIGQLKGGLAGPEAYFTYIGQKTAALISAAC
FT                   RCGAILGRVKRNQQECLAQFGWHLGLAYQIVDDCLDLFGSPERMGKPCRQDLARGLLTL
FT                   PVLRFLAVTPDAACWRERLARGLEAAEMEELVEAARGLGCDTYTAAVAADEVTRALTAL
FT                   DRLPVNPVQDELALLAARTLAPLEDPDCPAAYPGMTAAG"
FT   gene            160333..160701
FT                   /locus_tag="Moth_0159"
FT   CDS_pept        160333..160701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0159"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18497"
FT                   /db_xref="GOA:Q2RM42"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM42"
FT                   /protein_id="ABC18497.1"
FT                   /translation="MPSQITYVLSTRFTIERGYLVESRRGGGGYVRIARVPLRAEDQVK
FT                   GWVQEALGDYLSQDAATELLARLGEEGLLTRRERMLLAAAINRNALPLELPQRDRVRAS
FT                   ILKAVILTLLRDDFPGEQ"
FT   gene            160716..161225
FT                   /locus_tag="Moth_0160"
FT   CDS_pept        160716..161225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0160"
FT                   /product="UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18498"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM41"
FT                   /protein_id="ABC18498.1"
FT                   /translation="MLCERCQERPASVHVTRIINGEKTELYLCQECARELQPQLNFSIP
FT                   QFLAGLLDYDPELEVKAPPAVERCPECGLTYEQFHETGRLGCPECYHHLAPRLDPLIRR
FT                   IQGSSQHRGKVPRRAGGNLRLRREIENLRARLQQLVQQEEFEKAAQVRDRIRDLEGRLE
FT                   KGESSQ"
FT   gene            161222..162274
FT                   /locus_tag="Moth_0161"
FT   CDS_pept        161222..162274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0161"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18499"
FT                   /db_xref="GOA:Q2RM40"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM40"
FT                   /protein_id="ABC18499.1"
FT                   /translation="MSLNLERNSKWMEGSGPQADIVISSRIRLARNLKGLPFPNLMNSD
FT                   QQARVVSQVSRAIQAPMVFQAVGELKLQPLRELAPVERQILVEKHLISPDLAAGGGEKA
FT                   VVLRDDEAVSIMVNEEDHLRLQCLLPAMMLHEAWRLADAADDALENELDFAFDQERGYL
FT                   TACPTNVGTGLRASTMLHLPALVLTRQAGPVLSALTKVGVAVRGLYGEGTEAQGNIFQV
FT                   SNQITLGRSEEEIINNLSAVTVRLADQEREARELLRRQSRWQLEDRVGRAYGVLTNARI
FT                   LSSQEALQLLSDVRLGAEMKIIRGLDQRLLNQLMVRIQPAFLQFSAGKEMTPMERDVHR
FT                   AAMVRELLAG"
FT   gene            162316..164838
FT                   /locus_tag="Moth_0162"
FT   CDS_pept        162316..164838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0162"
FT                   /product="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18500"
FT                   /db_xref="GOA:Q2RM39"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM39"
FT                   /protein_id="ABC18500.1"
FT                   /translation="MARFTERANRVLRLAQEEALALRHPAIGTEHILLGILREGDSVAA
FT                   RALTNLGVNIKAVREEVRKVIRPGEAVVGGELGLTPRAKRVLELANEEARRQGVNYVGT
FT                   EHLLLGLLEEGEGLAAQVLGGLGLSPEKIREQVIALLGGAGQPQTGGWTVLFGNLPFGM
FT                   AAFPGGMGFQAQGMPAGAKMQERRPGQTPTLDQFSRDLTRLAREDKLDPVVGREKEIER
FT                   VVQILSRRTKNNPVLIGDPGVGKTAIVEGLAQKIVQNQVPEVLRDKRVVALDMSGMVAG
FT                   TKYRGEFEERFKKVMDEVRAAGNVILFIDELHTLIGAGAAEGAIDAANILKPALARGEL
FT                   QTIGATTIDEYRKHIERDAALERRFQAVMVEEPTVEETIAILKGLRDRYEAHHRVKITD
FT                   EALEAAARLSDRYITDRYLPDKAIDLVDEAGSRVRLKVYTAPDDVKKLEARLEELEKEK
FT                   AAAVNAQEFEKAATLRDEEKKIKEELEAKKGEWQKEKGLEKSVVTPEDIAQIVSSWTGI
FT                   PVTQLAQEESERLLHLEDVLHQRVIGQDEAVHAVARAVRRARAGLKDPKRPIGSFIFLG
FT                   PTGVGKTELARALAEALFGDEDAMVRFDMSEYMEKHTVSRLVGAPPGYVGYEESGQLTE
FT                   AVRRRPYSVVLFDEIEKAHPDIFNVLLQVLDDGRLTDAKGRTVDFRNTVIIMTSNIGAS
FT                   TIKRESLGFKASTSEVAAESYDKMKKHILEELRRTFRPEFLNRIDDLIVFHALSRDDIR
FT                   KIVDLMLAELNRRLEDNNLSVEVTDEAKDILVREGFDEAYGARPLRRAIQTLIEDQLSD
FT                   EMLAGKFKPGDKVRAVARDGKIALEKAA"
FT   gene            164937..165701
FT                   /locus_tag="Moth_0163"
FT   CDS_pept        164937..165701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0163"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18501"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM38"
FT                   /protein_id="ABC18501.1"
FT                   /translation="MRRLVYIVDYCTDEVYGSLGAEGYFTEISPLNPSSPYSASKAAAD
FT                   LLALAYYKTYNLPVIVTRCSNNYGPYQFPEKLIPLMITNALEDRPLPVYGDGLNVRDWL
FT                   HVRDHCIALDLVLHKGRPGQVYNIGDNNERTNIEIVRRVLRELGKPESLITFVQDRPGH
FT                   DRRYAIDATRLLRELGWQPAYDFEQGLKETIRWYCENRTGGGKSSPGSTGATTGGCTPP
FT                   GWGRPGDENYHYRRPRAARAGAGRGASGGRRA"
FT   gene            165622..166472
FT                   /pseudo
FT                   /locus_tag="Moth_0164"
FT   gene            166469..166924
FT                   /locus_tag="Moth_0165"
FT   CDS_pept        166469..166924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0165"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18502"
FT                   /db_xref="GOA:Q2RM37"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM37"
FT                   /protein_id="ABC18502.1"
FT                   /translation="MIAGVQVKKLVRHCDDRGFFMEILREDDEIFSRFGQASMSKSYPG
FT                   VIKAFHYHEHQDDLWFFPVGNAQVVLYDLREDSPTRGETNVFYLGEDNPILLLIPRMVA
FT                   HGYRVLGNEPAIIIYFTTASYNRSHPDEKRIPWDDPTIGFDWTTRYR"
FT   gene            166941..167681
FT                   /pseudo
FT                   /locus_tag="Moth_0166"
FT   gene            167764..168024
FT                   /locus_tag="Moth_0167"
FT   CDS_pept        167764..168024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0167"
FT                   /product="Protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18503"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM36"
FT                   /protein_id="ABC18503.1"
FT                   /translation="MGRGAFTTFIQAAMKEAVIEQLEDGTFFAEIPPYPGVWADGKDEK
FT                   ECLATLQEVLEEWLLFKLRDGDNDIPVLGGEDLNHKWQVKL"
FT   gene            168514..168900
FT                   /locus_tag="Moth_0168"
FT   CDS_pept        168514..168900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18504"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM35"
FT                   /protein_id="ABC18504.1"
FT                   /translation="MGYYDPALPARMMRYRSDIWEATLQAGKGTPPILQAVFFFYPEHD
FT                   NKNHQLSDYWGNLKTLEFTYRVVRVWEEPRQSVIERGLIGLYPLLPLMKGEKNNCAAGS
FT                   GVRLNYPCGAEPNSSWNPYMIRGI"
FT   gene            168903..169124
FT                   /locus_tag="Moth_0169"
FT   CDS_pept        168903..169124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0169"
FT                   /product="Protein of unknown function DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18505"
FT                   /db_xref="GOA:Q2RM34"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM34"
FT                   /protein_id="ABC18505.1"
FT                   /translation="MNPLERITIDPSVCHGKACIKGTRIPVSVILDNLAEGISQEEILK
FT                   SYPSLSLEDIKAAIAYGAMLAKERHIAL"
FT   gene            169114..169506
FT                   /locus_tag="Moth_0170"
FT   CDS_pept        169114..169506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18506"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM33"
FT                   /protein_id="ABC18506.1"
FT                   /translation="MPCELRGIKMLRFKIDENLPIEIADLLREAGYEAETVWSEQIQGF
FT                   SDIELLGICRNEKRVLVTLDMDFSDIRRYRPEDYQGIILLRIASQGKQSVINLFKKVIP
FT                   HLRYQNLIGYLWIVQKDRIRIRGPER"
FT   gene            169776..171551
FT                   /locus_tag="Moth_0171"
FT   CDS_pept        169776..171551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18507"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM32"
FT                   /protein_id="ABC18507.1"
FT                   /translation="MHDKLRRLIDRLFRKMIVPFLGAGVSYNANPDGLTRTPDMIRRLA
FT                   QELILEAKKSTELAKFLLCICGKQDGTESDLCIDKLCNAGMAVLAEVYIHLHNEVKACN
FT                   ILRVAEFCDLEPTPTHCYIAYIAREGYINEIITTNYDTCMEKAYEKSFNRNFTSRQVRV
FT                   VTNLSEYRHFIDDSNPKYPLLHIYKINGCAKKFKEDPQNEAANIVLTERQLQNWRENKW
FT                   AQDMFRDRCRTRSILFSGFGSEEPQIRHTVLQVMDEFINNGQNSGNNVEVWDYENSPFI
FT                   AEWGEMTFYQFQILSSYLRAHGLTQITINEVQEGAFTKSDKELFDRYLPWNGKNLDMEQ
FT                   FWGVVYLLFIQRLLSEKYFSPGSKFSNYLPISLSIQQLLLQEFRQEILGQGGNEFKLQD
FT                   LFIWHENASYLQVSALHHRILFPGEELEPYNYCAFRDEPVALCMLYFLWWLCYRAYNYK
FT                   DKSWLLPCAEGKALVRIFVAEDNKIKIPVYVCGRDGYYNLNQLVMGYEPPYSLGVIFVL
FT                   NGYGLEPKVFPISNIIDSQLDIIQFYIIPDVYCFRNSCQSLEDILEGIRNLITDPAKIK
FT                   KEAVHWKKWVEEIYQ"
FT   gene            171548..172204
FT                   /locus_tag="Moth_0172"
FT   CDS_pept        171548..172204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18508"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM31"
FT                   /protein_id="ABC18508.1"
FT                   /translation="MIEHFKELSTKINGIPIKCQREYFENDGALPPSLLITSPAMVVAI
FT                   FAPDANKTWNEQHAASFKKAVRMINYVIQYHDTHQNLVVIYVAPDKEHYKNAERDFVNP
FT                   SFTEGEYVLYLFREEDIKKVDKILSLFENIQWRIEKITFEEWLEAVLKIQDNKLVKEWL
FT                   QDFLEELLKKEIALDLRQVIIDSIRQKAEEIVRQIEGGSRNGRNDQDKRDYTGGL"
FT   gene            172158..174347
FT                   /locus_tag="Moth_0173"
FT   CDS_pept        172158..174347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18509"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM30"
FT                   /protein_id="ABC18509.1"
FT                   /translation="MEETIRIKEITLEGFKCFFKKQSINCDADVIILTGNNGFGKTSFI
FT                   EALELMATGKIEPRIGENSTKRPFENYINRNLLSGEAKARIEVKCQDGRVFQATLLPER
FT                   LDEESTLFPLNGFSTSFVRSSCFFYQDGVESTFGRSQEGIQGIADAFVGDFPNREILLD
FT                   ALVKAAAEVENIRSSFRANLGNEDILKNEAAEQARNLQAIIESNEYLKQLIPFPAKLVI
FT                   ASGKLSIRYKENIQKWVAALTGHEQGDQPVCKLLEEAIKAIESIRKQALADIPPQADIN
FT                   EGVARLKELLDNLPDFFPVTETSPKGNIALKELTEKEKALELELARIKTQMGLLLSEEQ
FT                   LPIPGTNISTWMGEIPLIASIDYMLKVKANSSEVVVDEIWSMLEKHGGDWSDKLKSKWL
FT                   QYKQLRDEATAITQKIFEIRKEITGIKKKEVDFDNLLQALKLWSAIFGAPLEKVNLEDG
FT                   TGYDLKKARMMLKEKFVNINAAETMTAWNKVLEYLHKWQQIEQKLETIKLNWTPAAREA
FT                   DKKLSDFISWATKRNLDKWIEEIKGNALRENYISKLNQALEYILFQFGMGKELAKNVHF
FT                   KRSNGKLYIQRWSEDNIIRETNIFPTFSTAQINQLAIAYMLALNCGVKNHPLGFICLDD
FT                   VSSAFDLNNLAADAHLIRMLAYGNNQRRQVFITSHHDIITSRLLPLLLPPSGFRLKVIE
FT                   FTSFRPETGPELRFYECKQARSGYIALQNVFKVEA"
FT   gene            174596..175549
FT                   /locus_tag="Moth_0174"
FT   CDS_pept        174596..175549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18510"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM29"
FT                   /protein_id="ABC18510.1"
FT                   /translation="MNIDHDRLFKELIETFFAEFMQAFFPRAYEAIDFTHVRFLQQEVF
FT                   TDVTVGEKHEVDILVETRLKGEEGLIMVHIEPQSYVQKEFNERMFIYFSRLYEQYRCKI
FT                   LPIAIFTYDQVRDEPDTFTTGFTFLDVLRFRFYKLELKKLPWREYIHSNNPVAAALLSK
FT                   MGFKDEDRVQVKLEFLRMLTRLKLDPARMEMLAGFFESYLKLSQEEEERLNCELGRIDK
FT                   KEAEPIVQITTSWHERGRMEGRMEGRMEGRMEAKKETILKYLSRRFGDQPADLEEKVQK
FT                   ISDLQILDRILDELFAADTIEEARAVILGKIAGNLQ"
FT   gene            175752..175994
FT                   /locus_tag="Moth_0175"
FT   CDS_pept        175752..175994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0175"
FT                   /product="CopG-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18511"
FT                   /db_xref="GOA:Q2RM28"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM28"
FT                   /protein_id="ABC18511.1"
FT                   /translation="MEYQNITLSLPKQVLQRVKHIAIERQTSVSGLLARTLEELVRQED
FT                   SYAKARERHTTLLRNGTYLGTQGRITWRRADIHER"
FT   gene            175984..176418
FT                   /locus_tag="Moth_0176"
FT   CDS_pept        175984..176418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18512"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM27"
FT                   /protein_id="ABC18512.1"
FT                   /translation="MNDNLRRQFVDTNVLVYAHDISAGIKHEKARDLILSLWDSRRGCI
FT                   SLQVLQEFYVTIVQKVAKPVAPETAARIIADLGQWTLHVPDVEDVLEAIEIQQRNELSF
FT                   WDSLIICSAKKLGCDVIWTEDLNTGQRYEGVVVLNPFHLD"
FT   gene            176432..176707
FT                   /locus_tag="Moth_0177"
FT   CDS_pept        176432..176707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18513"
FT                   /db_xref="GOA:Q2RM26"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM26"
FT                   /protein_id="ABC18513.1"
FT                   /translation="MQEKLQPRMLKVSEGTIRRWVQKGDLPALRYGRQLRIPASALEKL
FT                   GRPATEISNKSDWLAKCRAARVMMPLRGDRAKILQQLRDKVVEKNE"
FT   gene            176700..177191
FT                   /locus_tag="Moth_0178"
FT   CDS_pept        176700..177191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0178"
FT                   /product="DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18514"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM25"
FT                   /protein_id="ABC18514.1"
FT                   /translation="MNELEEDILYRFQGFFKTRNIDLAYLFGSRARGKASPLSDYDFAI
FT                   LAPDMGTEEYYRLLHELSMFMGGAKVDVVMLKFAPVELQYRVIKDGILLYQKDGYTRVE
FT                   FEGNILSRYFDFLPVLRQQRENVLKEGKSEKRVQRYREALGKTLGVLNEIRTAQNQIIR
FT                   "
FT   gene            177130..177516
FT                   /locus_tag="Moth_0179"
FT   CDS_pept        177130..177516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0179"
FT                   /product="Protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18515"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM24"
FT                   /protein_id="ABC18515.1"
FT                   /translation="MEKLSECLTKLEPLKTKSFDDFEQDPYLRDIVERNLEVAAQCCID
FT                   IANRVISIEDLEKPEDYYSAFITLGQAGILPLKFARSFAGIAGFRNILVHEYIQIDWHE
FT                   VYRNLHRLDDFYHFADCIKAWMKK"
FT   gene            177708..177938
FT                   /pseudo
FT                   /locus_tag="Moth_0180"
FT   gene            178289..179266
FT                   /locus_tag="Moth_0181"
FT   CDS_pept        178289..179266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18516"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM23"
FT                   /protein_id="ABC18516.1"
FT                   /translation="MNIDHDRLFKELIETFFAEFMQAFFPRAYEAIDFTHVRFLQQEVF
FT                   TDVTVGEKHEVDILVETRLKGEEGLIMVHIEPQSYVQKEFNERMFIYFSRLYEQHRCKI
FT                   LPIAIFTYDQVRDEPDTFTTGFTFLDVLRFRFYKLELKKLPWREYIHSNNPVAAALLSK
FT                   MGFKDEDRVQVKLEFLRMLTRLKLDPARMEMLAGFFESYLKLSQEEEERLNCELGRIDK
FT                   KEAETIMQITTSWHEKGRMEGRMEGRMEGRMEGRMEGRMEAKKETILKYLSRRFGDQPA
FT                   DLEEKVQKISDLQILDRILDELFTADTIEEARAVIVGKIAGGLQ"
FT   gene            complement(179409..179585)
FT                   /locus_tag="Moth_0182"
FT   CDS_pept        complement(179409..179585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18517"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM22"
FT                   /protein_id="ABC18517.1"
FT                   /translation="MKEGREVIIAKAGTPVARPVPITSEKPERYPGSAKGQITIALDFN
FT                   APLPEAILKEFEE"
FT   gene            179681..179989
FT                   /locus_tag="Moth_0183"
FT   CDS_pept        179681..179989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0183"
FT                   /product="Excisionase/Xis, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18518"
FT                   /db_xref="GOA:Q2RM21"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM21"
FT                   /protein_id="ABC18518.1"
FT                   /translation="MTFRGGYLMSEIFYPPAELARMLKVSERTIRRWIQKGDLPALRYG
FT                   RQLRIPASALEKLGRPAAEISNKSDWLAKCRAARAMMPLRGDSAKILQQIRLDRADR"
FT   gene            179986..180465
FT                   /locus_tag="Moth_0184"
FT   CDS_pept        179986..180465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18519"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM20"
FT                   /protein_id="ABC18519.1"
FT                   /translation="MNEMDVRLKEVCVDACLVVKLVINEPDSALADALFAWWQEQGVQL
FT                   IAPVFCPVEIDSVIRRRTVITTPEERLTPEQAEIAFEAVQAIPLKTISVPGQRRRGWEL
FT                   AKELKLPVVYDSHYLALAELRNCDFWTSDARLYNNVKGRLPYVHLLSEFASELMR"
FT   gene            180494..180946
FT                   /locus_tag="Moth_0185"
FT   CDS_pept        180494..180946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0185"
FT                   /product="DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18520"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM19"
FT                   /protein_id="ABC18520.1"
FT                   /translation="MKEGRSLERFKFYSLTNEEKHSLLQRIAACLKGKEEIAFAYLHGS
FT                   FLGEGPFRDIDLAVYINDEGIDTDYFFYEMQLEDSLRQLIPFPIDVRVINRAPLSFKYS
FT                   VLKNGYLLIENVPNIRVDFEEHTLDRYFDFAPFRKRYFKETFGLEI"
FT   gene            180930..181379
FT                   /locus_tag="Moth_0186"
FT   CDS_pept        180930..181379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0186"
FT                   /product="Protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18521"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM18"
FT                   /protein_id="ABC18521.1"
FT                   /translation="MALKFDALKAGKLLAAFRQAQKRLQDLARLPKEEFLTDPDKIGSA
FT                   KYHFIVAIEAAIDLSNHIIARNNLRIPEDYADTFRILGEAGIFPPEFVTTLIKMTRFRN
FT                   RLVHIYWDVDSDTLYNILVNGLKDLDAYLKAMGKFFTGNKEEPYC"
FT   gene            181513..182016
FT                   /locus_tag="Moth_0187"
FT   CDS_pept        181513..182016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0187"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18522"
FT                   /db_xref="GOA:Q2RM17"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM17"
FT                   /protein_id="ABC18522.1"
FT                   /translation="MMVPGGRQRPGSRPGPPELIDYRLVLIGSMLPDIIDKPLGGVIFK
FT                   ETLGNGRIYAHTLVFLLFAWAAGLLWWRRYRRPGGLVLAGGSLMHHLLDGMWRYPTTFF
FT                   WPLYGWGFPRGHPEEWFWQWLAGLLHDPLVYVPEAAGGIVLLFFFGQLVYRGGVMEFLK
FT                   RGRF"
FT   gene            182302..184572
FT                   /locus_tag="Moth_0188"
FT   CDS_pept        182302..184572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18523"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM16"
FT                   /protein_id="ABC18523.1"
FT                   /translation="MRIKGLWSYLAVVVCLSLVLAGIPAMPTAAAASSDPVADLVNRLQ
FT                   PVYNCLDAGDKQVIQAAKDEIAGLSDDEIAKILKDKRLITEQVKNNLRVDEDNAASTLA
FT                   GMIKYAAGIYYSPDASTLENELQGFRSQYSSTFSQLLGSGVTVDDAWQFALATEANLPA
FT                   ALQSNLGNILEQFITGSSYDAVLNSFSDIVSDAASGVTSDFKDALTGLGWNIGLLMQVK
FT                   DALRSKVPDGKAAEQALLKGYIRSQTQPLGSTTLTVGNTQEYGLKVLNQFEVSSSIASV
FT                   LGWQSSDPSIASFNGNKLTANKPGTIRVRAYHPSAGTNPDFNNSLWLAEFQVTVNAASG
FT                   GGGGGGGGGGGGGGASQPGQSTSTTTDFGQVTVDKSTGSVTTTIDAAKAADLIAQASGP
FT                   VVFKADIPTDVTVKTATMELPAAVFTKAAEAGKALSLEVAGVKALLPAGVIPPEILADP
FT                   AATINFAFQVLDTTEAQAVTGNLPASMRQAADVIEIDLYTVKGDNQQMVTPAKPVTLTL
FT                   TYRPEGVDADKLGVYRYNVAAGTWEYKGGRVDKATNSISAVLNSFSKYTVLAYDKTFSD
FT                   IQGHWAQRDIEIMAARHVAAGISASEFKPEGQVTRAEFTAFLLRTLGISEDRSAANRFA
FT                   DIQPGDWYYGAVVTASRTGLVAGYEDGSFRPDKAISRQEMAAMLARALAYAGQKVDVAG
FT                   RVDDILSKFSDNGSLASWARESAAVAVESGLIVGRTATTFVPLGNATRAETVVMLKRLQ
FT                   DRI"
FT   sig_peptide     182302..182397
FT                   /locus_tag="Moth_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.756 at
FT                   residue 32"
FT   gene            184654..186300
FT                   /locus_tag="Moth_0189"
FT   CDS_pept        184654..186300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18524"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM15"
FT                   /protein_id="ABC18524.1"
FT                   /translation="MLRRVSTRVLICWTLLFLMLLSLVGGAVALAAGLDLPGLYDQLKN
FT                   DPTYQPYRQELLNEYLKLNSNEQAMDNDLRSFLADVQARLSQADTSSLKDEAGVNALVM
FT                   KTAAEVLFTDKKYTTLANALAATSDIQSILKGNFPPSLEPVRKEVVNALLGSGGQAAAG
FT                   GGGTAAPSAGTEEEIQRDTAAGVVTWRVNPEAAAGIKDNKLVLSLAGETAPTRTFSLPP
FT                   ALLQDLGQKKADLELDYGPVVLTLPAASLADLSSSGGADLTFRQESLDPARVKDVNGPG
FT                   YNGAGMVYTLTAGDKGGLPAGVPARIKYEERQGLDRDLLGVYQVKSDGSLVYLGGHGVD
FT                   GSPYLEFSLPGDGSYAVLEYRADFADLAGHWAARDVQVMAARHIAAGVGEGRFEPDRDI
FT                   TRAEFTSLLQRVLGLPVKGTVTGFSDVPADAWYAPSVAAAVRAGLVHGYEDSTFKPDNP
FT                   VTRAEMAAMLGNALALQGLAVKVEPGQVEAVLQPYRDQAAVPSWARPAMAAAVTAGIVG
FT                   GREGGLAPLERATRAEAIVMLERLMDKAGWR"
FT   sig_peptide     184654..184749
FT                   /locus_tag="Moth_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(186397..187173)
FT                   /locus_tag="Moth_0190"
FT   CDS_pept        complement(186397..187173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18525"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM14"
FT                   /protein_id="ABC18525.1"
FT                   /translation="MTPATLSPRRYRDLTILDLDAQRSLVIACDSAGAIGPKEADVVRV
FT                   PGYVLGRFTARVALMEVLALGAWPVCVVNTLCVEPEPAGAAIREGVADEMRVLGIDPEK
FT                   TLTGSSEKNIPTTQSGIGITVIGLATTAELLMGRLAAGDTLALFGRPKVGTEVFLDDPE
FT                   IVDLKTVRLLLDQPGIREIVPAGSRGILAEARDLAALYGLQINWRPGLTGPALLKSAGP
FT                   ATCILAAGDRAALETTGRRAEKPFCLLGTLGPAASR"
FT   gene            complement(187170..187724)
FT                   /locus_tag="Moth_0191"
FT   CDS_pept        complement(187170..187724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18526"
FT                   /db_xref="GOA:Q2RM13"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM13"
FT                   /protein_id="ABC18526.1"
FT                   /translation="MAKPELSSPAVKASRWTARRLATLAMLIALSTVGANLKIPSITGT
FT                   PAFDSFPGFLGALILGPADGALIAALGHLLTAFTAGFPLTPPLHLVIAAGMAAVVALFA
FT                   IFYRFSPWLGIAAGIALNGLLLPALFIPLPGFGKAFFLAMVVPLLIASALNIVLAATAF
FT                   TSLRRVFPASYAAGRGKGEGK"
FT   sig_peptide     complement(187599..187724)
FT                   /locus_tag="Moth_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.737) with cleavage site probability 0.228 at
FT                   residue 42"
FT   gene            complement(188313..189716)
FT                   /locus_tag="Moth_0192"
FT   CDS_pept        complement(188313..189716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0192"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18527"
FT                   /db_xref="GOA:Q2RM12"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM12"
FT                   /protein_id="ABC18527.1"
FT                   /translation="MFLAAGTVLARPALAAAGDAVDTGDTAFILVASALVMLMTPGLAF
FT                   FYGGMVRQKNVLGIIMQCLATLALISVQWVLWGYSLAFGPDHLHLLGGLDWAGFRGVGL
FT                   EPNPLYAATIPHQVFAMFQLMFAIITPALITGAFAERMRFPAFLLFTLMWATLVYDPLA
FT                   HWVWGAGGWLRELGALDFAGGTVVHISAGVAGLVCALVLGRRRDYGRIPLPPHNLPMTV
FT                   LGAALLWFGWFGFNAGSALGANGLAGNAFVTTNTAAGAAILGWLAVEWLLHGKPTALGA
FT                   ASGAVAGLVAITPAAGFVTPPAALVIGGIGGALCCLSVAVAKVKLGYDDSLDAFGCHGV
FT                   GGTWGAIATGIFATKAVNPAGADGLLYGNAHLLGVQVVGVAAAWIFTAAVTYGILKVVS
FT                   LLTPLRVTAEEEEAGLDLSQHGESAYPDTGLAALEVAEGKRVTAPGELAVNWMVSQGNP
FT                   AGTGLFRQE"
FT   gene            190186..190524
FT                   /locus_tag="Moth_0193"
FT   CDS_pept        190186..190524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0193"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18528"
FT                   /db_xref="GOA:Q2RM11"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM11"
FT                   /protein_id="ABC18528.1"
FT                   /translation="MYKIEAIIRPEKFEAVKEALGRYGVHGMTVTHTLGCGQQKGKTEV
FT                   YRGTAYTIALLPKVKVEIVLEDRYVDDVVAIIAREARTGNIGDGKIFICPVQDAIRIRT
FT                   GERGAEAI"
FT   gene            190572..191093
FT                   /locus_tag="Moth_0194"
FT   CDS_pept        190572..191093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0194"
FT                   /product="Transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18529"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM10"
FT                   /protein_id="ABC18529.1"
FT                   /translation="MIDSKGVGMMDDVSLREKVQQALREDKDLRGYGLNADVAAGEVQL
FT                   QGIVDTLKEKERAERLVRQVPGVKGVANAVAISTDGTIRDEDVTLEVHEELDLDPRVDL
FT                   RHIGAESVDGHGTVVLKGRTEDPAEVEAAREAAAKARGVTRVVSQVKVGEEEMSLKDIF
FT                   HSQVNNDREG"
FT   gene            complement(191126..191566)
FT                   /locus_tag="Moth_0195"
FT   CDS_pept        complement(191126..191566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0195"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18530"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM09"
FT                   /protein_id="ABC18530.1"
FT                   /translation="MNSYMEAGKFVLDTYALLALLEEEPGAQIIADIISDDNNMSFLSL
FT                   INLGEAYYMLLRKKGEKAAAELVETIFADEGITLIECPWTRIKEAARIKAGGGLSYADS
FT                   FVVSLAQELQAPIITGDPEIRKLAPKLGFEVIWIGNATPLNL"
FT   gene            complement(191563..191811)
FT                   /locus_tag="Moth_0196"
FT   CDS_pept        complement(191563..191811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0196"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18531"
FT                   /db_xref="GOA:Q2RM08"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM08"
FT                   /protein_id="ABC18531.1"
FT                   /translation="MYKITVSQKGQIVIPLEIRKNYGLKKGDQLAVEDNNGIITLRPLP
FT                   RHPFLALRGKYKSSSPKDKLTTVLIKERTAERFREKG"
FT   gene            complement(191849..193819)
FT                   /locus_tag="Moth_0197"
FT   CDS_pept        complement(191849..193819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0197"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18532"
FT                   /db_xref="GOA:Q2RM07"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM07"
FT                   /protein_id="ABC18532.1"
FT                   /translation="MRILLTTLNAKYIHVNLALRYLRACCRDLPHTFILDEFTINDHPE
FT                   HIAAAIYRHRPDLVAFSCYIWNIEPTLAVAAILKKVRPELTILCGGPEVSFDTAAFLAQ
FT                   NPQIDLVITGEGEIPFRALLEQLAGQQRPPAGNREEPLTASMYRPAGGRPAPGPVPDPA
FT                   AIPGLAWRRGAETIVNPPAPPLRDLDTIPFPYQEDLDAAGNELSQRTVYYETSRGCPFA
FT                   CGFCLSSTTEGLRYFSLERVRDDLERLLKAGVREIKFVDRTFNAHKKRALAIWEFLLSR
FT                   RPRARCYFEIAGDRLDEEMLAHLNRVPPDLFQFEIGVQTIDAGVNARCNRRQDWARLAA
FT                   NTRRLREMGSIRLHLDLIAGLPGETYAGVGESFDAVVALKPHEIQLGFLKLLKGTTLRA
FT                   RADEFGYLFLDRPPYQVLASSAITYEEMLRLHAIEGLLKYYGNSHLADHAFAYLAATAF
FT                   DGSYFAIYEALAAWWEARGLLRRGHSQRDLFNHLASFAIHLARGIATRVTVPPLPGYHD
FT                   SILEINSHGDTPASGAEHSGCARNLTPAQLDRFYQLLKFDCLCRDRSRNFPGWMPPSPL
FT                   TEEERSNWMARITTPRSMEKYMPGLVKESPANLRRHGFIELFPCHPERPEEDNPTIVFF
FT                   YYGPPGSETRVYYLQAPPLVV"
FT   gene            complement(193951..195123)
FT                   /locus_tag="Moth_0198"
FT   CDS_pept        complement(193951..195123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0198"
FT                   /product="Thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18533"
FT                   /db_xref="GOA:Q2RM06"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RM06"
FT                   /protein_id="ABC18533.1"
FT                   /translation="MYTSLLVRYGEISLKGNNRPYFEDKLLANMRRALAGLPPRRMRKT
FT                   FGRVFVELHDDLEAVARRLQRVFGIVSMSPVATAPLELEAIKKAALAVLKDSPGSTFKV
FT                   QAQRPNKRFPLTSPEVNQELGAYLLTHSQGQRVDVHHPDRVIHVEIRDEGAYIYSRIIP
FT                   GPGGLPVGVTGRGLLLISGGIDSPVAGYMGMKRGLELTALHFHSFPFTSERSKEKVIDL
FT                   CRVLAGYSGPLRLVVAPFTNIQKAIRQNCPQEFYVTIMRRMMFRIARAVAAKEEAPAIL
FT                   TGESLGQVASQTLQSMAVINKVVDLPVLRPLVAWDKSEIIEVARRIGTYDISIRPYEDC
FT                   CTLFVPKHPATKPPLARVEAAEKNLAVVELVAECLENLEILTVEPEADVV"
FT   gene            complement(195342..196490)
FT                   /locus_tag="Moth_0199"
FT   CDS_pept        complement(195342..196490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0199"
FT                   /product="Aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18534"
FT                   /db_xref="GOA:Q2RM05"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM05"
FT                   /protein_id="ABC18534.1"
FT                   /translation="MAIIYLDNSATTAALPEVAIAVKEMLTENYGNPSSLHGLGIKAEK
FT                   ALGEARRQVAGLIGARPTEIYFTSGGTEANNWALLGIARARRRQGRHLITTAIEHPSIL
FT                   ATCRRLEADGFEVTYLPADARGVIRLADLEAALREDTILVSVMSVNNEVGSRQPVADIA
FT                   RLVHSRSRAVLHVDHIQGYGKIPLNCHEAGIDLMSLSGHKIHGPKGVGALYIKEGLRLE
FT                   PLLTGGGQEAGQRSGTENTAGIAGFGVAAQLAAADFARRTARMQEIKLELARRLVAEIP
FT                   GAVINGPPPEEGAPNIINVSFPGVRAEVLVHMLEQRGIYVSTGSACHSRRESASHVLQA
FT                   LHLERWRQDGAIRISLGALNRLEEVEPTVEAFKECVQELWSL"
FT   gene            196651..197652
FT                   /locus_tag="Moth_0200"
FT   CDS_pept        196651..197652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18535"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM04"
FT                   /protein_id="ABC18535.1"
FT                   /translation="MQRVEKALSRHQLDLLSLPNVVGVGKGFKSVRGQTTKKPALIILV
FT                   EKKLPASRLERGARVPQVLDEAETDVLEVGELRLLARTDYRRPAQPGMSIGHYKITAGT
FT                   FGAVVKDRQTGEPLILSNNHVLANISNGSDGRASVGDPILQPGPYDGGTNEQVIGYLER
FT                   FVPINPVVQEVTCGKALRFERALNRLVHLVRPYYQVRMQKITAAANIVDCAVARPVKKD
FT                   AITPEILELGPVRGVREPQLGMEIVKSGRSSGVTRSTIKVLQATVKVVLDEGLTGLFSD
FT                   QFVTGPIAQPGDSGSLILDKENYAVGLLFAGSDQTTVGNYIQNVLDKLDVEF"
FT   gene            complement(197705..199084)
FT                   /locus_tag="Moth_0201"
FT   CDS_pept        complement(197705..199084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0201"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18536"
FT                   /db_xref="GOA:Q2RM03"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM03"
FT                   /protein_id="ABC18536.1"
FT                   /translation="MTRKLSTILLSLALLLAIGWGLWERANRLTLANAVEAGGQRDFYN
FT                   LLNYVEQAQVSMGKTLASSSPRQQAVHLTEAWNQAAAAQHSLTQLPTPGFKPVNTSKFL
FT                   SQTSDYSNYLAQKLARGEEMTPQERQQLASLREEMGRLAADLHQTEGQVAGKTLRWSSF
FT                   YGFKMPSLPRTIAGRALPVEARPGPLDGFVNTDRRLQTLPSLNYDGPFSDHLEKQRPLG
FT                   LGGGEVTQAEAERRAMNFSNAASNSNYRVQATRTSNGRIPTFSLRLLDSRRPNVTTHID
FT                   VSKQGGQIVSLLNTRPVGAPTLDAAAALEKARAFLQAQGFTGMQPTYTVRTDNNQVITF
FT                   AAKEGDVILYPDQVKVKVALDNGEITGWDATPYYMSHHKRDLPRPKLTPEQARAKINPG
FT                   IKVEGVRLALIPLPGGQEKLTYEVKTKMDNTYYLNYINALTGEEEKVLQIIDVPGGQLT
FT                   M"
FT   sig_peptide     complement(198980..199084)
FT                   /locus_tag="Moth_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.560 at
FT                   residue 35"
FT   gene            complement(199115..199606)
FT                   /locus_tag="Moth_0202"
FT   CDS_pept        complement(199115..199606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0202"
FT                   /product="Cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18537"
FT                   /db_xref="GOA:Q2RM02"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM02"
FT                   /protein_id="ABC18537.1"
FT                   /translation="MLPRRLRLLLPVLLAATLLSAALWQYHHQGQAPGAIPTQAGTPVG
FT                   TSDEMNLLARLIAAEAGDEPYEGQVAVGAVVLNRVRSPLFPSTISGVIFEPWAFESVSN
FT                   GRIWQVTDLASPSRAAADALNGWDPTYGALFFWNPAKEVSPWIWTRSILTQIGRHVFAR
FT                   "
FT   sig_peptide     complement(199484..199606)
FT                   /locus_tag="Moth_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.703 at
FT                   residue 41"
FT   gene            complement(199700..200107)
FT                   /locus_tag="Moth_0203"
FT   CDS_pept        complement(199700..200107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM01"
FT                   /protein_id="ABC18538.1"
FT                   /translation="MEKTDLVEMLMQLLGPQQQQTLSFNELAGLVGLIDLLGILNLLNG
FT                   NVSVPARAGNAIQEALNAVLGQAGSGNLKPPGELAGLLGKNPALLTSLMNLLMSARESK
FT                   AAREKEAGEENTPTEEEQPQYHSRSSRFRNS"
FT   gene            200275..200508
FT                   /locus_tag="Moth_0204"
FT   CDS_pept        200275..200508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18539"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RM00"
FT                   /protein_id="ABC18539.1"
FT                   /translation="MGDHIVDPNLLAVIQSLKPYMSSRALQCTELAETLLEVLASEEAR
FT                   RVQEKLRNLRAEYKQTIQVSGLQKKEFRKNDK"
FT   gene            complement(200618..201028)
FT                   /locus_tag="Moth_0205"
FT   CDS_pept        complement(200618..201028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18540"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ9"
FT                   /protein_id="ABC18540.1"
FT                   /translation="MLSDCHLNTDEVELHIDNAVIRVIRRLTYDLPHEVSAFIPRAEIR
FT                   RRRYENGRLAWEEEVILNSLTVVHSPQRPPTGERPPAAGPGSGTIPAGPAGKSEGCGSV
FT                   PGIVPPPAAPAATHPAGRVAGSRPARLRLHYS"
FT   gene            complement(201122..201397)
FT                   /locus_tag="Moth_0206"
FT   CDS_pept        complement(201122..201397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18541"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ8"
FT                   /protein_id="ABC18541.1"
FT                   /translation="MLELNRPAEVVAMPVYEYRCAKCGVFEKEQRITAPPLTECPTCGG
FT                   PVHRIISRNIGVIYKAGGFYTTENRSQEYKNKAKEESKTSEVSKAS"
FT   gene            201662..203338
FT                   /locus_tag="Moth_0207"
FT   CDS_pept        201662..203338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0207"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18542"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ7"
FT                   /protein_id="ABC18542.1"
FT                   /translation="MGITVREALKLGGLRRAKVVAGEAGLERIIKYVDILEIPDPRGWF
FT                   RANELIITTGYAIRNDPRAQANLLLELARTNGAGLAVKFGRFIGSVPEEMRRLADELKI
FT                   PLLDVPDDIPYVEITNPLMAAIVNEQARQLEYSERVHRELTRVALEASNIQAVAAALAT
FT                   LVEREVVICDEELQPLAVSGAVSGKGSAGGSLQLPPEEIKRLHSAQKAVEITLWSRNVR
FT                   RRYFVAPIDVREHRYGYILVDGQTPLSELNQIALEHAVTVTALQMVKEEAVVEARRSLQ
FT                   RDLLEDLIAGALRHRELAISRAEALGILLEEPKVIMAIDIDDFTGYLLHQPGAQEANAG
FT                   VLKRRFHRAVNSCFMAFDRRVLTVQRSDSVVGILPANGREIRGAEDWRVLRGMLQELAA
FT                   SIQLKIARELDGVTVTIGISSIAADPMEISERYQEARTAIRLARRLNGKGTVAFWEDVE
FT                   LYHVLGQSGETLERFYRSVLGELDRPEVKNREELLETLRVYLECQGNVMASAAKLYIHR
FT                   NTMRYRLQRIEELLGRDLDSPDERLALWLALKARGLIRSEQ"
FT   gene            203466..204101
FT                   /locus_tag="Moth_0208"
FT   CDS_pept        203466..204101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0208"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18543"
FT                   /db_xref="GOA:Q2RLZ6"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ6"
FT                   /protein_id="ABC18543.1"
FT                   /translation="MLAVIRVLTTDDEDLLNAHGRLISERYGIPTRSYCIPDQPRGIYD
FT                   DETERVAVPKIVQLARRVEEEGAGAIFISCAADPALAEVRATCKVPVIGAGSAAAAVAL
FT                   AAGERIGVLNLMESTPAAVAAVLGRRMVAQARPEGVTNTRDLMTPEGKKQALKAAGLLV
FT                   EKGADVIVFACTGYSTIGLAGDIKKHLGVRVIDAVEAGGLIASYVLPR"
FT   gene            204139..205698
FT                   /locus_tag="Moth_0209"
FT   CDS_pept        204139..205698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18544"
FT                   /db_xref="GOA:Q2RLZ5"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ5"
FT                   /protein_id="ABC18544.1"
FT                   /translation="MEKHPRAFEPAVLILNIILSVLGSIIGLQILTTLGVTPNTAIIGV
FT                   LVALALSRIPGGWMAKYRSIHRQNLVQSTISGATFGAANSLLLPIGIPYLFGRPDLVVP
FT                   MLIGATMGMFIDWAMLYWFFDSRIFPGQAAWPPGVAAAEAIYAGDEGGKRAWLLVWGTI
FT                   IGIIGSYFKVSMSAFGVAFIGNVWALTMFGLGLLLRGYSVKLFGFDIDKLYIPHGMMIG
FT                   AGLVAGIQILLILLKGRKETTASGDAPAAANYTRSEKQVAKGLARGFGLYIVAALVLAM
FT                   LGGLYTSMPAWQLLFWAVFAAVSCILAEFIVGLSAMHAGWFPAFATALIFLVIGMALGF
FT                   PAPALALLVGFVASGGPAFADAGYDFKAGWILRGEGRDRGFELDGRWQQFLAGASGLVV
FT                   AWAMVTLTHGIYFRQGLFPPVDKVYAATIKAGVDAAIIKNLVLWAIPGALIQALGGSEK
FT                   QLGIMLATGLLILNPLAGYAVLAGILIRTLVLKFKGREAETPMTILAAGFIAGDALYGF
FT                   FN"
FT   gene            205740..206831
FT                   /locus_tag="Moth_0210"
FT   CDS_pept        205740..206831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0210"
FT                   /product="Protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18545"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ4"
FT                   /protein_id="ABC18545.1"
FT                   /translation="MGSRIILDNEVVEAAVLGGAVLGGGGGGSMEMGRQAARLAVELGS
FT                   PELITLDSLPEDAVLLTVSAVGAPAARTVYVKPVHYIRTVELFQKYTGQEIRGLITNEC
FT                   GGLAAVNGWLQAAALGIPVVDAPCNGRAHPTGVMGSMGLHRLSGYVSRQVAVGGNPQTN
FT                   SYVEVFASGSLETAAALVRQASVQAGGMVAVARNPVTAGYARENAAPGAIGRCIAVGRT
FT                   IIENRSRGPLPVIEGVAGVLQGEIAFTGRVAAVDLETTGGFDVGRVVVRDGDRLAELTF
FT                   WNEYMTLEIGSVRKGTFPDLLATMDLTTGLPLSSAEIKAGQEIAILHVHRDRLILGRGM
FT                   KAPELFQVVEKATGKEVIKYIFS"
FT   gene            206881..207819
FT                   /locus_tag="Moth_0211"
FT   CDS_pept        206881..207819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0211"
FT                   /product="Protein of unknown function DUF1177"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18546"
FT                   /db_xref="InterPro:IPR009561"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ3"
FT                   /protein_id="ABC18546.1"
FT                   /translation="MSFKQVITAYELLDSARVDGWAVAGLLKEAGLEDVEVKRITGPKG
FT                   STDFIKVRIPGSNGKMGGGEAPTLGIIGRLGGIGARPERIGFVSDGDGALAAVATALKL
FT                   GAMQKNGDTLTGDVIIATHICPQAPTRPHDPVPFMDSPVDIAEMNRNEVDPAMDAILSV
FT                   DTTKGNRVINHRGFAISPTVKEGYILRISEDLLDLMQIVTGKLPVVFPLTTQDITPYGN
FT                   GLYHLNSILQPCVATAVPVVGVAITAEVPVPGCATGATHLVDIEAVVRFCIEVAKAFGQ
FT                   GKCHFYDGEEFERLKALYGAMNHLQTLGKEQ"
FT   gene            207884..208555
FT                   /locus_tag="Moth_0212"
FT   CDS_pept        207884..208555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0212"
FT                   /product="AroM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18547"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ2"
FT                   /protein_id="ABC18547.1"
FT                   /translation="MTRKVGAITIGQSPRVDVVPEIKEILGDSIEVLEAGALDGLTREE
FT                   IAALAPGPGDYVLVTRLRDGSSVRIAEEKILPLMQARIDGVVAAGAEAVLLLCTGEFPP
FT                   FSCRRLILKPQLILHHFTAAVATGRRLGVIVPDAGQVEETRKRWAGVGSDLAVEAASPY
FT                   GPVDAIWEAAARLQAWQAELIVLDCIGFNMSMKREINRRTGIPVILPRAVAARTLIELV
FT                   S"
FT   gene            208572..209519
FT                   /locus_tag="Moth_0213"
FT   CDS_pept        208572..209519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18548"
FT                   /db_xref="GOA:Q2RLZ1"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ1"
FT                   /protein_id="ABC18548.1"
FT                   /translation="MPTLKEVARELLRVNMALEKGETLLVVTDTETAAIGEAIFQAGVE
FT                   SGAVASIIKMPPTARPGAEPPLPVAAAMEKARVVICPTRNSLTHTRARIQACQVGARVA
FT                   TMPGISEDMFFAGAVAANYDEVARLSTELARRLSTAQTALLVKDGLKLRLSLAGRQGVA
FT                   STGLYRHPGEAGNLPSGEAYIAPLEGRAEGETIIDGSVAGMGRLRGPIKVTIRGGRLAA
FT                   VEGPEGEELLKLLGDDPAARNLAELGIGTNEKARVTGNILEDEKVYGTVHLAFGDNTTF
FT                   GGETRAGVHIDGVITAPDLYLDGELVLSGGKIIL"
FT   gene            209675..211585
FT                   /locus_tag="Moth_0214"
FT   CDS_pept        209675..211585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18549"
FT                   /db_xref="GOA:Q2RLZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLZ0"
FT                   /protein_id="ABC18549.1"
FT                   /translation="MSRWRYRPLLWAVIILATLAAGVVVVNRVRLEEANKAVTVAVDFQ
FT                   QVQELARWSGLTTRETLIRLQQQGVNAVLFKEPTIADLQQEIWVKPGDEALAFFPAALQ
FT                   GQVRHDYTYLFTRDRELAGQLELQLENKVPGRLQVLDGPGFTALGVPLPVQELGNLGLG
FT                   FPVKDLEMARQLGLLIVPQVKNWYGANPATLAATLRPLAAYRDDLAALLFSDKDLPGYP
FT                   RYLVNLAAQVDQLQVPVGLVEFFPQTGINQLVMLLDKRAIRVHSISAEEMNTMSPAAAL
FT                   ERLELAARERNVRLLIVRFRFAPGSASWLEDNLNFVGKVSKMLAADGLTTGRAMPFAAF
FT                   PYSRLWVFLIGLGILAAGVLLLAELGLEGPGLVLGLLGLLAWTGVLGLNYQVLLARKIM
FT                   ALGAAIIFPTLGLLTAWSPEPRSLRTSVAILLRTALISLLGAVAIAAILADNTFILKIN
FT                   QFSGVKIAFIVPLVIFAAAVIIRREGRRTGTILRGWLDADLTVKLVILAVVVAAAGLVY
FT                   ISRSGNDGVGLLPFEGQMRSFLGNALLARPRTKEFLLGYPFLLLSLTLGYQHRYLLLWL
FT                   LGLVGQISLVNTYCHLHIPFLISLLRTFNGLWLGLLIGVLLVLAVRQAGHFWRRNGIWP
FT                   G"
FT   sig_peptide     209675..209779
FT                   /locus_tag="Moth_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.642 at
FT                   residue 35"
FT   gene            211573..212673
FT                   /locus_tag="Moth_0215"
FT   CDS_pept        211573..212673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0215"
FT                   /product="Polysaccharide pyruvyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18550"
FT                   /db_xref="GOA:Q2RLY9"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY9"
FT                   /protein_id="ABC18550.1"
FT                   /translation="MARVVISGYYGFQNAGDEAVLYSIVKALRSLEPDIEITVLSRRPE
FT                   QTAACLKVRAVDRWHPVRVAGAIRRADLVISGGGSLFQDVTGPKSLLYYLGIVLLARLL
FT                   RKPVIVYAQGLGPLKRHWSRWLTGRVLNRVQLISLRDSESRRLLEELGVTRPPVYVTAD
FT                   PVLGLEPENMDLRPGQDKWEQLELSGPVIGISVRSWPGYEECWPSLARVADELVAGGWQ
FT                   VLFLPFHFPADVDACRQVARLMHSPAVVLRENLDLPALMGLMGRLQFLIGMRLHALILA
FT                   SLMGVPFLALPYDPKVTALARMMEQPVAGFLASVSYTGLEAAVKQALAEREENARRVQA
FT                   AVAELRPLALDTARLVIEYLRKGARG"
FT   gene            212690..214291
FT                   /locus_tag="Moth_0216"
FT   CDS_pept        212690..214291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0216"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18551"
FT                   /db_xref="GOA:Q2RLY8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY8"
FT                   /protein_id="ABC18551.1"
FT                   /translation="MAVANDGKPARGPEGTPVARMARAASVVLVLNLLSRVLGFVRDAS
FT                   IAARFGAGPATDAYLVAYTIPFFLQTILGMAFVTVMVPVVTTYLVRGDRDQGWAVASAV
FT                   GNWTALILGLLTIVGLGVAPWLVRLMAPGFPAPVFDLAVKLTRIMFLSLAFMGTGMLVS
FT                   GILNAGYIFTSPALAPAVSNLVIIATVIFAGSAFGITGLAVGTVLSFVAYLLIQLPDLP
FT                   RLQFHYTCSLMAGHPAVRRIGRHLLPVCFSLAVVQLYLATNRFFASQLEPGSITALDFA
FT                   NRLVNLPLGVFVASVTTAIFPSLAEQAALNDRREMAHLTDRGLGLVALTILPAAVGMIV
FT                   LRVPLVQLVFQRGAFDPRATAMTAVAVLFYSVGLLAQAMHPILTRAFYALQDVVVPVVT
FT                   GIISVGLNILLSYFLAPRLGHGGLALANSLAASIYALMLYLALYRRLPELKVTLLLSTM
FT                   LRIFLAAMGMGLLVWLAGRGLHVFTWSRPLLGLLVRMTLLMGGGGLAFWVLARWLKVEE
FT                   VTFITAMIRRRLERVF"
FT   gene            214374..214805
FT                   /locus_tag="Moth_0217"
FT   CDS_pept        214374..214805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0217"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18552"
FT                   /db_xref="GOA:Q2RLY7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLY7"
FT                   /protein_id="ABC18552.1"
FT                   /translation="MDWNAIQGILPHRYPFLLVDRVLEVEAGRRAVGQKNVSGNEWYFS
FT                   GHFPGQPVMPGVLIMEALAQVGAVALLSLPEFQGRLALFGGMDRVRFRRQVVPGDVLRL
FT                   ETEIIKLKGRVGKGYGRAFVGEELAAEGELLFAVGEKIE"
FT   gene            214821..215870
FT                   /locus_tag="Moth_0218"
FT   CDS_pept        214821..215870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0218"
FT                   /product="Glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18553"
FT                   /db_xref="GOA:Q2RLY6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY6"
FT                   /protein_id="ABC18553.1"
FT                   /translation="MDILALALAGIVSFLLTPLLCRIAPRLGAVDKPNARKIHHTLMPR
FT                   LGGVAIYAGFMLAYWLGGYRHQEYLGLFLAGTFIMLVGIIDDIRSLSPRLKLLGQIIAA
FT                   VILVAFGVRVDFLTNPFDGLFILGKLAIPVTIFWLVGVTNALNLVDGLDGLAAGTSLIA
FT                   AVTIAVVAWFNGELVVAFLSLALAAAVLGFLPFNFHPARIFMGDSGSMFLGFNLAALAT
FT                   IGLTKSATVISLFIPVVILGLPILDTMFAIVRRFLNHRPIFAPDKGHLHHRLLAQGLSQ
FT                   RQAVGVIYLVDACLGGSAILLSRVATDQGVLILIGLAVIILVGCDKLGIIGRGGLARAK
FT                   TRHNTLHMF"
FT   sig_peptide     214821..214910
FT                   /locus_tag="Moth_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.838 at
FT                   residue 30"
FT   gene            215876..216118
FT                   /locus_tag="Moth_0219"
FT   CDS_pept        215876..216118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18554"
FT                   /db_xref="InterPro:IPR019466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY5"
FT                   /protein_id="ABC18554.1"
FT                   /translation="MVALDGRNYLLLALLLLTLGLGLAGGARAGAAAAGSQEDPVVTRS
FT                   YVQEAVDNRLEPLRQQLDAASKRLAALQQRLDSLK"
FT   sig_peptide     215876..215971
FT                   /locus_tag="Moth_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.794 at
FT                   residue 32"
FT   gene            216715..217476
FT                   /locus_tag="Moth_0220"
FT   CDS_pept        216715..217476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0220"
FT                   /product="Protein of unknown function DUF421"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18555"
FT                   /db_xref="GOA:Q2RLY4"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY4"
FT                   /protein_id="ABC18555.1"
FT                   /translation="MKFVEVFLQTLLAFFAILIYTRILGKQQIGQLTFFEYINGITFGS
FT                   IAAVLATDTAPNQTWMHFLGLTLFAFFTWLAGYAVLVSRPARKLISGEPTVVVHNGKIL
FT                   EENMKKMRYNFDELAMQLRQKNVFDIADVEYAIMEPDGDLSVLLKSQKRPLTPSDLKLS
FT                   TKYEGVPTELIEDGEILFQNLRQNHLDEKWLIQQLQAQGIQDISQVDYAVLRSNGTLYV
FT                   NTKEDDIINPVDITDAPESPVKTEKEEQDRP"
FT   gene            217500..218915
FT                   /locus_tag="Moth_0221"
FT   CDS_pept        217500..218915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0221"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18556"
FT                   /db_xref="GOA:Q2RLY3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY3"
FT                   /protein_id="ABC18556.1"
FT                   /translation="MAIKFGTDGWRAVIADEFTFANVRLVTQATANYLLREAGSGKIII
FT                   GYDNRFLAPEFARAVAEVLTASGFTVYLPSRAVPTPVTAWAIKHYQAMGALMLTASHNP
FT                   PEYCGLKFIPEYAGPAVPAITSAIEKEIAAVINGGEVKTLNLDEARGRGLVRELEPEAD
FT                   YREYLHGLIDVEALRKAGLKVVVDPLYGAGIGYLEDFLRGAGCQVQAIHNYRDPLFGGD
FT                   LPDPSARGLEELSRRVRETGAHLGLALDGDADRFGVVDGDGTYLTANQVLYLVLAHLIM
FT                   DRHYRGPVARTVATTHNLDRLARAHDLEIIETPVGFKYIGEALREKGCILGGEESGGLS
FT                   IRGHIPEKDGILATALVAELRAVRGRSLGEILADLHSSYGHLVNQRLDIKVDPATKERV
FT                   LQELPDFAPAKVAGIPVTGRLTVDGVKLTLADGSWVLLRPSGTEPLLRLYAEAPDAGRL
FT                   RLLQKEITTALRI"
FT   gene            219138..219569
FT                   /locus_tag="Moth_0222"
FT   CDS_pept        219138..219569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18557"
FT                   /db_xref="GOA:Q2RLY2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY2"
FT                   /protein_id="ABC18557.1"
FT                   /translation="MGYQAPVTLLASVVSLALAYGWLWRRYQAWGLNYYRLVILVRNQG
FT                   EYLEGLLRQFFSWRYWHGLPLELWVVVEAPCEATLAILHHFLYPYPCCRVLCIARDSPV
FT                   TGAVPALTAGDGEVLDLREETNFFRAGAKLYQVYSKMLT"
FT   gene            219634..220707
FT                   /locus_tag="Moth_0223"
FT   CDS_pept        219634..220707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0223"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18558"
FT                   /db_xref="GOA:Q2RLY1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY1"
FT                   /protein_id="ABC18558.1"
FT                   /translation="MGEKLGRADWLAAMLVTVGGVFLSLAAPPGPTVYWGLTWSIFNGL
FT                   ILAIGILSTGFITRVLILGLNLILIAGWQLTSGWPSATSLPLLLFLPVLVPLYRKQRKE
FT                   ILAGLVGGLILGGYSTLKENLANPSSWAILGGWVAIAGFFYYLMVGLVVKARQAASLQA
FT                   EVEYTRHEYQEACKRLAAMEMAAITDDLTGIYNYRYFVQAFSNLLNSRQQPRYLAVLML
FT                   DIDYFKEINDAYGHLTGNRVLAELATILKECTREQDVVTRFGGEEFALILPDTDYHGAL
FT                   QVAERIRKAIAEHTFQAEGTAIHVTVSAGVAVWPVDGTDKKDIIARADRALYQAKTTGR
FT                   NSVCAYQFLKKERGVHE"
FT   sig_peptide     219634..219714
FT                   /locus_tag="Moth_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.715) with cleavage site probability 0.677 at
FT                   residue 27"
FT   gene            221141..222502
FT                   /locus_tag="Moth_0224"
FT   CDS_pept        221141..222502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0224"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18559"
FT                   /db_xref="GOA:Q2RLY0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLY0"
FT                   /protein_id="ABC18559.1"
FT                   /translation="MHTPLEDLCHWLYLEGEIKLLPGVGYDPDGRPRCRRCGQATGLLK
FT                   VNCAACSREDCLLCEECLAMGQSRRCRPLYARPWPFAAGSPARPAAVVRPLLRFDLTPA
FT                   QADAYREAEGFASQDKEKECLLWAACGAGKTEVAYGAIAAALARGRKVLYACPRKEVIR
FT                   ELHPRLQAVWPGLRIQALYGGSQGKYGEADLILATTHQALRFYRRFDLVILDEVDAFPL
FT                   AGDPMLYYAVERARREHGQILWLTATPPPEMVARVRKGKLAVIYLPARYHGHPLPEPEF
FT                   VREPFLRPPGTGPLPRSMVNCINTTLGAGLQLLLFVPAVSLVEGVAAWLLDSWPGQAPG
FT                   GAWVRGCHAAHPRREEVIAAFRRGEFPVLVTTTVMERGVTIPRLNVLVLYAEEGRVFTA
FT                   STLVQIAGRAGRSAAYPTGRVWFIGRHLSPAIAEAARQIREFNRLARRRGYLTR"
FT   gene            222680..223348
FT                   /locus_tag="Moth_0225"
FT   CDS_pept        222680..223348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0225"
FT                   /product="Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18560"
FT                   /db_xref="GOA:Q2RLX9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX9"
FT                   /protein_id="ABC18560.1"
FT                   /translation="MDRGLFCPQCHQELYSWQEKYHPCRYCGRLLAAGGGAVCRQCREE
FT                   LPPFRRARAVGAYRGILKELIWAFKYQGRRSLAAPLGQLLAGVVVKELGSARPHLVIPV
FT                   PLTAARLQARTFNQAELLARALGRELGLAVSGQALARMRETAPQVGLSRRERWQNLAGA
FT                   FQVQEPALVKGHRLLLVDDVMTTGATAAACTGALLAAGAAVVEVVTLATGIDSIANISP
FT                   "
FT   gene            223728..223925
FT                   /locus_tag="Moth_0226"
FT   CDS_pept        223728..223925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0226"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18561"
FT                   /db_xref="GOA:Q2RLX8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX8"
FT                   /protein_id="ABC18561.1"
FT                   /translation="MQGKVKWFNPEKGYGFIEREDGKDVFVHFSAIQEEGFKTLAEGQE
FT                   VEFDIVEGPRGPQAANVIKC"
FT   gene            224070..224642
FT                   /locus_tag="Moth_0227"
FT   CDS_pept        224070..224642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0227"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18562"
FT                   /db_xref="GOA:Q2RLX7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX7"
FT                   /protein_id="ABC18562.1"
FT                   /translation="MGNNRKKGSERSASRMELIIRGKNLPVTDALRQYIAKRLGKIERY
FT                   LDGVDEIQVNLAVTRDKHVVEVTIPLNGYILRGEEATGDMYGSVDLVVEKLEKQIAKYK
FT                   TRLNKKIKNGTIKEFAAGQPEEENGPEPRLIRTKRFPIKPMPVEEAILQMNLLGHSFFV
FT                   FSNAETEEVNVLYRRRDGNYGLIEPEY"
FT   gene            224792..225475
FT                   /locus_tag="Moth_0228"
FT   CDS_pept        224792..225475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18563"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX6"
FT                   /protein_id="ABC18563.1"
FT                   /translation="MPETKKGEPGSGDYERVICQIKGVLGARLVTEPDGSISEIHIMAV
FT                   SGRNPKQIVRDVESAILVQLGVAVDHKKISIVQVELPQLPGEVAEERLSDTQGDRLRLV
FT                   SINLFTRGLETEATVEVEAGTGGTIYQGHAFGPNAPEYNLRLVAAATVNALEKCCGSNW
FT                   SIALEDLVWVEVAHHRAAVCAIILVTHQGSEYLVGAALADGDDRQAAARAVLKALASRC
FT                   YHVND"
FT   gene            225695..228385
FT                   /locus_tag="Moth_0229"
FT   CDS_pept        225695..228385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0229"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18564"
FT                   /db_xref="GOA:Q2RLX5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLX5"
FT                   /protein_id="ABC18564.1"
FT                   /translation="MVLGILRNLLDDNARDIKKLSRQVEAINALEPEIQALSDSDLQAK
FT                   TPEFRRRLERGETLDELLPEAFAVVREASRRVLGMRHFDVQLMGGIVLHQGRIAEMKTG
FT                   EGKTLVATLPAYLNALTGRGVHIVTVNDYLARRDSEWMGRIYRFLGLKVGLIVHGLDAA
FT                   ERREAYNADVTYGTNNEFGFDYLRDNMALHPEEMVQRELNYAIVDEVDSILIDEARTPL
FT                   IISGMAEKPTEMYYTVAAIIPRLQPNIDYNVDEKAKVATLTEAGVAKVEKMLGVDNLYD
FT                   DANMELAHHVNQALKAHTLMKRDRDYVVKDGQVIIVDEFTGRLMFGRRYSEGLHQAIEA
FT                   KEGVKIERESQTLATITFQNFFRMYDKLAGMTGTAATEEEEFRKIYNLDVVVIPTNKPM
FT                   IRKDYPDVVYRTEKGKFEAVVEEIRERHAKGQPVLVGTISIEKSERLSEMLKKRGIPHQ
FT                   VLNAKYHEKEAEIIAQAGRLGAVTIATNMAGRGTDIILGGNPEALAKEKMRQKGYSPEI
FT                   IAAATAIKVDEGDPEVMAARQDYQQFLAAARRETEEEHRRVVELGGLHIIGTERHESRR
FT                   IDNQLRGRAGRQGDPGSSRFYVSLEDDLMRLFGSDNLTGILDRLGMDDSTPIDHPLVSR
FT                   SLEQAQKKVEAHNFDIRKHVLEYDDVMNKQREIIYRQRREVLTGADIRPTIEDMIKTVV
FT                   DQTVDRFAGESKYPEEWDLAGLLDYAEQLFLPGCDREALANAIKEMEKEEVYGFLREKA
FT                   MEAYRQREEELGPETLREIERLILLRVVDTKWMDHLDAMDQLRQGIGLRAYGQQDPLVA
FT                   YKFEAYQMFNDMIASIQEDVVRYLYRVKVVQPQAERPRQVVENRYAGEASGPRQPVRRE
FT                   HKVGRNDPCPCGSGKKYKKCCGAGK"
FT   gene            228873..229865
FT                   /locus_tag="Moth_0230"
FT   CDS_pept        228873..229865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0230"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18565"
FT                   /db_xref="GOA:Q2RLX4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX4"
FT                   /protein_id="ABC18565.1"
FT                   /translation="MLAPGFWEDRARAEAVGKRLTYLKEKLARYRELESKCADVRELWQ
FT                   LALAEDDHSLEEEIARDLAAVEGKVEGQLLATLLNGPYDRHNAILSLHPGAGGTESQDW
FT                   AAMLLRMYNRWCEDRGYQVELLDYLEGEEAGLKSATILVKGENAYGYLQAEKGVHRLVR
FT                   ISPFDAAGRRHTSFASVDVIPEVEADEEVEINPDDLKIDTFRSQGAGGQHVNKTDSAVR
FT                   ITHLPTGIVVTCQNERSQHANRLSAMKILQARLAALKRQEQEAELAQIRGEQREIAWGS
FT                   QIRSYVFHPYSLVKDHRTGVETGNIQAVMDGQIDPFIQAYLHWQRRKQG"
FT   gene            229959..231398
FT                   /locus_tag="Moth_0231"
FT   CDS_pept        229959..231398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0231"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18566"
FT                   /db_xref="GOA:Q2RLX3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX3"
FT                   /protein_id="ABC18566.1"
FT                   /translation="MNWGLINQAKPGKERIALINARAHLELAKKYVTEKVLQEAFSYME
FT                   KNPEENFPRILNTARLLAREEVHKQQIAKVLEAYRTNPSIHAYVNRLFKVHPNVKQRLI
FT                   YNWFVNAMLLGIPRQHQVSQETGVHIPNFFLLDPTSDCNLRCHGCWAGEYAHHDTLELD
FT                   LVDRLCREAKAVGIYWLAMSGGEPFRWPHLFELAERHPDMAFMLYTNGTLIDDAVADRM
FT                   VEVGNITPAISLEGWRERTDARRGRGVFDRVMAAMDRLRERGLVFGVSITITRENAEEV
FT                   TSDEFIDFLLEKGVVYGWSFHYIPIGRDPNPELMVTPEQRAYLAERIPYIRNHKGLQIA
FT                   DFWNDGELTLGCIAGGRRYFHITASGAVEPCAFIHFSMDNIKEKSLLEVLQSPLFRAYQ
FT                   RRQPFSDNLLRPCPLIDVPEGLRQIVAETGAKPTHPGADTALKGSIGAYLDANAARWGE
FT                   VADRIWRERHPEPQKELTAGK"
FT   gene            231440..232132
FT                   /locus_tag="Moth_0232"
FT   CDS_pept        231440..232132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18567"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX2"
FT                   /protein_id="ABC18567.1"
FT                   /translation="MLTRRRRQFLDKIKKIYQETGKPVHYIAVAEALKVSKWTAYDVLL
FT                   ELEKEGFLERQYIVNSNEKTPGRSMVMFVPSSLAASLEGSGGNTSSFVLDWQQARARLL
FT                   DALANLLPREAGQVAGELLQEMPGKTNPVITSAYTLTILLVYLKSLGERALQVVRSALD
FT                   KASRPEAGLFLATGTGLGLAVNMLSQNPLAGQLAGYLNRLQEHIENLTGREHKLLLDFL
FT                   HEALERVV"
FT   gene            232197..233861
FT                   /locus_tag="Moth_0233"
FT   CDS_pept        232197..233861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0233"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18568"
FT                   /db_xref="GOA:Q2RLX1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX1"
FT                   /protein_id="ABC18568.1"
FT                   /translation="MSLRRRYIHLNRYRQVVNVLARYGFGYLLDQVGLGELILRRSREE
FT                   APLSLGQRLRLALEELGPTFIKLGQLLSTRPDLLPADIISELTRLQDRVPPFPFADVRK
FT                   AVEEELGQPLEELFASFDPEPLAVASIGQVHLATLPDGSQVIVKVQRPGIARQVRVDLE
FT                   ILFDLARLAQRHTPYGKIYDFNQMAAEFARALTEELDYTREGRNADRFRENFAGDASVY
FT                   FPAVYWDYTTRGVLTQEYVEAVKLNNLEEIDRRGYSRRRIAVNLARAVYQQVLVDGFFH
FT                   GDPHPGNLAVLPGEVIVFMDFGLTGTLTEELKEQFVNLVLGIIRRRSQDVLRTIIAMGM
FT                   VPAEVDRGALRREIEALRDKYYHLSFRQISLGQAIEELLQLAFRYHLRMPPELTLLGKT
FT                   LLTLEGLVRKLDPELELAELAEPYGRELLRRRFSVRFLWRALTENLASGWEVMQSLPRQ
FT                   FQHLLDLAERGELTLRVEPLHLRGLVRQIDRIINKLTMSVVLLAFSIIMASLIISTALG
FT                   APTNSLFFRLPTLEVGFGAAGMMLLWLLVTIWRGGRD"
FT   gene            233948..234205
FT                   /locus_tag="Moth_0234"
FT   CDS_pept        233948..234205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0234"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18569"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLX0"
FT                   /protein_id="ABC18569.1"
FT                   /translation="MPYRITNDCIACGDCTVVCPRKAIVLEGSTYNTVGDINSTTDVVR
FT                   DGAMDEPPEKLVAFYRITAGCNNCGCCREVCPAGAIIWED"
FT   gene            234301..235146
FT                   /locus_tag="Moth_0235"
FT   CDS_pept        234301..235146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0235"
FT                   /product="Protein of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18570"
FT                   /db_xref="GOA:Q2RLW9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW9"
FT                   /protein_id="ABC18570.1"
FT                   /translation="MHRKAWADYLGITAGTLVTALGLVLFLVPNRIAAGGVSGLATVLH
FT                   YVFGWPVGLTMLVLNIPLFLAGLKVLGLEFGLKTLYGTIILSVFTDTLALWLHAPTSNT
FT                   LLASLYGGLLSGVGMGIVFRSGGSTGGTDLAALLFRHYLHISAGMGLLMVDALVISLAD
FT                   LVFNVELALYALVALFLTSRAIDAIQEGGGYARAALIISDKAEEIARRVLVELDRGVTG
FT                   LAGRGYYTRQEREVLLVVVQRAEVSRLKDLVASIDPEAFVIVSNVHEVLGEGFGYFNRL
FT                   "
FT   sig_peptide     234301..234405
FT                   /locus_tag="Moth_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.492 at
FT                   residue 35"
FT   gene            235167..235982
FT                   /locus_tag="Moth_0236"
FT   CDS_pept        235167..235982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0236"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18571"
FT                   /db_xref="GOA:Q2RLW8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW8"
FT                   /protein_id="ABC18571.1"
FT                   /translation="MEKDLQSLMATARRIRRDIVRMVGAAGSGHPGGSLSAVEIMTALY
FT                   FKVMRLDPERPDWPERDRFVLSKGHAAPVLYAALAERGFFAVDKLDTLRRLGSPLQGHP
FT                   DRKSLPGVEVSTGSLGHGLAVANGMALAGRLDGRDYHVYVLLGDGELEEGMVWEGAMAA
FT                   AHYHLDNLTAIVDHNHLQIDGRVEEVMSPEPVADKFRAFGWEVMTIDGHDFGQILDALE
FT                   RAREVKGKPTVIIAETIKGKGVSFMENQAGWHGKAPKPEEVEKALAELA"
FT   gene            236226..237161
FT                   /locus_tag="Moth_0237"
FT   CDS_pept        236226..237161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0237"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18572"
FT                   /db_xref="GOA:Q2RLW7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW7"
FT                   /protein_id="ABC18572.1"
FT                   /translation="MTKIATREAYGKALVELGRQNSQVVVLDADLSKSTMTRYFAQEFP
FT                   ERFFNMGIAEQSLMATAAGLGLSGKIPFASTFAVFATGRAYDQVRNGIAYPKVNVKIAA
FT                   THAGLTVGEDGASHQAVEDVTLMRAIPNMTVIVPADGEETRQAVFAAAAYQGPVYIRLG
FT                   RPAVPVIYNEDYRFQIGRAHTLRRGKDAAIIACGVMVHEALRAAEELAAAGLEVMVVNM
FT                   STIKPLDREAVLAAAATGAVVTAEEHTVIGGLGSAVAEVLATERPVPLAMVGIRDTFGE
FT                   SGKPDELMAKYGLTARDIVAAVKRLKGKKD"
FT   gene            complement(237328..238362)
FT                   /locus_tag="Moth_0238"
FT   CDS_pept        complement(237328..238362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18573"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW6"
FT                   /protein_id="ABC18573.1"
FT                   /translation="MPENEGQPRPPHHPYDKGYRQLLADKRVFLELLKTFVREAWVEAI
FT                   DADDLILVNKSYVLQDFSEKEADVVYRLKTRNRNVIFYVLLELQSTVDYLMPFRLLLYM
FT                   VEIWREIYNNTPQGERESKHFRLPPIIPAVLYNGAGSWTAALSFKEMLNSYQDFSGHLL
FT                   DFRYLLFDVNRYSEEELIRAANLIAGIFLLDQKMQPEDLAGRLQKLAGVLRRLTPDEFR
FT                   HFTTWLKNVVQPRMPGDFSEKIDGILNASNPWEVERMIYNLELTLEEMQRQALLKGLKE
FT                   GEQKGKLEGKLEGKLEGKLEGKLEGKREVARNLLLLNVDIETIIKATGLALEEINALKK
FT                   QMEQ"
FT   gene            complement(238793..239140)
FT                   /locus_tag="Moth_0239"
FT   CDS_pept        complement(238793..239140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0239"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18574"
FT                   /db_xref="GOA:Q2RLW5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW5"
FT                   /protein_id="ABC18574.1"
FT                   /translation="MLRFGESLKELRQRKGLRQEDVARMVGVERPTVANWERGTKQPGL
FT                   ETLVRLSRLFGVSLDELVGVERAATPLPLASYRSLAADPLVKLLAERTGVPAKNIAAFI
FT                   AALQIPDDVLP"
FT   gene            239276..239521
FT                   /locus_tag="Moth_0240"
FT   CDS_pept        239276..239521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0240"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18575"
FT                   /db_xref="GOA:Q2RLW4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW4"
FT                   /protein_id="ABC18575.1"
FT                   /translation="MRTALRRVRLQAGLTQSELARLVGLTRASYTNIEKGHKNPSVGTA
FT                   LRIARALNRPVEELFADESPAVQDVKSEGRAMRKGG"
FT   gene            239756..243187
FT                   /locus_tag="Moth_0241"
FT   CDS_pept        239756..243187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0241"
FT                   /product="Glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18576"
FT                   /db_xref="GOA:Q2RLW3"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW3"
FT                   /protein_id="ABC18576.1"
FT                   /translation="MSAQSLTKSFKKARRAVAVVAVLALLAALLPAVPAWAADVTTINI
FT                   SNPTSTSPKYVKAGETFTVQYTTDGQGTGYVRFSLVNATGTRELAVDQVTFPVTSGSKV
FT                   LTVPADMADGTYDLKVEAREQYQANWYPTTVNGAVIVDSTPPSITASTLTSPNGGENWK
FT                   VGTSQNITWRSTDISDDNLKGINLYYSTDGGANWTLIEGNKTNDGTYSWTVPGAISTNC
FT                   KVKIEAEDMAGNKVSDVSDGTFTIYGVDNSAPTVSLTAPANNAWVGGTYSVTANASDSE
FT                   SGIASVRFEYSTDNGSNWTTIGTATSSPYSVSWSTASIADGATVLVRATATNGVGVTKT
FT                   SDPVTVRIDNSAPTVSLTAPANNAWVGGTYTVTADASDSESGIASVRFEYSTDNGSNWT
FT                   TIGTATSSPYSVSWSTASIADGTTVLVRATATNNAGVEASDTRTVTVDNSAPSSTGVTA
FT                   PAAGAVWKIGTTQEIKWNPFTDAKNNLLPNPITIKLSTDGGTNWTTIAANEANDGTYTW
FT                   VVSGVPSQNCKIKIEATDTAGNTGEAVSDEFTIWGQDTSGPTVALSGVNNNDKVKGTVT
FT                   LNATASDSESGIARVKFEYSTDNGSNWTNIGTDTSSPYSVNWDTTSGIANGTTVMVRAV
FT                   ATNGVGAEVADVRTGILVDNSPPSVTLQQIPNNLIGATCTIKADASDNESGIASVKFQY
FT                   STDNGNTWSDIGTATAPNAEGYYHVTWNVPLADGTTGVQVRATAVNGVGLESAPSTATG
FT                   LTVDKTPPSIKTNTLASPNGNERWARGSKQSITWTSGDITDNHLGATPVSLYYSTDGGA
FT                   NWTPIAADETNDGTYDWVVPAVISDKCRVKIEVRDQAGNVASDISDADFTIYAVEQSAP
FT                   DVTVNSPNGGESYTPGSSVVITWTAADDTTPRADLKVDLYYSTDGGATWTAIATNEAND
FT                   GAYAWTVPSVSSSNCLVKVEARDAVGNVGYDISDRTFSINAPATPPAEVNTVALKAGWN
FT                   LVSLPLIPKEPAIDTVLAGVYGNLDTVWGYDTTTGTWSSYAPGAPSTLTQMRDGRGYWV
FT                   KVNNDCSFAVDGVVLPMPPQVPPSYELVPGWNLIGFKSTVPKKASEYLAAMAGKYTVIY
FT                   GFDAATQRFQQVLADDNLQPGKGYWVAVTDSGRIYP"
FT   sig_peptide     239756..239869
FT                   /locus_tag="Moth_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            243212..244822
FT                   /locus_tag="Moth_0242"
FT   CDS_pept        243212..244822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0242"
FT                   /product="Ig-like, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18577"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW2"
FT                   /protein_id="ABC18577.1"
FT                   /translation="MFSRMFALKKPAGAFGLLLALILIFGLPGYALAVPAQPHQFYGQV
FT                   TVGGEPAPQGIEVVAKIDGVQYAATVTDALGRYGYDPVFYVPADNPDTPAIEGGRRGDL
FT                   IEFYVAGVLAGSYQFEVGGVTKLDLSIAALPDTTAPTVSITDPANNATSVAVDKTITVT
FT                   FSEDVKAGAAYDGITLKDAGGYPVAVTRNIVGKVLTIKPNANLTNSTTYTVVIPAGAVA
FT                   DLAGKALAQDYIFNFTTEAAPVTLQALKVEPSSFTLTVGETKQLVVKAVYSDGSEADVT
FT                   DEATYASANENVARISATGLITAASAGETVITATYGDKEAQVAVIVQVSPAGPAPTVTA
FT                   VDPTNAVAGQSGQTITVTGQNFQDGAQVVLLQNGQEVSAVNAVYSDSSRVTFTLPVSVP
FT                   PGVYTVAVRNPDGQQSADAVALVLYAGPKPAMNVYPGVQGTQPGQVQAGGGVRVEVPVL
FT                   VSQIYPNALVIIRVDDPDGKPLYASVEGPLPANTPLKYSASFNLPGKAGNYTVKAYVWD
FT                   GWQTMNPIVPASQAQFTAQ"
FT   sig_peptide     243212..243313
FT                   /locus_tag="Moth_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.462 at
FT                   residue 34"
FT   gene            244931..246988
FT                   /locus_tag="Moth_0243"
FT   CDS_pept        244931..246988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18578"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW1"
FT                   /protein_id="ABC18578.1"
FT                   /translation="MTFKRLVLVVAAVMMLLLGATSAYAAYTINLNEPVVSTSAPPYAT
FT                   VTAGGSVQADGQPAVGVPVALRLSGADGQLLAADQVATDSSGSFSEPLPLPAGTNSGSA
FT                   TLVAAAAGAIAQQVVEIPPLPAAYYGSVKNSGGSNVAAGSVEAYIDGQKVGSLDFQNGF
FT                   YGGSGGLDPKLVASGTDADKGKTVTFKVVINGQAYDATPASPVTWEPGDVRQVDLSITA
FT                   QQPPAGDQVPPAVTTTDPANGATGVAVTKAVAITFSENIQAGAAYDSIALKDGSGNSVA
FT                   FTKSISGSVLTITPSANLAYSTIYTVSLPAAAVQDLAGNALASPFTFSFTTQAASSGGG
FT                   GGGGGGGGGGGGSTTPSTNRVEQPIQAGAATVAELAGVARVDVPAGAVSGTGATIAAEV
FT                   KDDSLAAQAGMTLISKVVDVTLNNGTLNGQLTITLYYDKSKLAADQQPVACYYDASQGQ
FT                   WVRLEGSVDENAGTVAVTVDHLTTFAVFAAAKEVTPPVTFKDMQGHWAAETVSRLASMD
FT                   IISGYPDGTFKPDNQITRAEATAILARALKLAPGSEQDLKFKDNAAIPEWARGVVAAAA
FT                   REGLIKGYPQPDGSVTFVPGRSISRAELAAIVVRILAMKSGAPAPAELKFADTASIPDW
FT                   ARQSVAQAVASGIVAGYPDNTFQAERPVTRAEAAAMILRLLDKIGTQGGQ"
FT   sig_peptide     244931..245008
FT                   /locus_tag="Moth_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            247377..248126
FT                   /locus_tag="Moth_0244"
FT   CDS_pept        247377..248126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0244"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18579"
FT                   /db_xref="GOA:Q2RLW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLW0"
FT                   /protein_id="ABC18579.1"
FT                   /translation="MCRKQPIELFFFFCPGGDGLSLIQFFNVTKQYPPNITALDDVSVK
FT                   IDKGEFVFLVGPSGAGKTTFIRLLFREEVPNRGQIIIGGRSISRLKRKEVPLLRRNIGI
FT                   VFQDFRLLPDRTVFENVAFALRVVEAHPREIKPRVEMALAQVGLSNRARMFPHQLSGGE
FT                   QQRAAIARAIVNNPRILVADEPTGNLDPVTSGEIMKLLEEINRLGTTVIMATHAWDIVN
FT                   SMRKRVIALQHGRLVRDDREGAYGYEA"
FT   gene            248116..249003
FT                   /locus_tag="Moth_0245"
FT   CDS_pept        248116..249003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0245"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18580"
FT                   /db_xref="GOA:Q2RLV9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV9"
FT                   /protein_id="ABC18580.1"
FT                   /translation="MKLRTAGYFFRQAALSLWRNIWMSLAAAASVAISMFLLGAFLLLV
FT                   FNVNHIAANLQSNVEIAAFLQVDVPRQVSLHIQDQVRALPGVTEVTLVPKEEGLKQLSQ
FT                   QFGSEQDLLAATGGVNPLPDYLRVRVADPQTIQSVAGAIKAIPGVEKVNYGQEVVERLF
FT                   AVVRWLRWLGVGIIVMLGLGALSLIVLTIRLAVYSRRREINIMKYVGATDWFIRWPFFL
FT                   EGLWLGLLGSGVAAVAVYLGYRVVLNMVGPAAVFVPLIRDQGLLLRSTLGLVAGGSLVG
FT                   ALGSLFSIRRFLKV"
FT   sig_peptide     248116..248277
FT                   /locus_tag="Moth_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.727 at
FT                   residue 54"
FT   gene            249030..250163
FT                   /locus_tag="Moth_0246"
FT   CDS_pept        249030..250163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0246"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18581"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV8"
FT                   /protein_id="ABC18581.1"
FT                   /translation="MRRKATALLLMAALALGTVPAHGASVDDLQRQQQQLQQNIQEQQK
FT                   LLQQKNDEGEALLQQLQQIEEDIRQKQAQIASLDQQLAAAQGRVQQVAAELQKAEAAQE
FT                   TRMSILRSRLKDIYQVGRVNYLEVLLQSTSLEDFLVRLELLTKIARGDINLIDEIKAEK
FT                   AKIAAQKAELEAERDHIAQLRRQADNERVQLASRQENQRQLLAQVEQEKKRVAAALDEM
FT                   EATARQIAAKIRAEQAKSNRKLSPSGTKGMLWPLPGYTQISSPFGWRIHPLLKTNRFHD
FT                   GVDLPAPAGTEIIAPLDGQVISTGYLGGYGNHIVIDHGGGLSTMYAHLSAILVQNGQEV
FT                   KKGQVIGRVGSTGWSTGPHLHFMVLLQGEPTNPMNYY"
FT   sig_peptide     249030..249101
FT                   /locus_tag="Moth_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            250230..251393
FT                   /locus_tag="Moth_0247"
FT   CDS_pept        250230..251393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0247"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18582"
FT                   /db_xref="GOA:Q2RLV7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV7"
FT                   /protein_id="ABC18582.1"
FT                   /translation="MPRIWRQIGRGLLALCVLVTLAVGVGVATHFREVEQGVKTYALLR
FT                   FQALQPISTDKLMEGAIRGMVEALDDPYSTYLDAETYRKLQESVTGSYGGVGLLITLDE
FT                   KDKRVVVVSPFKGTPAQRAGIKSGDYITAIDGRDTTGMDLETASNLMQGEPGTRVELTI
FT                   LSAGDSNPRKVALTREIIKVPTVDGRMLPGHPGVGYISVTMFNEQTGADLGRELNDLRQ
FT                   QGMQKLILDLRNNPGGALPAAVDVASYFVPQGPVVYIADQKTSEPLMARGYAQPLPLVV
FT                   LVNKGSASAAEIVAGAIKDTKSGTLVGETTFGKGIVQTIFPLPGDAAVKITTQKYLTPG
FT                   KHDINKKGITPDYVVPMDPQLEQQVLAHAPDLERDVQLQKALEVLGK"
FT   sig_peptide     250230..250319
FT                   /locus_tag="Moth_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.705) with cleavage site probability 0.458 at
FT                   residue 30"
FT   gene            251493..252050
FT                   /locus_tag="Moth_0248"
FT   CDS_pept        251493..252050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0248"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18583"
FT                   /db_xref="GOA:Q2RLV6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV6"
FT                   /protein_id="ABC18583.1"
FT                   /translation="MRHILFVIDMQNDFVAEGGALSFPAAREIIPFVSSKVKQALSRGM
FT                   EVLLTLDTHIPGDAEFQKFPPHCLEGTPGQALIPELQAIIAPYEGTGQIKFCKKNRYSA
FT                   FYNTDLDAWLGLTPGSPGERVSQVEMVGVCTNICCFFTAEELANRDIPVRILAQGMASF
FT                   DPGAHRWALDQIRRVLGLQVAE"
FT   gene            252279..252494
FT                   /locus_tag="Moth_0249"
FT   CDS_pept        252279..252494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0249"
FT                   /product="Protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18584"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV5"
FT                   /protein_id="ABC18584.1"
FT                   /translation="MEIKRLTAAITQEGKWYVARCLEVEVTSQGHSIEEAISNLKEALE
FT                   LYFEDEEHPRINASPIIAPVEVNMAI"
FT   gene            252491..252721
FT                   /locus_tag="Moth_0250"
FT   CDS_pept        252491..252721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0250"
FT                   /product="YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18585"
FT                   /db_xref="GOA:Q2RLV4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV4"
FT                   /protein_id="ABC18585.1"
FT                   /translation="MSIFLVISGQEVVRALQKGGFVKVSQKGSHVKLRKSEENIRTVIV
FT                   PLHEELAPGTLKSILRQSGLTVKELKNLLNC"
FT   gene            252738..254729
FT                   /locus_tag="Moth_0251"
FT   CDS_pept        252738..254729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0251"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18586"
FT                   /db_xref="GOA:Q2RLV3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV3"
FT                   /protein_id="ABC18586.1"
FT                   /translation="MPPFILKSDYQPRGDQPRAIAALVEGLKKGYRHQTLLGATGTGKT
FT                   YTMAQVIQAVQRPTLVLAPNKTLAAQLCGEFKEFFPDNAVEYFVSYYDYYQPEAYVPQT
FT                   DTYIEKDSSINDEIDKLRHSATAALFERRDVIIVASVSCIYGLGSPEDYSTLMLSLREG
FT                   QEYDRDAILRKLVDIQYSRNDYDFKRGTFRVRGDVIEIFPASFTEKAIRVEMFGDEIER
FT                   LLEIDTLTGEILGRRSHVAVFPASHYVVEEAKMERALESIQAELEERLRELRAQGKLLE
FT                   AQRLEQRTNFDLEMMREVGFCKGIENYSRHLTGRAPGEPPYTLLDYFPDDFLMMIDESH
FT                   ITVPQIGGMYEGDRSRKETLVEYGFRLPSALDNRPLTFEEFCRHINQVIYVSATPGPYE
FT                   LEHSQQVVEQIIRPTGLVDPEVLVRPVKGQIDDLLAEIQKRVAKNQRVLVTTLTKRMAE
FT                   DLTDYLREAGLKVRYMHSDIGAIERMEIIRDLRLGVFDVLVGINLLREGLDLPEVSLVA
FT                   ILDADKEGFLRSERSLIQTIGRAARNAEGQVIMYADTITDSMRRAIDETNRRRQIQMEY
FT                   NRRHGITPRTVSKPVREVIEATRAAEEPARYETAGEGARKKTKLSKRELKALISQLEKE
FT                   MRAAAKRLEFERAAELRDAILELRLQAG"
FT   gene            complement(254789..255256)
FT                   /locus_tag="Moth_0252"
FT   CDS_pept        complement(254789..255256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0252"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18587"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV2"
FT                   /protein_id="ABC18587.1"
FT                   /translation="MGKDAFLNKIAGFQRLLLDTNSVIYFLQGISPYDAILNPLFGLFE
FT                   QQNLEAVLSVITETELLVGPLKKDNKEALTMVKLFLNDFPGLKVIPISRQIGQMAAAIR
FT                   ARTNLRLPDALIIATAKHTGCGAIIGNDLAWSKIDTSAAELPEVILLDAYV"
FT   gene            complement(255235..255492)
FT                   /locus_tag="Moth_0253"
FT   CDS_pept        complement(255235..255492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0253"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18588"
FT                   /db_xref="GOA:Q2RLV1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV1"
FT                   /protein_id="ABC18588.1"
FT                   /translation="MDQAIIKVSSKRQITIPAAIYKKLGIQPGQKLFLEVHGDKLIIWP
FT                   KTKSYTELLAGSLKGVYGQTKEEIDVYVRKERETWEKTPS"
FT   gene            255637..259335
FT                   /locus_tag="Moth_0254"
FT   CDS_pept        255637..259335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0254"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18589"
FT                   /db_xref="GOA:Q2RLV0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLV0"
FT                   /protein_id="ABC18589.1"
FT                   /translation="MQFIADLHIHSRYSRATSKDATPENLYRWALYKGVTLVGSGDFTH
FT                   PAWREELKNKLEPAEDGLYRLKEEFSRPVDEEPGPGPAGPGKGARWPADMGTSAGWFSS
FT                   IPSEASGRPAVRFIISGEISTIYKKNGRVRKIHHLILLPDLEAAEALSRRLEEIGNLHS
FT                   DGRPILGLDSRQLLEMTLEACPEAVFIPAHIWTPHFSLFGAKSGFDSLEECFGDLAGYI
FT                   YAVETGLSSDPPMNWRLAALDRLTLVSNSDAHSPRNLAREANLFNTELSYPSIRRALRD
FT                   RDGKEFLGTLEFFPEEGKYHYDGHRNCRVRWRPAQTREAGGVCPVCGKRVTVGVLHRVE
FT                   ELADRGEGFRPATARPFESLVPLPEVIAAALGSGVATKRVTRLYFDLIGRLGPELAVLR
FT                   EAPLEAIARVGGSLVAEAVRRMRTGEVDVQPGFDGEYGKILLLRPEERQLFSGEPSLFA
FT                   GEAVTGPVAAIEEKHPEIGATGPAGATLEEAGAGQGGIFAPQVPAGRRTRHPETAASAV
FT                   IRPAPVPAGSGGPGLTGALNPEQQSAVTAATGPVVVIAGPGTGKTRTLVYRLAYLIKER
FT                   GVAPGEIAAVTFTNKAAAEIRQRVADLLGDRDGMESLTVGTFHSICLDLLQSSLTGSPG
FT                   ADLQGKPVGTTDTPASPRLTVVDEADAREILAGVLAEKGTGRRGLPGLQRRISLLKSRG
FT                   LLPDSPEVPADLRPIYRAYQERLAAYGVLDYDDILLKALELPALRPEGAPAFQGPVPFT
FT                   HLLVDEFQDVNAVQYRLVKKWTGDGKNLFVIGDPDQAIYGFRGADYRFFGQLLEDFPAA
FT                   RVFRLTRNYRSTPVILRAAAAVVAHNPGGDLRAAAGGELAATTASTTSPAAGPGISGGG
FT                   GLVATRPEGGPILHLEAPGETAAGIAIVREIGRLVGGATMLQAHGQDGGTWREGPETGS
FT                   DGAYGFSDIAVLCRTGHQLKALEECFLKEGLPYRIVGRESFLEERPVREALAFCRCLVN
FT                   PEDDFHLLKYLGSGSAGVGEEVAIQVRETALKRGVPAWLVIRELAGELQNFINSLEAYR
FT                   AALDKQSPAELLARWAGEHGLLDEPSISRLLRVAERFPDLSAFLRGVVLAGEADHERPG
FT                   NNGASPEVVTLMTLHAAKGLEFPAVFIAGVEDGLLPLKEGPGVTLSPEEMAEERRLFYV
FT                   GMTRARELLVLVSSRRRELRGTVVPAEPSPFLGEIPADCLVRETWDARGKKKNGKDEEK
FT                   YQQLSLF"
FT   gene            259486..262401
FT                   /locus_tag="Moth_0255"
FT   CDS_pept        259486..262401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0255"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18590"
FT                   /db_xref="GOA:Q2RLU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLU9"
FT                   /protein_id="ABC18590.1"
FT                   /translation="MARDKIVIKGARAHNLKNIDVTIPRDQLVVITGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSSYARQFLGQMDKPDVDVIEGLSPAISIDQKTASHNPRSTVGTVT
FT                   EIYDYLRLLFAHIGRAHCPRCGRPITPQTISQMVDRLLTYPEGTRLQVMAPIVRGRKGE
FT                   YRNVLEEIRRQGYVRVRVDGEIRETSDNISLAKNKKHTIEVIVDRLQVRPGVASRLAES
FT                   LETALKLADGVVLIDIVGQEELLLSEKFACVECGVSLPEVTPRLFSFNNPYGACPACTG
FT                   LGVTMKVDPGLVIPDKSLTLREGAIAPWSRGNNGYQQMLECLADHYGFSLDVPVRELKP
FT                   EHLQVILYGSGEERIKFRYTNRFGDRRAYEAPFEGVIPNLERRYQETQSEWSRAEIENY
FT                   MSQQPCPACRGARLKPEALAVKVGGLNICELAALDVRAAAEFLRNLNLSEREKVISRQI
FT                   LKEILARLQFLLDVGLDYLTLDRTASTLSGGEAQRIRLATQIGSQLMGVLYILDEPSIG
FT                   LHQRDNERLIATLKHLRDLGNTVIVVEHDEDTMRAADYIIDIGPGAGEQGGRVVAAGTV
FT                   PEVMANPNSLTGQYLSGRRRIPVPAERRRPGDKWLTIKGAREHNLKGIDVSFPLGLFIG
FT                   VTGVSGSGKSTLVNEILYRALAQRLNGARTNPGAFAGLTGTEYLDKVIEVDQSPIGRTP
FT                   RSNPATYTGVFDDIRALFAATPEARARGYKPGRFSFNVKGGRCEACGGDGIIKIEMHFL
FT                   PDVYVPCEVCQGKRYNRETLAVKYKGKSIADVLAMTVDEAAEFFAPIPRLHRRLTTLQD
FT                   VGLGYITLGQPATTLSGGEAQRVKLATELARRSTGRTMYILDEPTTGLHMADIERLLNV
FT                   LQRLVDAGNTVVVIEHNLDVIKSVDYIIDLGPEGGEGGGRVVATGTPEEVCRVAASYTG
FT                   RFLAPVLERDRGLPALEPRTAGLPEEEPRGRRELPLVVGQE"
FT   gene            262415..264256
FT                   /locus_tag="Moth_0256"
FT   CDS_pept        262415..264256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0256"
FT                   /product="Excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18591"
FT                   /db_xref="GOA:Q2RLU8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLU8"
FT                   /protein_id="ABC18591.1"
FT                   /translation="MDLEEKLARLPDHPGVYIMHDANGAIIYVGKAASLRNRVRSYFRG
FT                   QHQPRTQAMVSHVADFEYILTDNEVEALILECNLIKQHRPRYNVSLKDDKSYPYIKITT
FT                   QEDFPRIQITRSVTRDGSRYFGPYTSAGSLKETLKLLRGLFPIRTCRDTPLQPRSRPCL
FT                   NAHIGRCLAPCAGQVDRETYREAVDNVIMFLEGRHTALVKELKEQMEAAAARLEFEKAA
FT                   RLRDQLRAVQEVCEKQKLAAASGEDADAIAFAREGEAALGLIFFSRGGKVIGRDHFFLT
FT                   GSEGLSRGEVMAALLKEYYSRGVEIPPEILLHDEPEDAATIASWLSRLRGGRVNLRVPK
FT                   RGTKLKLLRLVHENAVSLLQEHLLTRRRQEEGSRAALLELQEILELPRLPRRMEAYDIS
FT                   NFQGSSQVGAMAVFVDGRPLPSAYRRFQIKTVRGPNDFASLQEVLSRRFRRAAEQDPHF
FT                   ADLPDFVLIDGGLGQLHAARETMEAMGVGYIPTFGLAKEEELLFRVGTSEPIRLPRESK
FT                   ALQILQHLRDEVHRFAITYHRQKREKTAYRSVLDDIPGVGPKRKKALLRHFGSVAAISK
FT                   ATLEDLLAVEGMNRTVAARILAGLGRRSDGEDSTGSP"
FT   gene            264228..265046
FT                   /locus_tag="Moth_0257"
FT   CDS_pept        264228..265046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0257"
FT                   /product="HAD-superfamily hydrolase subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18592"
FT                   /db_xref="GOA:Q2RLU7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLU7"
FT                   /protein_id="ABC18592.1"
FT                   /translation="MGKIRLVALDLDGTLLTDDIVIEPRAREAIRKVKEKGITVTLATG
FT                   RMFSSARPYAVELGLELPLIVYHGAQVRHSTTGEILFERTLPVPLALRLIKNIKEFGYP
FT                   YNVYLDDRLYVESIQAENEEYAWRAGVDLHRVEDMLTFLEQQPKGPLKIVALHDGPALD
FT                   PLEAAIRREAGAGIYITRSMPTYLELLNPEVNKARGLQALAELEGISPEEIMVCGDSYN
FT                   DVQMFRYAGLAVAMANAPEKVRAEADYVTGSNNDGGVAQALEKFVLGDGA"
FT   gene            265152..266051
FT                   /locus_tag="Moth_0258"
FT   CDS_pept        265152..266051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0258"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18593"
FT                   /db_xref="GOA:Q2RLU6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLU6"
FT                   /protein_id="ABC18593.1"
FT                   /translation="MPETKYPRLVIVTGLSGAGKTQAVRCLEDLGFFCVDNLPPSLIPG
FT                   LVDLLGHPGKEGEGITKVALVMDIRGGEFFSGLDAALNYLDGLGIPYEILFLEAADEVL
FT                   VRRYKETRRRHPLSSGGQILEGIIEERRRLEELRGRASKIIDTSELTPRQLKEQVSELF
FT                   GSSQRRLIVSIISFGYKYGIPLDADLVMDVRFLPNPYYVPALRPFTGHDRCVEEFVMAS
FT                   PVTRQFIEQFAALLRFLIPHYLQEGKSHLVVAIGCTGGQHRSVTLANKLGELLQGENYS
FT                   VTVKHRDVVRYLSTGNRR"
FT   gene            266099..267439
FT                   /locus_tag="Moth_0259"
FT   CDS_pept        266099..267439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18594"
FT                   /db_xref="GOA:Q2RLU5"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLU5"
FT                   /protein_id="ABC18594.1"
FT                   /translation="MDGLKWLYPGLKIKRWLLLAVLGLLLLVSGLTVILGITLLASAEK
FT                   GVTWFILHTLGGLGSPLLAGLLAMALGAVFIGVAVRNLARSVIQVLLPGHTANPWQVFY
FT                   RRQYLARGPHLVAIGGGTGLAVLLRGLKNYTRNLTAIVTVADDGGSSGRLRQELSIPPP
FT                   GDIRNCLVALADTESLMEDLFSYRFRQGEGLAGHSLGNLLLAAMTDMAGDFDRAIQELA
FT                   RVLAVGGRVIPSTTTHVVMGAELADGSTVLGESNIPLAGKPIKRVFLKPADCRPPAAAL
FT                   EAIARADAVIIGPGSLYTSVLPNLLVPGIVEALRDTPAPVFYVCNIMTQPGETDGYTVA
FT                   DHLRALIDHCGQGIIDTVIAHSGPISRAARRRYGEKGARPVLINSPAIARMGVELRRGW
FT                   LVDETHVVRHHPERLASLVMEEVYRHQARGRRRFFYLVRERFRTLAR"
FT   sig_peptide     266099..266230
FT                   /locus_tag="Moth_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.714 at
FT                   residue 44"
FT   gene            267495..268448
FT                   /locus_tag="Moth_0260"
FT   CDS_pept        267495..268448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0260"
FT                   /product="Protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18595"
FT                   /db_xref="GOA:Q2RLU4"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLU4"
FT                   /protein_id="ABC18595.1"
FT                   /translation="MLMPLSFSLQTKEELARVKARHPCCRQAELVAFLRLGNLDGGQPG
FT                   EETVLFTTPYPALARKVYSLAREFLACPVKVRNSRRQGKGRPVFRVVARARLKEIQDWL
FT                   AGRAGVPEYPCCQAAYMRGAFLVTGSVNKPSGTHHLELIFPDAAMAGQMQGLMQQQELE
FT                   PRLSRRQRGYVLYLKDSEQIIRALSLMGAYSAVLAYENVLIFKDMRNRVNRLVNCETAN
FT                   LTKTVETGLRQAENIRYLIATVGWDYLPPALREIAAVRLQHPEASLKELGEMLHPPVGK
FT                   SGVNHRLRRLELIARQVRGQGREGYAPDDDLSRPRA"
FT   gene            268678..270063
FT                   /locus_tag="Moth_0261"
FT   CDS_pept        268678..270063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0261"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18596"
FT                   /db_xref="GOA:Q2RLU3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLU3"
FT                   /protein_id="ABC18596.1"
FT                   /translation="MREGLGLNLEQTQKLIMTPELRQAIVILQLSTLELADYIQQELQE
FT                   NPVLEVRDDGEVAAGCESREENDSFDIDWQEYFQDGSDLGYVCEPREELPEWYPENFPT
FT                   GQPTLQDHLLLQLQIAATNPRQVEIGSFLIGNLDSNGYLKISLKEAAALLKVPQADVWQ
FT                   VLDLIQHFDPPGVGARDLVECLLLQLRQRGEAPAGTEKIIRGFLPDVAEGRLTRIARRL
FT                   NMSLPAVQAAVDYIRSLDPKPGRSFGGSLDNRYIVPDVIIERVGDEYVVLVNDLAMPRL
FT                   GINPVYQALLRKEAACDPRTRQFIERKLNAAAWLIRSLEQRRLTVYRVVNCLVKEQREF
FT                   LDKGLKYLKPLTMRQVAAALGIHESTVSRATANKYVQTPQGVFELKFFFASGVEKRGGA
FT                   AAAESIKKMISEAIGREDPASPLTDQQLQEMLQRQGIRISRRTVAKYRDEQGIPAAAKR
FT                   KRY"
FT   gene            270259..271266
FT                   /locus_tag="Moth_0262"
FT   CDS_pept        270259..271266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0262"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18597"
FT                   /db_xref="GOA:Q2RLU2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLU2"
FT                   /protein_id="ABC18597.1"
FT                   /translation="MAIKVGINGFGRIGRLVFRASLEKPELEVVAINDITDVKTNAHLL
FT                   KYDSVHGRLNATVEAREGAMVVNGREIKVLAERDPAKLPWKDLGVDIVIESTGVFTDAT
FT                   KAAAHRQAGAKKVIITAPAKNEDITIVMGVNNDKYNPAQHHIVSNASCTTNCLAPIAKV
FT                   LHDNFTIKRGLMTTAHSYTNDQRILDLTHKDLRRARAGALSIIPTTTGAAKAIGLVLPE
FT                   LKGKLNGMAMRVPTPNVSVVDLVAELEKPATVESINAAMKAAAEGPMKGILGYCEEPLV
FT                   SRDFNGDPRSSIVDALSTMVIDGTLAKVVSWYDNEWAYSKRVVDLAAFMAAKGL"
FT   gene            271426..272607
FT                   /locus_tag="Moth_0263"
FT   CDS_pept        271426..272607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0263"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18598"
FT                   /db_xref="GOA:Q2RLU1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLU1"
FT                   /protein_id="ABC18598.1"
FT                   /translation="MAKLTLKDLELNNKRVLVRVDFNVPLEAGRVTDNTRIRAALPTIE
FT                   YLLDHGARVILMSHLGRPKGKVKEELRLDPVARELESLLGRQVHKVNDCVGPEVEAAAA
FT                   ALKPGEVLLLENLRFHPEEEKNDPGFARQLASLADVYVNDAFGAAHRAHASTEGVAHYL
FT                   PAAAGFLLQKEIETLGKALADPERPFVAIIGGAKVSDKISVIRNLLTKVDTLIIGGGMA
FT                   NTFLKAQGYAMGKSLVEEDQVPLAQELIQLAAQKGVKMLLPRDLVVAQEFKADAPHQVV
FT                   AVNAVPDGWMALDIGPETARAYAGALEGARTVVWNGPMGVFEMEAFAHGTEAVARAVAA
FT                   VDGMTIVGGGDSVAAVEKMGVAGKIGHISTGGGASLEFLEGKALPGVVALTEK"
FT   gene            272688..273437
FT                   /locus_tag="Moth_0264"
FT   CDS_pept        272688..273437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0264"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18599"
FT                   /db_xref="GOA:Q2RLU0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLU0"
FT                   /protein_id="ABC18599.1"
FT                   /translation="MRRPIIAGNWKMHNTTEEARDLVTLLRPLVGTARAEVVVCPPFTA
FT                   IAATVNAASGSNISVGAQDLFWEDKGAYTGEVSGPMLRDLGCRYVIIGHSERRQYFGET
FT                   DATVNKKLLAAYRNELLPIVCVGETLAEREAGHTLEVVGRQVREGLKGLETGQARDLVV
FT                   AYEPVWAIGTGKTATAADAQEVIAFIRKTLGEMYGETAAAIRIQYGGSVKPENIAELMA
FT                   QPDIDGALVGGASLDAVSFAAIVNYDQ"
FT   gene            273462..275003
FT                   /locus_tag="Moth_0265"
FT   CDS_pept        273462..275003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0265"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18600"
FT                   /db_xref="GOA:Q2RLT9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLT9"
FT                   /protein_id="ABC18600.1"
FT                   /translation="MAIAVNRPLMLMILDGFGLGPEGEGNAISQGRLPNYRRLLAGYPH
FT                   TRLRASGEAVGLPAGQMGNSEVGHLNIGAGRIVYQELTRISKAIRDGSFFSNAALVGAV
FT                   RAAREHGGALHLMGLVSDGGVHSHLDHLYALLDLAKREGLERVYIHAFLDGRDVPPASA
FT                   AGYLEQVEDECRQKGIGAIATIMGRYYAMDRDRRWERTARAYRALVAGEGHQASSPSEA
FT                   IRASYERDITDEFVEPAVITRDGRPLATVREGDSVVFFNFRADRARQLTRAFVDRDFDA
FT                   FERPGGRLDIQFVCLTQYDVTIPAPVAFPPQVLQNVLGEVIAGAGLKQLRIAETEKYAH
FT                   VTFFFNGGVEEPFPGEDRLLIPSPKVATYDQKPSMSAREVTDAVLERLDKYDFIVLNFA
FT                   NPDMVGHTGDLAAAIAAVETVDECIGRIVQAMAERRAPLLLTADHGNAEEMREPDGEPH
FT                   TAHTSNLVPFILVDDRYRGASLREGALEDVAPTVLDILHIQQPAEMTGKSLIVKG"
FT   gene            275104..276390
FT                   /locus_tag="Moth_0266"
FT   CDS_pept        275104..276390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0266"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18601"
FT                   /db_xref="GOA:Q2RLT8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLT8"
FT                   /protein_id="ABC18601.1"
FT                   /translation="MTTISDIYAREILDSRGNPTVEVEVFLESGGWGRAAVPSGASTGA
FT                   YEAVELRDKDPKRYGGKGVLDAVNNINAIIAPELVGSDALDQREIDRQLIEMDGTPNKG
FT                   KLGANAILGVSLAVAKAAADALGLPLYRYLGGVNAHTLPVPMMNILNGGKHADNNVDIQ
FT                   EFMVMPAGASDFASALRMGAEVFHSLKAVLQSKGLNTAVGDEGGFAPNLRSNVEAIEVL
FT                   LEAIAKAGYEPGKDCFIALDPASTELYKDGKYVFAGEGVTRTSDEMVEFWASLVDKYPI
FT                   ISIEDGLAEDDWEGWQNLTKRLGHKVQLVGDDLFVTNTERLSRGIEMGAANAILIKVNQ
FT                   IGTLTETLEAIEMAKKAGYTAVVSHRSGETEDTTIADIVVAVNAGQIKTGAPSRTERVA
FT                   KYNQLLRIEEELDAAALYPGLKAFYNLKK"
FT   gene            complement(276447..277397)
FT                   /locus_tag="Moth_0267"
FT   CDS_pept        complement(276447..277397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0267"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18602"
FT                   /db_xref="GOA:Q2RLT7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT7"
FT                   /protein_id="ABC18602.1"
FT                   /translation="MQRLLIFHPKQGLKENLPPGFQPRQSEEFTWLDLVQPAREELDLL
FT                   ADLFHFHPLAVKDCLHPHYRPGMAQYDEYAFLTLRCIQARQRSLTAALNVFLGPGFIVT
FT                   VHQEELDFLNKIWHQYRQDPRLFAKGVDFILYSLLEPLTETFFAFFDRTEARIEYLEEE
FT                   VFRQPTRRILNQVFTMRRQAIKLRKILGAQRDIINVLAYPEFNLVKPENRVFFLDIYNE
FT                   MLRLIDQVETFHDLASSTLEIYLSLTSNRLNEIMKVLTVITTIMMPLSLIAGIYGMNFR
FT                   YMPELEWRYGYFVVLGVMALLAGVMLYFFRRKGWF"
FT   gene            277656..278516
FT                   /locus_tag="Moth_0268"
FT   CDS_pept        277656..278516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0268"
FT                   /product="Protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18603"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT6"
FT                   /protein_id="ABC18603.1"
FT                   /translation="MTVFNPFLASASANKPSTSNFRPPTAAIYIGTSGYSYRDWQGYFY
FT                   PRGLAAKDMLPYYAREFNFTEINSSYYALPRPQNLEQMARKVPEGFIFAVKAYRTLTHD
FT                   RGESVTDDSKQFRQALQPLVDQGRLGAVLLQFPYSFHNNQANREYLARLRELLPDLPLV
FT                   VEFRHAGWVHDAVRDFLARNELAYTCVDEPDLPGLPGPVVYCTAPVAYVRFHGRNAAKW
FT                   WRHEEAYERYDYLYTEAELKEWLPGIAYLAGQARQVFVAFNNHYHSQAVTNARMLKELL
FT                   AAGQL"
FT   gene            complement(278568..279461)
FT                   /locus_tag="Moth_0269"
FT   CDS_pept        complement(278568..279461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0269"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18604"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT5"
FT                   /protein_id="ABC18604.1"
FT                   /translation="MELVKIHGHTYYIPGATNTGVFTTKSGYCVLIDSGINNTVAHKIS
FT                   KVLAEKGLKPRYLLTTHGHADHFGAHNLLKELYPGLEILASPGEKVYMENNLQATTTLY
FT                   GAVPYDEIKVPLLFARSTAVDITITPGPLKLLDQHLEAIATPGHTAGHLAFLTPDGVLF
FT                   SGDAVFDQGILAKYPLPFLLDIKAELATLEVIAGLEIKYLLPAHGQEVITEVEPVLEAN
FT                   RRQIANCLDIIVELLSQPLTREDLLAQVAILEDITMDIPQYFLNLSSLSAFLSYLKDEG
FT                   RISCSVENGKLYFFAI"
FT   gene            complement(279715..279969)
FT                   /locus_tag="Moth_0270"
FT   CDS_pept        complement(279715..279969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18605"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT4"
FT                   /protein_id="ABC18605.1"
FT                   /translation="MIQYAWKFGGGRRNSMPQEIYTEGKKDIFPEQARVAGRLPGVYGN
FT                   GIPCEQVECIYCLENHYCCRAWPPRNQDGYCKNFISIND"
FT   gene            280137..280361
FT                   /locus_tag="Moth_0271"
FT   CDS_pept        280137..280361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0271"
FT                   /product="protein translocase subunit secG"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18606"
FT                   /db_xref="GOA:Q2RLT3"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT3"
FT                   /protein_id="ABC18606.1"
FT                   /translation="MLHTIILILDILVALGLIATVLLQSGRSAGMSGAIAGGAETIFGK
FT                   KKGLDDFLNRVSSILGGIFIVFTLLLSVI"
FT   sig_peptide     280137..280241
FT                   /locus_tag="Moth_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.344 at
FT                   residue 35"
FT   gene            280417..280968
FT                   /locus_tag="Moth_0272"
FT   CDS_pept        280417..280968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0272"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18607"
FT                   /db_xref="GOA:Q2RLT2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT2"
FT                   /protein_id="ABC18607.1"
FT                   /translation="MNREEARQLMERHVKNKNLRKHCLAVEAVMRALARHFGEDEEKWG
FT                   LAGLLHDIDYESTKEDPDRHSLVGAEMLAREGLPEEIIYAVKAHNERHGLPRPDRLSKA
FT                   LYATDPLTGLIVAAALIRPEKKLAIVDVPFLLNRYHEKSFARGASRETIAACNELGFSL
FT                   EDFFHIGLKAMQGIAAELGL"
FT   gene            281077..283389
FT                   /locus_tag="Moth_0273"
FT   CDS_pept        281077..283389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0273"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18608"
FT                   /db_xref="GOA:Q2RLT1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT1"
FT                   /protein_id="ABC18608.1"
FT                   /translation="MDREEILTLMRARSYRPLTASELMVALGIEDEGAFMELLHSLEQE
FT                   GYIVRTRKDKYGLPEKMGLVSGRLQASPRGYAFVVPLDKDREDLYIGALNINGAMHGDL
FT                   VLARVLPGTTGRRQEGEIIRVLQRVNKRVVGTFDATRNLDFVIPDDARLHQDIIIPAGA
FT                   SLEARDRDKVVVEITRWPEARRSPEGRVIQVLGQTGAPGVDVLSIIKKYGLETEFPPEV
FT                   IREAEEIPRDLEPGELAKRRDLRDWRLVTIDGADARDLDDAVSLERRPDGSYLLGVHIA
FT                   DVSFYVREGRPLDREAFNRGTSVYFVDRVIPMLPARLSNDICSLNAGEDRLAITALMTI
FT                   SPAGTVKDYELFPSVIRVRERMTYDDVRRILEDKDPELMERYRELVPDFQLMARLAAIL
FT                   RRRRRRRGAIDFDFPEAKVKLDDQGLPVAIIPRHRTVAEGIIEEFMIVANEVVARHLYE
FT                   LAVPAVYRVHEEPAPDKLEALNTFLAYFGLHIKPNREGRVRPRAFQEILAAVKGRPEER
FT                   VISTVMLRSMMHARYAGDCLGHFGLASPYYCHFTSPIRRYPDLVVHRILRETWSPAGFS
FT                   AERMAQLSAFVALAAVQASEREKLAEEAERESLDMKKVQYMERHVGATFAGVISGVVPY
FT                   GFFVELENTVEGLVHVSTLTDDYYHYQEDQLALVGEHTGKSYRIGQPVTVLVTRVSVDA
FT                   RQVDFELVKPEEEKTGPVGGAGAKVKGHPVKAREREAGPSGGKARKKAMTMAGGKTGSK
FT                   GKGKARVRRNKGTRRRK"
FT   gene            283433..283699
FT                   /locus_tag="Moth_0274"
FT   CDS_pept        283433..283699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0274"
FT                   /product="Protein of unknown function UPF0180"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18609"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLT0"
FT                   /protein_id="ABC18609.1"
FT                   /translation="MHQRVAVERDLSAIGDHLAENGLKVERLDLTDMTPERLQDYGAIV
FT                   VSGQTTNFMGMEDLKARLPVIEAAGKTAEEITSMVKERLQLQL"
FT   gene            283781..284248
FT                   /locus_tag="Moth_0275"
FT   CDS_pept        283781..284248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0275"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18610"
FT                   /db_xref="GOA:Q2RLS9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLS9"
FT                   /protein_id="ABC18610.1"
FT                   /translation="MGRQVKVVTDNRRARHDYFIEETYEAGIALTGTEVKSLRNGRANI
FT                   KDSYARVENGELILHDMHISPYEQGNRFNHEPRRPRRLLMHRYEIQRLYGKVREKGLTL
FT                   IPLKVYFNERGLAKVELALVKGKRLYDKREDIAARDAQREIARALRERQKV"
FT   gene            284252..284606
FT                   /gene="ssrA"
FT                   /locus_tag="Moth_R0018"
FT   tmRNA           284252..284606
FT                   /gene="ssrA"
FT                   /locus_tag="Moth_R0018"
FT                   /product="tmRNA, 10Sa RNA"
FT                   /note="Predicted Proteolysis Tag: (A)ANNIVNFARKDALVAA*"
FT   gene            complement(284645..286096)
FT                   /pseudo
FT                   /locus_tag="Moth_0276"
FT   gene            complement(286452..287198)
FT                   /locus_tag="Moth_0277"
FT   CDS_pept        complement(286452..287198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18611"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS8"
FT                   /protein_id="ABC18611.1"
FT                   /translation="MSLAEAKARLLIKTYQPQYPLDIKEFVKLLGLDKPVEFHKCHELP
FT                   DEVSALVIDKEWYENIHILTNANHPVTRQRFGSVHELGHIYLGHKGGLHFYSPGNIYGE
FT                   DPIEHCEADIFATESLMPVFHVFELAGRIGSPLSLLKAMETSFKVSLEAAARRVIELEI
FT                   YKRSACILLRDGQTAFSYATNDFYYTWEMLSGFMEEIFTLMKPGQRKVWVYNELAVHTS
FT                   RMQKGYMLAVLVGGKADLNMKVAEVL"
FT   gene            complement(287262..287648)
FT                   /locus_tag="Moth_0278"
FT   CDS_pept        complement(287262..287648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0278"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18612"
FT                   /db_xref="GOA:Q2RLS7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS7"
FT                   /protein_id="ABC18612.1"
FT                   /translation="MSIGKRIKELREKIGLTQEELAERVQISRSALANYESGYREPKGE
FT                   ILVRFAKALNTSTDFLLGNEVKVDKTNDKTKKYELDEATLLFARLSNLTPEGREKVLRE
FT                   LEWIEELERKRFLERKKKQNQEKN"
FT   gene            287843..288091
FT                   /locus_tag="Moth_0279"
FT   CDS_pept        287843..288091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0279"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18613"
FT                   /db_xref="GOA:Q2RLS6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS6"
FT                   /protein_id="ABC18613.1"
FT                   /translation="MNRLKEIRKKHKISAKKLAEAVKTSRSNISMIELNLRKADLDLAK
FT                   RIADYFNTTIEDIFFADKCHDMGQKIVNETSLNETCQ"
FT   gene            288612..289085
FT                   /locus_tag="Moth_0280"
FT   CDS_pept        288612..289085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS5"
FT                   /protein_id="ABC18614.1"
FT                   /translation="MHMPEQPYIAVVCPSEAKIQRKNRTPDAERKWRKRHGLPPLREQG
FT                   KRGPGKASRVDRQEVARAVARVIVDNPIATTKVLAELAGLIREDADKKEREAVVARVRR
FT                   ALKDLQQMPGLAGDEALAEAVRQAFAKREEEKERRRQKRERLKRVNIFLKQNL"
FT   gene            complement(289097..289333)
FT                   /locus_tag="Moth_0281"
FT   CDS_pept        complement(289097..289333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0281"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18615"
FT                   /db_xref="GOA:Q2RLS4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS4"
FT                   /protein_id="ABC18615.1"
FT                   /translation="MYMLNKKIFALRLKFLREQHNLSTQKLADALGLKSKGAITQFEKG
FT                   IISPSVDTLISIADFFDVSLDYLVGRSDDPRRY"
FT   gene            289419..289667
FT                   /locus_tag="Moth_0282"
FT   CDS_pept        289419..289667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0282"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18616"
FT                   /db_xref="GOA:Q2RLS3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS3"
FT                   /protein_id="ABC18616.1"
FT                   /translation="MCTMKRQRLIEARKSTGLSSKQLAQQLGISKAMVVSLENCHCNPS
FT                   WEVAQRLEQFFGIPASQLLVVDYEQDRRTGTQPENVI"
FT   gene            289789..290064
FT                   /locus_tag="Moth_0283"
FT   CDS_pept        289789..290064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0283"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18617"
FT                   /db_xref="GOA:Q2RLS2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS2"
FT                   /protein_id="ABC18617.1"
FT                   /translation="MPDQSYIVCPPPLSPQQRQIWDLYHKGYGAKRISKELGIRVENVK
FT                   KQLKRVKNKLGYIEGEDKNFGQKPLGVSCAHEGLEEIAIYLLKSSP"
FT   gene            complement(290061..290366)
FT                   /locus_tag="Moth_0284"
FT   CDS_pept        complement(290061..290366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0284"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18618"
FT                   /db_xref="GOA:Q2RLS1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS1"
FT                   /protein_id="ABC18618.1"
FT                   /translation="MTLGNRLKELREKHHLTQYRLAKLSGVSQSHISEIESGDKEPTTG
FT                   TLMKICSAMGLTLAEFFTEETPSLPPDLRQILKEAESLTPGQRQKLIEFLKSIKSN"
FT   gene            290487..290711
FT                   /locus_tag="Moth_0285"
FT   CDS_pept        290487..290711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0285"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18619"
FT                   /db_xref="GOA:Q2RLS0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLS0"
FT                   /protein_id="ABC18619.1"
FT                   /translation="MVVIVLGCILKQIRASKNLSQYQLSKKSGVAQSYIHDIESGAKSP
FT                   TLRTLEKLAAALEVPLGELLGEEEGKKAV"
FT   gene            290789..292117
FT                   /locus_tag="Moth_0286"
FT   CDS_pept        290789..292117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0286"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18620"
FT                   /db_xref="GOA:Q2RLR9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR9"
FT                   /protein_id="ABC18620.1"
FT                   /translation="MELLSPQQRQIWKLYEQGYGAKRIARTLEISVDQVKVQLRRIKAK
FT                   MEGGNKNFGQKPLGVSCAHEGLEEILESLQDTSSQIDFLRENGYKPGAIANTLGVNIKK
FT                   VYNRNYDKKRSSFMRSFMSKEELRSLPSQGEVLDLDIARVIYEVFANNDPSYETLAMLG
FT                   TQNLGGWRAKRVALTRRAGMLKALAASGRGKTLKITNKKGPWWEMMKDLVEKYRRVGAD
FT                   TYIPDDWSAFEWELKSRIGAALEGLHVEPQEGREDKKVFEVVGGVTAVVIRPLPGQASV
FT                   LTSVSLHDGKPGTKKWEGLVSRDIEGLKVDGQPVKLEGVLIKNRKAIWFTRDPGILQNG
FT                   DKVRVREGFNGYVIEVLTWNPGLPGPRIVRLKDEDLAWAVAVFIIGKDGLKEDYRIEIG
FT                   GKLYNYRYSPASRNGVIPGGTSVTVEGASKRTERLPLNGCVRH"
FT   gene            292102..292527
FT                   /locus_tag="Moth_0287"
FT   CDS_pept        292102..292527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR8"
FT                   /protein_id="ABC18621.1"
FT                   /translation="MRQALKDLQKMPGMKPWRKRSGRLRQAFAKREEEKERRRQERERA
FT                   QVDSEEEAALVAWMQYQQAVNAAEMSARRMQVGGGDWLKWAGSAYELDSDRNKYICTLE
FT                   PTSRPADLPLKISALGNIPAASGFKKGKGGGKNPLLP"
FT   gene            293066..293428
FT                   /locus_tag="Moth_0288"
FT   CDS_pept        293066..293428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18622"
FT                   /db_xref="GOA:Q2RLR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR7"
FT                   /protein_id="ABC18622.1"
FT                   /translation="MWKVYFQEKIPFLWYDVLEFPAWLLPLFYCWKAAPFVFGLGVVGF
FT                   IAAAIYSWYSGDVYYNVLILKMGFWFIIAFASSFVLGVLVSMWEDLVKERRNEKGQSLT
FT                   IQEVIRKELDFERWCS"
FT   gene            complement(293616..294374)
FT                   /locus_tag="Moth_0289"
FT   CDS_pept        complement(293616..294374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0289"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18623"
FT                   /db_xref="GOA:Q2RKR6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR6"
FT                   /protein_id="ABC18623.1"
FT                   /translation="MSNKLTAYLESQMQALKLKGMLAHYQEITEKASQNNLSYTEYLSL
FT                   LFEEELKRKNEGTVKTKINKARFPFIKTLEEFDFSFQPSIREKEIISLSSLDFVEKKEN
FT                   IIFLGPPGVGKTHLSVALGIKACMAKYRVVFITAQKLLEELLLSAKDGSLLDKLLGYSR
FT                   LNLLIIDELGYMPVTKEQANLLFRLVSMRYEKGSIILTSNYNFNEWGEIFSDQVVAAAI
FT                   IDRLVHHARIFYINGTSYRLKGKLKAANDR"
FT   gene            complement(294371..295858)
FT                   /locus_tag="Moth_0290"
FT   CDS_pept        complement(294371..295858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0290"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18624"
FT                   /db_xref="GOA:Q2RLR5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR5"
FT                   /protein_id="ABC18624.1"
FT                   /translation="MYKWQRIKALHAQGVGIRQIARDVGVSRNTVRKYLKEAGPPQFKA
FT                   REYTKELDKFLEEIKVMLAKGYIGTRIYKELKDKGYQGSLASVHRYLRAIKEDDRTAKL
FT                   ATTRVETGPGKQMQYDWKVWTLPVDGKLVKIYLHEVVLSYSRMKFYTFSLSITTADVIR
FT                   VLIEAIDFFGGYAPELVIDNGKQMVITHQKDGIVRYNDEFLKFCGMYGIEPSACENYRA
FT                   RTKGKVERPFYYVQEHLLRGLEVGNLNEFAVKLSEFQEAYNKRPHSTLGRPPEEMFAEE
FT                   KGCLVKIPAVEPALLHHKEPRKVSNDGYISHDGNLYPVPMRYCLRRVWVENIYGRRLKV
FT                   YDEEGALLAEFDLDLKKQTARPLHPEHETINRQYQEKKLKLRSALVEKFTSAFGEDGQR
FT                   YLEGLRDKNGANLYWHLAEILSYQEIYTPEDIIAAIKECLKIGSYHKNSVKRLLERKEI
FT                   APLSCACDPASVNMPPGKIKRDLSCYALKESEVAAVS"
FT   gene            297009..298121
FT                   /locus_tag="Moth_0291"
FT   CDS_pept        297009..298121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0291"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18625"
FT                   /db_xref="GOA:Q2RLR4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR4"
FT                   /protein_id="ABC18625.1"
FT                   /translation="MEHIINILPKLIRASFEGNLQTIEIASMTISRKLKKEYPATADEI
FT                   AKIIAFHKAGAPMLRAAGHDPLPTDSDTYLSLAKLYEPDILNPKIILDSEVEEVIEQFL
FT                   KERMFAEKLITLGIRPPTSILLYGPPGVGKTYLSKYIAHKLSMPLIVMDLASSVSSYLG
FT                   KTGQNLKKIVDYAKNRPSILFLDEFDAVAKRRDDPSDIGELKRIVNVLLKELEDWPIHS
FT                   IIIAATNHPDLLDKAIWRRFNRTIAIKLPTLKVREKLWQLYLRENELINPSDSFISVVA
FT                   KVTEGFSPSDINQVAECILRRIIIDGEDLIKGTIHELKSRCDKNAKFNERFIRVTKETL
FT                   GANVTQAQIAEWLNISVSTVNHHLKKKKGE"
FT   gene            298125..299192
FT                   /locus_tag="Moth_0292"
FT   CDS_pept        298125..299192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18626"
FT                   /db_xref="GOA:Q2RLR3"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR3"
FT                   /protein_id="ABC18626.1"
FT                   /translation="MPNDLYPLLGQGERLIEPITPGQRSAKKSFPRTYEEARELIKNQL
FT                   KDLRYEIDNIPQQKRVEQIIFTVRLNHNFLAKSYIPNTFFYQTGMENIGSRRWIYKESN
FT                   KEKPQLSKLHFVRAEISNLAILEEKLNTQESRLSEAFKQDIQKIEKLSLLSPEEAIQGF
FT                   NDDWQTGKVEIVLHPLKDSSEEAVRKLKDILLANGVKEKSILIRHYPGGPTFISANITR
FT                   KALQEIGDFNPLRTVHPLKINFFPELRKIGSFPIIPTPPVGKTISTIKVGIFDGGIDAT
FT                   NPYLANYVKENSLIKTKPHPTYITHGTAVAGVVLYGPLNNYDNNTVLPNPFGLTPADWT
FT                   YAPDIKLSCNFSSSF"
FT   gene            complement(299227..300111)
FT                   /locus_tag="Moth_0293"
FT   CDS_pept        complement(299227..300111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0293"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18627"
FT                   /db_xref="GOA:Q2RLG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG5"
FT                   /protein_id="ABC18627.1"
FT                   /translation="MLRIVGVSRSTYYYQLTHEPKPHTTTGGRPFPGHSLTVGGRKVSD
FT                   EQIKEWIMESISGDGYAYGYRKLTHMLRQDHELVVNEKKVYRLCKELDILRPQRNLRRK
FT                   HPRNLAQNRTITAPNQLWEVDVKYGYIAGEDRFFFVLSYIDVYDRQIVGYHIGLTCEAR
FT                   HAVETFRAALWKRQILQRNLPLPIIRSDNGPQFVSHLFESECERWNVLHERIPPKTPNM
FT                   NAYIESYHRLLEDECLSMGEFGTYAEAYQAVVEFVSRYNNRRLHSSLHYLSPAKFYRRH
FT                   IETGLQPRYPVRV"
FT   gene            complement(300156..300497)
FT                   /locus_tag="Moth_0294"
FT   CDS_pept        complement(300156..300497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0294"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18628"
FT                   /db_xref="GOA:Q2RLG6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG6"
FT                   /protein_id="ABC18628.1"
FT                   /translation="MERRKFTLEFKRQVVEQAIAAGNNSVVARKYDIRPNIVSRWVRQY
FT                   KAGQPMQGSSPKGNATHVTQQEHARLVAENRELDKQNTHLKQLLGEKDLEIAILRDLLK
FT                   KANPHLQIK"
FT   gene            300571..301848
FT                   /locus_tag="Moth_0295"
FT   CDS_pept        300571..301848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18629"
FT                   /db_xref="GOA:Q2RLR0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLR0"
FT                   /protein_id="ABC18629.1"
FT                   /translation="MVCVESFRVLPTSDPADIELYEAIDIVEEVVPARNDINVYNFSFG
FT                   PSGPILDDEVSRFTYVLDELAWNYRKLFVVAVGNDGNLPAPFNRIQSPSDIVNGLGVGA
FT                   YTYDQNNNIIRAPYSCVGAGREGCKVKPDLVAFGGDDNRPIHLISAINHQEKLLSMGTS
FT                   FSAPVIASKAAEILGRCDKFSPLVARALLIHSAVHPSSIDLELGYGVINQTVDEILNCS
FT                   PNKVTIIYASSLSPASYVKLPIPFPKNINYNGRVKISWSIAVLSNVNPLHVEDYTNSAI
FT                   EDTFYPHDQKYRFTKKNNPNKIKDIVIDADEIRLLLADGYSKSLLPVSKSVDTLKTEQT
FT                   RRKELKWDTVVKKWDSLNASSLKNPFLVLHGLGRNGSNDRIDYAVVLTISVPGYKGKLY
FT                   EDILTEYPVLEPIRIRSINEIMITIS"
FT   gene            complement(302365..303384)
FT                   /locus_tag="Moth_0296"
FT   CDS_pept        complement(302365..303384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0296"
FT                   /product="recA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18630"
FT                   /db_xref="GOA:Q2RLQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ9"
FT                   /protein_id="ABC18630.1"
FT                   /translation="METGREQALSKALAEIEKKHGKGAIMRLGQQERLNVEALPTGILP
FT                   LDLALGVGGLPRGRIIEIFGEEGSGKTTIALHAVTEIQKGGGNAVLIDAEHAFDPNYAK
FT                   TIGVDIENLLVSQPEYGEQALEIASALIQSSAVDIIVIDSVAALVPKKELEGEFGDAIV
FT                   GLQARLMSQAMRKLSGIVSKSKTIVIFINQLREKINTGGSFGKPDFVTTGGRALKFYSS
FT                   VRIEVQRGDQIKKGTEVVGHKMKTRVVKNKVAPPFRGCELDLIYGRGMSKEGALLEMAV
FT                   EKGIVTKSGAWYCWQGDHLGQGHENACEFLRQHPDVAREIESVLKESLSGVLPQGKII"
FT   gene            complement(303503..303931)
FT                   /locus_tag="Moth_0297"
FT   CDS_pept        complement(303503..303931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0297"
FT                   /product="Protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18631"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ8"
FT                   /protein_id="ABC18631.1"
FT                   /translation="MQEYIIKAVNDLVKKYNTRDPLKLAECLGIKIFHYPFRKIKGMVL
FT                   EFMGRKLIGINSSLPKAEQIIIVGHEIGHDQLSPAGLGYFFMVENTCIITGSEEYRANA
FT                   FTAELLLAEERPRYGQTIEEFAAELGVPPELVKIKFIK"
FT   gene            complement(304019..304252)
FT                   /locus_tag="Moth_0298"
FT   CDS_pept        complement(304019..304252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0298"
FT                   /product="YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18632"
FT                   /db_xref="GOA:Q2RLQ7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ7"
FT                   /protein_id="ABC18632.1"
FT                   /translation="MSPRLPRITGIDAVAALRRGGFTVEYIKGSHYHMAHRSIPARQVI
FT                   IPVHAGKTLKPKTLKSILEKAGLTIEEFLDLL"
FT   gene            complement(304249..304590)
FT                   /locus_tag="Moth_0299"
FT   CDS_pept        complement(304249..304590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0299"
FT                   /product="Protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18633"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ6"
FT                   /protein_id="ABC18633.1"
FT                   /translation="MLPQKDLETLSKLPPERLRMVLNFARANLINQKITRRYNVKLDWN
FT                   EPTDEDGVAGYTVTVPSLPPVVTEGDTREEALENAREAIACYLEYLIITGQPVPESDTE
FT                   GENMVEVII"
FT   gene            complement(304622..305062)
FT                   /locus_tag="Moth_0300"
FT   CDS_pept        complement(304622..305062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0300"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18634"
FT                   /db_xref="GOA:Q2RLQ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ5"
FT                   /protein_id="ABC18634.1"
FT                   /translation="MDPKEFGSYIAHLREKAGFESQAALARASGVWNSTIARIEAGQTR
FT                   QPDPETLKKLAPFLKVSAQDLMTAAGYLPEEEKPTKPIDTREWYNRDDPPSNIELEEFL
FT                   RQSNVQFNGAPLDEEDKEDIIEFLKFAWKTLKKEKEKEKEKG"
FT   gene            305215..305490
FT                   /locus_tag="Moth_0301"
FT   CDS_pept        305215..305490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18635"
FT                   /db_xref="GOA:Q2RLQ4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ4"
FT                   /protein_id="ABC18635.1"
FT                   /translation="MKPKIVLKSKYLKELQEERGITDVALAKLAFLNPSQIWRVKERRS
FT                   NPGPEFIAGILNAFPDKNFNDLFFILNPLQESQEGRISNFNLSKKG"
FT   gene            306024..306767
FT                   /locus_tag="Moth_0302"
FT   CDS_pept        306024..306767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18636"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ3"
FT                   /protein_id="ABC18636.1"
FT                   /translation="MPEQPYIAVVCPSEDKIQRKNRTPDAERKWRKRHGLPPLREQGKR
FT                   GPGKAPRADRQEVARAVARVIVNNPLATTKVLAELAGLIREEADEKDRKAAAERVRQAL
FT                   KDLQKMPGLAGDEALAEAVRQAFVKREEEKERRRQERERKAAEASASQYDEDIQWLMEQ
FT                   QAIHAIEMSKGTKIGGMDLLKWAGSAYELDGNRNKYICILEPTSRPVDLPLKISATGNI
FT                   LVASGFKKGKGGGKKAVGFPTQTEL"
FT   gene            complement(307147..307740)
FT                   /locus_tag="Moth_0303"
FT   CDS_pept        complement(307147..307740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18637"
FT                   /db_xref="GOA:Q2RLQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ2"
FT                   /protein_id="ABC18637.1"
FT                   /translation="MDIGSIFKEIFNLLKYPPRILLVIMVLIITRHFDPDSFTAALAPI
FT                   QGSIPVALNILKVITLATAIYGMIGGILTLCCWMLELAGIFLERYQINVTLPPGWHYRT
FT                   INDIILCGFSWMWVSVSLIYFLGGEIQVALLFKVFSSRLPFVFLMLFVILPAIVSAVLL
FT                   IQVILDELITPSPIPKPMEIKIVDPVPIKKTENL"
FT   gene            307878..309059
FT                   /locus_tag="Moth_0304"
FT   CDS_pept        307878..309059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18638"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ1"
FT                   /protein_id="ABC18638.1"
FT                   /translation="MRKPMLLVPLLLALLITGVPIFPAAAQPYQDPNGVYYKQARVFGK
FT                   VVTFDPQRNLAVIFGSIYVYDPNSGWQLVDSRKFHLVTPVNYQIGDGLAGAVNKTVAVE
FT                   GPYQAWPGQKEEVIEAHKVETADYPIETPPWYAFGKTVTTDHIVKFNLSQVTDLVDVLA
FT                   GLQKAAGIRQDMRLTPEEVSRLAGEITYPSDDAGRSLAGRMRSELAKSWNDKWVVTKDN
FT                   AATNDMRVGVGGWQFYEGLLGYNNSYIEKAPLVRKNLDAFMDAIHPGGGTPKEEGPAAM
FT                   YALVQAERDKYGKIIKVTVSGALMDTVPGLLQAIADPSSAHIETWRLEGWTEKEAAEMD
FT                   GRYCWLSGSRVLVRDEMGNLKDQYFSLRNYLTRDGFNNTLDITRNVIGEGGVF"
FT   sig_peptide     307878..307958
FT                   /locus_tag="Moth_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.733 at
FT                   residue 27"
FT   gene            309356..309982
FT                   /locus_tag="Moth_0305"
FT   CDS_pept        309356..309982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18639"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLQ0"
FT                   /protein_id="ABC18639.1"
FT                   /translation="MVSASVVSVTGQQPQYRVQVLLHLRRLVPVTPAEAQAAAPVNVPV
FT                   TQEDLLRWKQGGTLDQQKAILVWRDYLLKVEVPVQVKENQSQVTGLPVVIANNQGEGVI
FT                   KEPGYNESASQQFITFINQFLGLYYAGGSLANFLAPGAAITAAGGWKLESVDEVLVDNS
FT                   VNPTRACVRATISAPGAGRLVQMMFLKIKMERGSYLVEDLSAQPQ"
FT   gene            310036..310362
FT                   /locus_tag="Moth_0306"
FT   CDS_pept        310036..310362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18640"
FT                   /db_xref="GOA:Q2RLP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP9"
FT                   /protein_id="ABC18640.1"
FT                   /translation="MRNRYFPILVRVGPALLAALVFVGATLTPDIAYAYDLKAGAMSVL
FT                   DLAKIVVMIAVLIGAVWSFFKNQVATMMVIIIVGAVLIAITTPGLMESVGKAFISLLGG
FT                   GTSP"
FT   sig_peptide     310036..310140
FT                   /locus_tag="Moth_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            310346..310867
FT                   /locus_tag="Moth_0307"
FT   CDS_pept        310346..310867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18641"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP8"
FT                   /protein_id="ABC18641.1"
FT                   /translation="MAPLPNQTKGNSQAGLPYFLVLPNSSPLYSTGSPNRLPSFFEVAT
FT                   MEKQETRLFKSYKSLFHIRFKIHNIGDRTLPRGLSFETLAMFAILYLPLWPLGRLLYPA
FT                   HPWVGAVIAAGAAAGMLSQCDPQGKFLPLFILGLAEYFARPKTTDYSGRAIARRRKSRL
FT                   EWKAMEVEEE"
FT   gene            310864..313287
FT                   /locus_tag="Moth_0308"
FT   CDS_pept        310864..313287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP7"
FT                   /protein_id="ABC18642.1"
FT                   /translation="MKFPLIAFKNNIVFNNQGEAYAVYRLKGEAYNHLPLAERQMVIKR
FT                   LEESFYGYEGKGQILLLCEELRLDEGGYLAAAGVSYDLPREVALEASRHARSVREALSY
FT                   GARRRRRYLVLQLRLDPQLDDIKTLLAEARDLALGTFLRSEKWLLSPRRLQEALEAEEE
FT                   LYHRVRNITAGRADFGDLDFIIRRNTRRVGVLPPPLPSRDAGRFTPAIISAFSDGCLLE
FT                   EHPGYIAITQGNDETHYQVFITFPDLPKSIPETGAEWLASLDVNEAAIDAVVHFQVTRP
FT                   FKAKKAAESRRRFLKGQIEEAIKGRDEPSVDEEYGLTEGRYLESKIQAGQPLAAMAVTL
FT                   AVAGKDLKAVRATATRTIERYTSSGYRAVRPVGDQIKCLYSFLPGAPTAAPLIECDPGF
FT                   IAAAGPHISLETGDGKGFFLGWSGAAPVWWRPGYAARELGRSNAVFITGGLGGGKSMTI
FT                   KTMGHFIRLAGGVLFVIDPKKNEYRAYERLYPIKRIDLSPGGDQELNPFMLAADERRSK
FT                   GIALDFLSIALNLRDDNDVRRVAVSQAVERVAGRPPAERNLEACLEELNMMAKEKAHPQ
FT                   VAREAGQCALLLESLRDGSLGHLVFGKGRGNEISPVTVVSLQGLPLPRTAQNLLAGRIT
FT                   ESERQGLGMLYLAAAMAREVAFSLPAHIIKGQIFDEVWMLAGISEGARLLDELIRMGAR
FT                   SYNAIPILATQNASDVASMQTIKNNVSYVLCFRAQDKSEIRSNIELLGADVEEEEEKKG
FT                   AGLANLFRSLESGWCLMKDALGRIGQVYIDPRPEYLLQVFDTTPGKEGEETKIG"
FT   gene            313280..314527
FT                   /locus_tag="Moth_0309"
FT   CDS_pept        313280..314527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0309"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18643"
FT                   /db_xref="GOA:Q2RLP6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP6"
FT                   /protein_id="ABC18643.1"
FT                   /translation="MVELKGIILDFRQAVAAQNLSKVAFDAALTVGVLVLLAEVAANYK
FT                   KRQYVKNALVGLIAFIITYAFIRYFPARGSEFELVTMLLGLWYAAQVIYNLAGRTLKTY
FT                   SEAFTGGWHAFRQAINGKKAYQHSYRQTYQAYQEASQGNNQEKEASTAGPPPGVEYLPP
FT                   RRPDPRAFDGLIGLDKAIDAIKTALELPLKQPEKIREYNLELPRGILLYGPPGTGKTSF
FT                   ARAAARYFGCSFYAVNASSLIGRYVGTSEANLRNLFAHARRHRPAVIFFDEIDAIGRRR
FT                   DGSDMNRASDILLQLLLGELDGFASREGIFIIAATNRADVLDEALVRPGRLDQKIELPL
FT                   PGARARRQLFEVYLRNRPTELNETDYQTLVARTTGASAADIKAVCDRAALAASRVRARI
FT                   DCAYLIEAINELRGRG"
FT   gene            314524..315078
FT                   /locus_tag="Moth_0310"
FT   CDS_pept        314524..315078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0310"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18644"
FT                   /db_xref="GOA:Q2RLP5"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP5"
FT                   /protein_id="ABC18644.1"
FT                   /translation="MKLRGSTHLFSGLAAASLLSTNLPGLGMAALGALLPDIDQPGSMI
FT                   SREVAGVPFGRIGRGIVGIAILGAWHQTRLPLLLPAGVAFVALAFLPHRGITHSALGLV
FT                   LAWLAIKTLGWPQVPFLIGYGIHLAEDLLTPSGIPLLYPWQERMRIPLAQTGGIIDRTL
FT                   GLAALALFLIAVGKGLLVTLR"
FT   sig_peptide     314524..314613
FT                   /locus_tag="Moth_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.500 at
FT                   residue 30"
FT   gene            315117..316574
FT                   /locus_tag="Moth_0311"
FT   CDS_pept        315117..316574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18645"
FT                   /db_xref="GOA:Q2RLP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP4"
FT                   /protein_id="ABC18645.1"
FT                   /translation="MAKRLPLVTIALLLIMFTFSLPMPAALAGIGDQTAKDWNLQGDIE
FT                   SEKAIEGQMFNIASITFLNPATTAAAVTAVGPFGLLTVGAGAAAAGLAEIAKPENAIWE
FT                   NWPLDRYVFYHYAPDKYLGMVPTAQHATSAIGDMIANLIFSLSKSITRTSINVMVLAFH
FT                   TDIVSGMIPWVSRGVADIFTNPQNDLTPVLLILGMSLLLIYSVFKLLRGQAVSVLGSIL
FT                   IALLGVGGVFFFSANAEKLIGDFTRFTDSTAGLFLGAISSYTSESQKVNISNPIDRGLV
FT                   AAGQTAWDTIIARPWAVAMFGTADESKLKLTQDEYNKMDKSSFPAESLAKIQPGMRIDT
FT                   LFLGCGGDARDAVADILGRPNKRYLLVVREDIDHGFHPGTMIGFNPANTLNHIETALLT
FT                   LLPAIAFAILIGLVGLSIIVCQAVLAALLLVLPLALFALMIPETGWTLASRYFRTLIGF
FT                   FAVKLIYGIYLSLVLVVATSFTKAVMG"
FT   sig_peptide     315117..315203
FT                   /locus_tag="Moth_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 29"
FT   gene            316574..317704
FT                   /locus_tag="Moth_0312"
FT   CDS_pept        316574..317704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP3"
FT                   /protein_id="ABC18646.1"
FT                   /translation="MLGLAMILQAAIFLAAAFFRKKFLNLIMESIQEGASKYHEKATER
FT                   IIQTNAAIARRLGLADMISDWWIARHNMGNQAGQGKEEPPSPGGVWEQMPPPPPRPSNA
FT                   KQLPPGGPPTIDIEPEPEVWEGRPPQGYPFKELGDGHEETGFILINKEKAHDTSLDTAG
FT                   AIPKGIINSRQANSNTAIKKEAAAAAADGAATPAGAGVTAAANMALTAGKKVKEGVQGE
FT                   VQAMAGPAASQPALGVRLEGGRETANLPPAAGPKAIAQNQDQTWSPAKQAPEPVRLDSR
FT                   PIINQELPLTPREPRRPEATVDGTAATTVTPAKPAIPAQPGPHAGQAAPAPQAIHRPQE
FT                   PYKASPSWPNSTVRHLEEGQPRLPRMPAPNEKQQER"
FT   gene            317766..318224
FT                   /locus_tag="Moth_0313"
FT   CDS_pept        317766..318224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18647"
FT                   /db_xref="GOA:Q2RLP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP2"
FT                   /protein_id="ABC18647.1"
FT                   /translation="MARKFLQVLSYFREKYWTWILDEEFPANEIIYALYAAFCLVIIGL
FT                   LVRVLGLEVDSLDFIILVPLTIIFIGGTMFYFAPAWFASLWIIPALPCALIAAIIQCIK
FT                   TIIQSIKTFIGGKKKRYSFLTEEELAGGFLDFSGFGGDPCGPGHNEMD"
FT   gene            318268..318933
FT                   /locus_tag="Moth_0314"
FT   CDS_pept        318268..318933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18648"
FT                   /db_xref="GOA:Q2RLP1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP1"
FT                   /protein_id="ABC18648.1"
FT                   /translation="MYIWAAKGFREKRPVYSLVIDAFMVGLLLSLFTLVLWSTIGIVFH
FT                   QTEKLANFFNGLIILIFNGIRVLFERSISLAFTTVYYVGVFYCLSLILGYLSRLLKEGR
FT                   FPPWKKGQQPRIFADSFLDVELLRLRERRVVPQVIITLKNGEKIRGKCYSYTFTEPREM
FT                   AVDSGNEARLTRHIVIVKLDENIERLELLFEEPTKKWKNPLVVTGKFISGIVRNRASP"
FT   gene            319073..320113
FT                   /locus_tag="Moth_0315"
FT   CDS_pept        319073..320113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0315"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18649"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLP0"
FT                   /protein_id="ABC18649.1"
FT                   /translation="MGGIPMDPMAATATISIAKKAGQLATSARAREGLAVKIEYLTIGI
FT                   FFLIPALLISLVLIFFLALGMDDQGKITGFQSGAPTAFAVADIPAQYLPIFLKAQEKYG
FT                   VSWAVLAAIAKIESGFGRDMGPSSAGAIGFMQFMPATWEQYKQDGDGDGRMDPYNPYDA
FT                   IFTAANMLKTDGFATDPRGAIFAYNHANWYVDMVMSQAAAYASTMLPVGQGAWPLPAQY
FT                   KTITDGYGMRWHPILKKFSFHDGIDLPAPQGTQVFAVKDGKVTWDRENGAYGLTVMLDH
FT                   GGLETKYCHLSMVAVRKGEQVKAGQVIGYVGNTGLSTGPHLHFSVYINGRPANPEEWLK
FT                   IPSGNN"
FT   gene            320128..321831
FT                   /locus_tag="Moth_0316"
FT   CDS_pept        320128..321831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN9"
FT                   /protein_id="ABC18650.1"
FT                   /translation="MAKIVTSLALVPGAGATFIATNIGAWMANKGIKTLLIDLSARGVL
FT                   GPLFLVEKAKERVYPTTATWQEFSNPASSLIKTQYGLAVLPAPERDKSTNYDLNVEAFF
FT                   DYFEPLFEVIIIDLGGDIYLPHVFPIMEKASKNILVAEPSKRCVEALPGHIKEALMQYE
FT                   PELIINRVTSRAYYHPRDIARQFNVGQYITIIDDPKSNNEAIKQRLPLSLYGKGKAAQM
FT                   LLEIGEHLFPETLRESKDTQEEQDISVKNVRNPNESVVTGRGIKIEVDQEREKEAVREG
FT                   RVKPIKIPKLLQIQGRLKKISVAKIRKKAEEQCRFQDDILITVWNPSGFFVSMTALNLA
FT                   VAAAAEGYDTALINYNFTNPETDIWFGIKQTSAKDADYNDAGIMTFGEAISPKLAVKML
FT                   KERAWGVKYLPAGNKLGNIGTPDYGEKGAQLLENIIVAIKAREARKPKVTIIETGTWYE
FT                   QPPVYAALKTCRVLFIPMSGSRQEGEIVKQQLAELKRVEVEPVTVELIFAPEEIKLPAQ
FT                   VCQERLIVPDDRERYLKASATKKPYSLLTEGGQEIWRQALKMASNLIEFA"
FT   sig_peptide     320128..320205
FT                   /locus_tag="Moth_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.748 at
FT                   residue 26"
FT   gene            322030..322632
FT                   /locus_tag="Moth_0317"
FT   CDS_pept        322030..322632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18651"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN8"
FT                   /protein_id="ABC18651.1"
FT                   /translation="MEMEMEKFEKTIDILKQMLDSGKAIIKFRKNGAMLQIIDEDTLND
FT                   LREKFNLDQKDFGKSVQDILRFIARAINDKGSENEIKQAKIQLIKDKLIDDKIKEKFWF
FT                   AVNSFGNQFAQMEWQIVAKLDKDKDNIDKDKDNINKNTTYCAIVRFRYLSENKDGLDLT
FT                   ESLVMECSLEDIEEIRNEMEKIYHTLSSYRERNLQWQ"
FT   gene            322623..323120
FT                   /locus_tag="Moth_0318"
FT   CDS_pept        322623..323120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18652"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN7"
FT                   /protein_id="ABC18652.1"
FT                   /translation="MAITYRDLNYNNRLLDMETKSLTGKGYGNTITRDAFPTYNINYEF
FT                   TIVTPYLAEEGHQTMKNNELNTIKPWDIYYASLPKLLEQQKEENEHLKKALISFKEKEC
FT                   GGNRIKAILELYKQRLLYTSDVLKFGGLSYDEFLDLINENQIPYQYEDDFTDDIEGFDE
FT                   LL"
FT   gene            323117..323599
FT                   /locus_tag="Moth_0319"
FT   CDS_pept        323117..323599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN6"
FT                   /protein_id="ABC18653.1"
FT                   /translation="MKVVSNTTALINFARIGRLDILREIFKEILIPEEVYAEIKGYTRE
FT                   RINEQRNWIKRCIITCHKTFSYLIKQGLHSGEAAAIVLVLDQLPSNKPIYLILDETYGR
FT                   KVAKSIFEDRDVKLISSVQVLKIAESKGIIQNRGTLLRQFYQEGYEPSKLDRYELY"
FT   gene            323855..324847
FT                   /locus_tag="Moth_0320"
FT   CDS_pept        323855..324847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18654"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN5"
FT                   /protein_id="ABC18654.1"
FT                   /translation="MKKIRVLITLIVLILLLAQALPAYAEMEYRFSDKGTINTDFSWGA
FT                   DDIIEAIDFELYAGYPDNTLGLNNNMTRAEFAAVLNRIVDAGGTPGPNWYDGAVDGLVK
FT                   AGVIPDKSGDWDAPITRLEAAKWLGRLAKVYQVTVKDPGATFSDTSDPDAIYANKTGLM
FT                   KGVSPGVLGADKNLLRGEAAVLLLRVAKSVDSNLPSDDELKQAMVEAIGDVNANIADFE
FT                   ARRNADLSFYDKLPYKRVTRNYFEYERKFMYAWRDDGRKNYQGKIDEVKVAEKHNAIAI
FT                   VVCKIENESGYKGIAVARLKKIDGRWMMTQGGTPENRDLKYLQLVGIIK"
FT   sig_peptide     323855..323932
FT                   /locus_tag="Moth_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            324869..326914
FT                   /locus_tag="Moth_0321"
FT   CDS_pept        324869..326914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN4"
FT                   /protein_id="ABC18655.1"
FT                   /translation="MLRKAFFRAFFFLLLLGLMAVPAFASPLGGGGYSKGTPSDSQAPL
FT                   SNGMTWFVRRVPVLFYDPSPNGAEYNTEANTFSLKNPDLVWGELWTKPGWANESSRFGL
FT                   NELYIPINPAMTPAPASGTGQVAVPMDKVTVHTANWIDPKVVINVGDIKWGEDMSPAVF
FT                   LNMPLPSRDAFLNQAAGMNAAQASKYQGIFGRQIPSSDGSVSYFRALDSFDHGSTYYYH
FT                   LFLSDGPQGNNFAVAADVPPYYDERTPTGIGFYRGKDWADNLKSDPGSVPGFIGAITPW
FT                   CNLKLTGPNEVTGAPGEEKEVEFTAVSEVGSDVTTDVGTKRDGQGQFDLPAKGVTLPAW
FT                   GKVPVKLKFKIEDQPYTVRVKVDPNESILETRYDDNYVDITVKPYAPDMYVSVLDPGAT
FT                   EVYPGQAYTGQVTFGLAKDYPSPVKGTLTLTNNGSPVPGVDGQVVEFQPGEEKSFGFTF
FT                   TGADGGNKLVAKIHPINPPDDKDWSNNSKEVSVPAVNQQPSGGNGDLVLQAYSQAGQDV
FT                   YGNYVAPIERPAGTAKFSDTVKATLRIPQPAPPRGEVTWWEIKKVSLTYPKRNPEFTFG
FT                   HPVPPEGTITINMNCPSGKIDGAKKSVNATSEFREDWSVAGAPIYDNLTGEMAPGPTEY
FT                   IITATYTVHYEYRWWELNEGWRYDDKYETKNVSAKLLVNGTGVNSL"
FT   sig_peptide     324869..324946
FT                   /locus_tag="Moth_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 26"
FT   gene            326911..327438
FT                   /locus_tag="Moth_0322"
FT   CDS_pept        326911..327438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18656"
FT                   /db_xref="GOA:Q2RLN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN3"
FT                   /protein_id="ABC18656.1"
FT                   /translation="MIRHMRHLAKEEDGFITIFLLVTTLIVMLSLMTMVAGVALGAHKL
FT                   ATATYMWFGEALNFSTNTANITGMAENTPVNTDIAMKNFISAFARMTNTTFTGNQFNSG
FT                   PGSPYPGPITLNSFTRVNPGDPIPYGTARQPGFMASITVPVWGKSLPFIGPQYVTVPMK
FT                   YFAPVKSTQLMR"
FT   sig_peptide     326911..327036
FT                   /locus_tag="Moth_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.863 at
FT                   residue 42"
FT   gene            complement(327467..328198)
FT                   /locus_tag="Moth_0323"
FT   CDS_pept        complement(327467..328198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0323"
FT                   /product="Peptidase M41"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18657"
FT                   /db_xref="GOA:Q2RLN2"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN2"
FT                   /protein_id="ABC18657.1"
FT                   /translation="MITQLNFPNINHLFLVLITFLLFISIISFKYIISLPCNLTFFFLN
FT                   LFLCSYLFNLTVLPLVPPYYNNITVLSIHEAGHAVVAETLVPGSVNSVRLFKPWQMRWL
FT                   LLFGNETMGYTNIKSSIKTQGTLSAIKNDICVNLGGLAALEVLMPENKYIGAKNDLEQI
FT                   EKWVESTVNSGLLDNEGITWNSLSDQERSQIAHNIIPPEYQRAKNIISQHKEEVLVIAE
FT                   ALRKNYYVTGDQVRSLLVKNH"
FT   gene            328684..330021
FT                   /locus_tag="Moth_0324"
FT   CDS_pept        328684..330021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0324"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18658"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN1"
FT                   /protein_id="ABC18658.1"
FT                   /translation="MVKIALEFQSHDWKAEIERQRMKIIDELAAQISREHPEIFSDQLV
FT                   DEGYAAAEKIVKNYVLTRKDLAPSEVEGVVKAIMGQATSYGPLQEFFVGKEAKEITEVM
FT                   VNPSKDGPRVFYGKHGKLHDAGRGYFKDNDEVTRYCQKICEDVGRPFTEDAPIVDAWLK
FT                   DGSRVAVMGYKVSPLGTALTIRKSPLLRPPMPLEKLVEYKMLPSLAASMMVDLLVKGHA
FT                   NIGIFGRTDSGKTTFARSLAQHIDPQERVFIAETSFEMYLPNLPNCINLVELVYGDKTI
FT                   VDMTQLCKTMNRNNPDRSIVGEIRSREIIAASQIASSTSGGFWTTGHAGDVNDLRTRLF
FT                   GMFLDGGVQLPVEFLDEIIRSMFHFLVFLDKSFDGMRTLMSLVEVTPEGYRTIIRYDTK
FT                   AFAASRGKERRWIYENTVTPEKMGKLAFSGAELKPEYEKVPEKYLC"
FT   gene            330036..330821
FT                   /locus_tag="Moth_0325"
FT   CDS_pept        330036..330821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18659"
FT                   /db_xref="GOA:Q2RLN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLN0"
FT                   /protein_id="ABC18659.1"
FT                   /translation="MLAVGLFLSLAVLFYGLTVGEFPEVDRTKDFFKVYGSAAVGAAVM
FT                   FMAGSILCGTPLGGVVWAVPGWFIPGWLMKMRENRRKERLRQVAKDIIVAAGGMFSANL
FT                   MTGEVIKTLAERIPAPLGRELADIKARRELNSYNTYPQLLNGLAEKYDLMEIKAMAAVL
FT                   AAAERAGGPAAAAKGLKRLGAALRLRDRLIQERKVATYESRLAAVVVIMILAAGLLFDA
FT                   TAWREAYTGSGKLILVAASALITGMGLFVVKTSEMRDLE"
FT   gene            330875..331645
FT                   /locus_tag="Moth_0326"
FT   CDS_pept        330875..331645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18660"
FT                   /db_xref="GOA:Q2RLM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM9"
FT                   /protein_id="ABC18660.1"
FT                   /translation="MLFLLIPGKEDEVSPAEIATGSIRRKIREQLTSGRRGQMLEAVGR
FT                   AAGDVVKAGIMSGAGLGVLGLLLCYGFMGVWAILPALVLFAVGVFLTGFLVENEFKKWQ
FT                   GKVLEGIPSLLNFIPAFREVEGVTPREALALSLPFIPRPLRDELKRALDKIARTGDVVG
FT                   AFDELAGKVKHPLVDAVCFRLATSWTTTAGGDIFADLSDQMAGLKEEMAARATTGKTAI
FT                   FALVCVLGLIGMALEFGYPGVKLLLSRLSGVFGS"
FT   gene            332055..332465
FT                   /locus_tag="Moth_0327"
FT   CDS_pept        332055..332465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18661"
FT                   /db_xref="GOA:Q2RLM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM8"
FT                   /protein_id="ABC18661.1"
FT                   /translation="MLEKVIALIGGLFFLLGFALTAGLFIAMIGQWYMLQSEAQFLAAS
FT                   QGRYGGYTVEADAQLKQFVQEHNLDRSKLKVIVSAPNAPKPWGQAVTAEITYPFDFKVG
FT                   SFIKPFTVSLTGKGEAVSMYIPGTLNVVYTSP"
FT   sig_peptide     332055..332120
FT                   /locus_tag="Moth_0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.674) with cleavage site probability 0.445 at
FT                   residue 22"
FT   gene            332443..333054
FT                   /locus_tag="Moth_0328"
FT   CDS_pept        332443..333054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18662"
FT                   /db_xref="GOA:Q2RLM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM7"
FT                   /protein_id="ABC18662.1"
FT                   /translation="MWSIRRRRWIFMGVKGRDMLLWLFWGVTIMSLACLLGGYVRPGYF
FT                   FFAGQVILTVILFYWRYLTRKTAARMSSNLGLKAVGLVPLRRGWVGFLIWLSGHRLEGR
FT                   WIKAYEVHLLPRAKKTSLTLFLEEMAADLEFLKARMPGCLFMWETSAPLPASIREYVRG
FT                   QAERGMAIWEKGQWFPGPPGAGKDIKKSKCRYGCVIVSEK"
FT   gene            333100..333738
FT                   /locus_tag="Moth_0329"
FT   CDS_pept        333100..333738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18663"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM6"
FT                   /protein_id="ABC18663.1"
FT                   /translation="MSRKVGIVISLILALIFTAAILAAGNGKYRQATKTVEVVKAVRFI
FT                   PAGERITADSITTVRVPESMASGLATNPKDLEGKEAKVSLLKDQFVWKDAAGELAAGPG
FT                   MVEVVLPVDLAASGAVWPGERVNIHIAVKNNNPGSSAPSPKICENVLVTKVLGQDGVEI
FT                   EPGKTTGLNPTTNKVPVAVGVEVPKDVEDVLVQAAANKTVYLVKVPGSA"
FT   sig_peptide     333100..333171
FT                   /locus_tag="Moth_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.739 at
FT                   residue 24"
FT   gene            333874..335493
FT                   /locus_tag="Moth_0330"
FT   CDS_pept        333874..335493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0330"
FT                   /product="ATPases involved in chromosome partitioning-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18664"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM5"
FT                   /protein_id="ABC18664.1"
FT                   /translation="MRCLICAENGAAELIKEDLMKTGLYKNWKFVTCGDAREMLGYTRE
FT                   RPDVLVVSRFLPGMDPVELLDRMPTMFPASHIVLLAGRVDENGRGYIKAAAKRGLVNVV
FT                   TGKLPGDRPYTLLEALTADREGQSILEDEEDGEENDEKIAGNGGFDNSEALGNSDYDKE
FT                   PGDTTKAGEPFKVPSRQENKITGACANAGISEKPSQRDDFDFILSSVYETPVSGRVSFR
FT                   REGSREAGIGMRVSPPKPSPGRGTGFQRRPARDVSGRAKNVDNFAGKGRSILVLTAANK
FT                   GGVGKTTVAITLAVALARAGIPVALWDLDLGAPDVATFFGIKNVPGVEALPGREIRHQV
FT                   VESLLVNVEEYLYVLPGPMDKTLPAFESGEIAGIAQVLLSMFSVVIGDTPPEFWTKGWL
FT                   EEIFPMADKVLAVVDQSKFSEAETAAYAPCLISMGVPPEKISIILNRFSPKLHNARTVE
FT                   KYFCSGFKKEVPARILPKVVATIPENWETYAQKGYKGEVAGLEDAYSQWHNLAGEIASM
FT                   AGYSYSKPEEEKRGMFKFFKKR"
FT   gene            335508..336407
FT                   /locus_tag="Moth_0331"
FT   CDS_pept        335508..336407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18665"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM4"
FT                   /protein_id="ABC18665.1"
FT                   /translation="MASTGLEARLKKMAEYLDTEAIAAALKLPVETVSDILDGKAEIET
FT                   VPAGKPAAPAVVQVNSARVAFRQRVIAVWRAKGGVGCTAVALYLAWLLKDMLRVLLIDL
FT                   NLDAGGSDLSYYLGLPEYPHLGGAGYGLETSLINVQDGFYVLQAPRRADEIKIPKGMIT
FT                   GIINAARPAFDVIIMDLPNNTEEHVIEAVSNATTMVFVTAGGEQELLRIALKIVEFNKE
FT                   ENLLVANGGKIGAGAAREIGVDKVVSIPWDGGLQKVLEGNGRPQKGSPFMEGVEALRDI
FT                   LYERTGQKGGILKKLFLR"
FT   gene            336444..337403
FT                   /locus_tag="Moth_0332"
FT   CDS_pept        336444..337403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18666"
FT                   /db_xref="GOA:Q2RLM3"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM3"
FT                   /protein_id="ABC18666.1"
FT                   /translation="MFAGLIYLLLAAGSLILWSGGFDPYQCITSACGSLSTILGRPLLL
FT                   WGAAYYSLSAVLCFSGLAATKRKAVLTIIYGGVAAHALLLFLAWRGTGELCPTCLKFLL
FT                   VEALQAVYVTAYPPGRLRRVPAALAAAGLVVVAGLLAFNPRVVPAAAMPAVPPAKVIPA
FT                   VPVEKEEKAGLPKQDFVEKKTSTGLKSLPSSVKNDTNKNPGLAVTTLDNRPVTLELAAR
FT                   PALFVAWWCLHCDEALQEMAKLPEGMRPYLVFTYLQGDDQGEIEAKLKRNGLEGTAVYL
FT                   ASEPPEGVKGVPVLVFVENGHVSHVEGVKAIEEKLIGK"
FT   gene            337427..337954
FT                   /locus_tag="Moth_0333"
FT   CDS_pept        337427..337954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0333"
FT                   /product="Peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18667"
FT                   /db_xref="GOA:Q2RLM2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM2"
FT                   /protein_id="ABC18667.1"
FT                   /translation="MTWPAWLFFLSVTVVGVTDFISHYVPNFITLPLMVAGIFYHLWAD
FT                   NWVASIFGASACFLLGLVMFTLGGMGGGDVKLMAAIGAWMGLYGALAVIFVASCIGGVW
FT                   GLGKLVKQGRLKERLVYLIQGAFLTFVGGVKGALVIERIPEDINAPLPRDVIPFGACLA
FT                   AGLWVFMLLASF"
FT   gene            337967..338656
FT                   /locus_tag="Moth_0334"
FT   CDS_pept        337967..338656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0334"
FT                   /product="Flp pilus assembly CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18668"
FT                   /db_xref="GOA:Q2RLM1"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM1"
FT                   /protein_id="ABC18668.1"
FT                   /translation="MKIFGRKKNYGSRRSIPIQAILAIIFGLAVAVASGIYYQRYISTH
FT                   QAMTQVIVPAHNINAYTQIKPGDLTWRQVPVGAVEPGTARKPDDLVGKVALAELYQGEQ
FT                   VRLERVGEVSTDDKQVVAVNIDLARSGGGYFSPGDLVDVYFAETENVPGAILASNARLL
FT                   QLVDAQGNPITLNQQGGLLQQASQSAQAPRTPAVAVLAVSPADIPQVTRGAANGSRGIV
FT                   LVKKLKP"
FT   sig_peptide     337967..338068
FT                   /locus_tag="Moth_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.540 at
FT                   residue 34"
FT   gene            339322..340680
FT                   /locus_tag="Moth_0335"
FT   CDS_pept        339322..340680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0335"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18669"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLM0"
FT                   /protein_id="ABC18669.1"
FT                   /translation="MFGIVKNDRADKADKKEEYRLGKRTLQEATKFVQDIITNSEVWGE
FT                   EAFRHKEILEDAQAGLPGAIEKARELIKEILDKYQVEVEGMTREQLAREIFSYAWGLDV
FT                   LEEAYYDPEVDEIRVNGPSAVFIQKRGKNVKTGIKFKDAEHVKKIIARLLFHDRGVALT
FT                   ASTPIVESIRKDGTRLTATCPPVTREWTMVLRKHDTFQMTPENLIRAGTLNQELLDLLI
FT                   TMVRGRANILISGGVGSGKTSLMRFLISYIHEILRIVTLETDVELRLCEHYCGRDIIEL
FT                   EEHADLNCDMKKLFRTTLRYSPDIIMVGEIRGMGEAVEAIKACTRGLHGSMATIHFGSP
FT                   YEAVTGCAKMMLEEGLNLPLEIAETWVADAFDVIIQMFADSTRGIKKIVQVTEVWPEKR
FT                   GVNFHDLVVWRPSKYDYFEGEWEFVNPPSERLQEKLFKYGVNMSRFSSKAGAA"
FT   gene            340680..341630
FT                   /locus_tag="Moth_0336"
FT   CDS_pept        340680..341630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18670"
FT                   /db_xref="GOA:Q2RLL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL9"
FT                   /protein_id="ABC18670.1"
FT                   /translation="MDYFQLAFVAVFGAGLGVSAGGLCYSALRLLKAPRLALPRRKSRE
FT                   MPPVIRRFLHQGQGNEDELPPWLKQWSERTSLMLKRSGVHIPVMRYLVGLLAGGAGGFI
FT                   TGVTLMKNLPAAVILALSIALAPDVVLIGRVQNRRNKIIEQLAAAVRIFAAEFGDTPQV
FT                   PRALSITAQKVPAPLGDILRQADTDLAAGKSIDDVCLYLMKELDFEYGRMFVQLLRLAW
FT                   DDAAVRPLFTRLAGRIANLQGLIYKNASGMAYSRFMGMFVNALILPEFLLMRSVVPETG
FT                   YFLVYNPLGRLLVVVCFLSILVGMILDRVLSGVET"
FT   gene            341627..342406
FT                   /locus_tag="Moth_0337"
FT   CDS_pept        341627..342406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18671"
FT                   /db_xref="GOA:Q2RLL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL8"
FT                   /protein_id="ABC18671.1"
FT                   /translation="MTLVLPALFGGGVGLAAGMLLLLVLRMTPSARLADRLSSLAKPNP
FT                   SRLSGKKLKAGGRQALVPALGGAIFLGLIAGKMPYALVAIPVGAALGFLASRIAVKLYQ
FT                   SRTHFQRLREAAVLYESIDLFTRAGFTPRQAMELSLPLLTLLRPAVERCIASWSGGALR
FT                   AIEQLGNDINLKEADVLIAVLMQIVEGGVAKLAGVMEEEALRLDELRQNLGEMRIAAKP
FT                   VYSTVYIFLPVAALVGMLLGPLAFRAISMISNLRAGY"
FT   sig_peptide     341627..341731
FT                   /locus_tag="Moth_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.907) with cleavage site probability 0.487 at
FT                   residue 35"
FT   gene            342438..342707
FT                   /locus_tag="Moth_0338"
FT   CDS_pept        342438..342707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18672"
FT                   /db_xref="GOA:Q2RLL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL7"
FT                   /protein_id="ABC18672.1"
FT                   /translation="MLKGIVEFLKGEKGAVTTTELIGYSLLVGGAVALVGFGATALFRG
FT                   KTGAIFGAVKNMKAMSGAVSDTSTYSATLTTDTNTGIATGATGN"
FT   gene            342981..343544
FT                   /locus_tag="Moth_0339"
FT   CDS_pept        342981..343544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0339"
FT                   /product="Peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18673"
FT                   /db_xref="GOA:Q2RLL6"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL6"
FT                   /protein_id="ABC18673.1"
FT                   /translation="MIYLPDAVMLAAAAIAVYTDLKTGLIKNWLTIPFFLAGLVKATLS
FT                   GPGILPDLMAGLAAIPATFIFLSPGEGDIKLAAGMGVWLGPELLPVYFIGAGLARLVMA
FT                   LAVRLKVYDWDVVAMAKGTWISEIRLGSVPALGHKNFRMFQRAGEMAGADTDLPVVPGA
FT                   IFVFGGALAVVLFRVIFFLSARGI"
FT   gene            343547..344173
FT                   /locus_tag="Moth_0340"
FT   CDS_pept        343547..344173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18674"
FT                   /db_xref="GOA:Q2RLL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL5"
FT                   /protein_id="ABC18674.1"
FT                   /translation="MAAFKRSLKKFKKRPAGLYLARGLNPGIDSRRDGPGHNGGVEGPA
FT                   GGNPQLGSQYYSKFNGRRFLRDARGFVLLEFLIVFLIMAFLTFGGVDYWVILSKHQYAE
FT                   HLVNYYLQRMEVEGYLSVADENDLMARFNAFSCPVQGIQGPRQSQGAARVLRNPSDLDA
FT                   STVSLQVTCRPQPQPLLIGRIIGGIVPGGFTIKVGGSALSERVSP"
FT   gene            344206..344844
FT                   /locus_tag="Moth_0341"
FT   CDS_pept        344206..344844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18675"
FT                   /db_xref="GOA:Q2RLL4"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL4"
FT                   /protein_id="ABC18675.1"
FT                   /translation="MLKRLLKDQRGPALIWFLIFLPVLMLGMAYLADYTQATTESDIDV
FT                   QRALEMAVRAAAMQVTPDSQAAGHPRINIVAANIAFRRELASNLGLDANTLAPLKGSAM
FT                   KTRPDYTLVVYNGDDTYAAGGALEAYKYVFSGGLTGGMMAAAGFPYTFGITSSDVLPGG
FT                   GGTLQTSLDMPGVVAVISTSVTKILGKSSITPVRWAAAKIVCPNGSCGP"
FT   sig_peptide     344206..344295
FT                   /locus_tag="Moth_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.623) with cleavage site probability 0.347 at
FT                   residue 30"
FT   gene            344841..345569
FT                   /locus_tag="Moth_0342"
FT   CDS_pept        344841..345569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18676"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL3"
FT                   /protein_id="ABC18676.1"
FT                   /translation="MRKKIFLLIAVLTIVVPLLISALQHVMAMPPRNTVEVYLSALASG
FT                   DRERAKSVSTGRAAEAAGKLEGKNLAARVDEISTSLQALGRDWARVKATVELTLKDGTA
FT                   DVGWYELDVMKEAGGWKVISLREDAPDLSGWDLVGGSSKDVVAAREVFAGYLDALAAGK
FT                   WDEAVKYLAGPARKSIEASRDVLSKGKIIGRVDDLQSKLVWAKGKEMIVEFSYKADAKA
FT                   VELTAELYHTPQGWRITALR"
FT   sig_peptide     344841..344927
FT                   /locus_tag="Moth_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.798 at
FT                   residue 29"
FT   gene            345705..348446
FT                   /locus_tag="Moth_0343"
FT   CDS_pept        345705..348446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18677"
FT                   /db_xref="GOA:Q2RLL2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL2"
FT                   /protein_id="ABC18677.1"
FT                   /translation="MAGLRFCKKVKNRLLLSIWARVILIGMLLVSGVFFIATDAYAASW
FT                   VDTGYPGFKYGSILLTGTDGKIWAIGAAYGVYNGYGFDTRSSYWNGSSWVSAGIVSSDY
FT                   WNTGYWTRPAGATVGKDGKIWVLKYKETDGENYTGNYYVSYWNGSSWVDTGQIGPSGIS
FT                   ASAGGALTTGADGTIWARLNGQIYRWNGYSWVSSTGGPEGWKSFSTATGTDGKSWKWGY
FT                   DQNGTARVQYWNGSSWVNTELYAGWQHGPGSITVGLDGKIWASVSGYNGYLDYVAYYTS
FT                   DNTLSLVPSPNGATGQLVLNPRTWGSQGVFVALEGSNDGVNFTSLGIPGAGTISVTPTS
FT                   NTYYVRAVLTIQFTPDFTKTFYSNVVSVPTIINAPTVTQQMGIVTWDQTRGRSWIKLNW
FT                   NAVSNASGYKLYVFDGNQYQVKDLGNLTSWDSRTSKIFPFPNELPENNSISTNLFHWDG
FT                   SGTDFEDTAKRLYRTTTGISYDSYNNYWFRVTAYNQWMETNWNAESCIVAPQLPNATDG
FT                   QQPTGSVNAVSQEGLKKTYNTGIKVTVNAQDNLSGVRRVELSNDGVGYTIQYEAPLNPD
FT                   NGTGIASYSNTFDWDVSPGAGTKVIYVRITDAVGNQKVVTDSIALADDVLPPSVTLSIN
FT                   NGASSTTSASVTLTITATDNSSVPSQMQMRLSNNGTLWSPWQAYQQTITWDITNASYGG
FT                   TSAAGTKNVYVEVADAAQNYSMATASIGYNPSPPTGTVNIVGAVSGTYNGQQAWFTNSN
FT                   DLILNLNFSGAAKIRTAVNGMPWSEWQPYSTSFEMALPVSQGLAVINLQVADAYGVVGQ
FT                   QQTLRVLIDSQPPVISKLRGYNGLTATSSTSVNLEIQASDNLPGALQYQYQVNGGAFSS
FT                   WANLSSNTISVSGLANGANNINVNVKDQAGNIASASTTIFKI"
FT   sig_peptide     345705..345833
FT                   /locus_tag="Moth_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 43"
FT   gene            348912..351116
FT                   /locus_tag="Moth_0344"
FT   CDS_pept        348912..351116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18678"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL1"
FT                   /protein_id="ABC18678.1"
FT                   /translation="MVGEVLLTARKIFSALVLAGLCLFLRAGPAFAATWQYGITASDTP
FT                   ATIDSSATTAVVDTTLHEIRLPKYNAHAASFWPDGGPDYVVMAPGKVVHFSFDGTKMVE
FT                   NTILDVPLSSNPLAIAAGDTYPDVVVATKDKLYHYSFTGTGMIENPALSVAGLAGAVAV
FT                   GVRQGEVAGLLNGSVKDYMFNGTGMVEVPYLEPLGLTNPLDFALMAGSYDVAVLDGNRV
FT                   RYFNFNGSGLVENPALAVTGFSSPVAIAAAGEKDLVVVDGKQVKHFSFDGSAFRYNAAL
FT                   SVTSGLNNPVCVAVRPGTYDRIIIDGDQVMYYSWDGSQLVYNPDMSVTVAGLSNLGSYA
FT                   PSAVAVSQTKDPGNNVDYVRVRAYVIVPDKTSITFSLTADGTNWVKVWRVRGTPTGPVA
FT                   EVTADNGATWTAVGDSQAVSPASADTRLWAKLPAGRAVMWRADLATSDPNVTPKIVAFN
FT                   GVAVVWDTDAKPYPPVIDTPGTCYTTTTPTLTWSFSDPDPGDSQSAYQLQIVRASDLQL
FT                   VLDTGKVMGSSTQYTVPTSGTPDVPGPLWASGDYRFKVRVMVWDQAGVESDWSDWADFC
FT                   VVAFERPRIAGIASPPPGQVAPDPANPSKHILITPGMTAAQLPKVKAGAKVTLLIDSVG
FT                   PLDAVTAVFPYGAGHQATIGFGPVAATVNGTNKTWQVEIWTDPSLEVTPEGTVVMMQLS
FT                   GTGAAGSAALDAPPYADGVVVTEGTVYNDWFVVLQGRDTS"
FT   sig_peptide     348912..349010
FT                   /locus_tag="Moth_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            351196..352242
FT                   /locus_tag="Moth_0345"
FT   CDS_pept        351196..352242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0345"
FT                   /product="plasmid segregation actin-type ATPase ParM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18679"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLL0"
FT                   /protein_id="ABC18679.1"
FT                   /translation="MLAIQTNPQPAALAIDVGFGYTKAVSSTGGKVIFPSVVAPAGSPD
FT                   AFDRLDKSDTGYRVRIKKGIDGLLEEWLVGELALKEGREVQYFQDWEKHSHPAHDAVLL
FT                   AAAVLTWNWPRAGSGIMGISNPALVVGLPVDVWRDELQREGLKKHLAGLAAEVSVNGND
FT                   PVRVTFSRVYVYPQAAGAFLTVPDLPDSGIVALVDVGQKTTDSAAIEIVNGRQRLVKTM
FT                   CFSINKGMAALVEAVREEFRRQTGAPLPPQQAWETVKSGSLWYRGKQIDMAPAIKKARS
FT                   EIARAIADQVLAGWGERADFVRKVYLAGGGILDLPDLKNMFPAAAVLPGPQWANALGFL
FT                   KVARGLAV"
FT   gene            352807..353559
FT                   /locus_tag="Moth_0346"
FT   CDS_pept        352807..353559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0346"
FT                   /product="diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18680"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK9"
FT                   /protein_id="ABC18680.1"
FT                   /translation="MPSKNLIAPGRKAVSILLSKREVEAVIRHPERIRVYYQPVVNIQS
FT                   GRPWGYEALVRGDGVLAKPGRLFKSAGAWGFLGELDAACFKAVLAGGMPREGVLAVNVT
FT                   ATGLVNLDAAAYANPSLIIELTEYGQREPRELAGVLERWRRDGARVAIDDVGQDSGQLR
FT                   AALHLKPDFIKLDRSLVAGCDRQAAKRLFLAQALEVCRYLGAEAIAEGIEKPGELKVLR
FT                   DLGIEYAQGYLLGRPQPGWKKAVMAGGG"
FT   gene            353566..354144
FT                   /locus_tag="Moth_0347"
FT   CDS_pept        353566..354144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18681"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK8"
FT                   /protein_id="ABC18681.1"
FT                   /translation="MRIGVDLCNTIANINAMLVMKFTRLSLTRYPDPEIPEGFFHTTEG
FT                   LELLSKAQPFPCAAGTLRFLASAGHEIIYLTSRPVLAAGLTREWLAVNSFPRGTLMFLP
FT                   RGFKALFARYYGIEWFFEDDPLEALRLNDVVSRVFVKIWPYNLGVQGPGIVRFVNWREV
FT                   LFLVSGRKRAGAGVVHERHDYGARIGARG"
FT   gene            354239..355108
FT                   /locus_tag="Moth_0348"
FT   CDS_pept        354239..355108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18682"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK7"
FT                   /protein_id="ABC18682.1"
FT                   /translation="MARCAGENRVAWPSLSNIAAHCGISRKTAKRAIDELIARGLLAKE
FT                   ARVTDLGDYTSNIYTLREPGPGEFTSMPSGEGGRVPQTLPCNEMPGVGYHRPYLGSDRP
FT                   YVGSEVHSKNTKLRITSEEDVVVVKAAPGEKSAGAGGQQEPTQCADMVIGLPASTGPVL
FT                   QEVPPVNTEGDGNKPGTTGNEQDRPESLEVPEAAAQIQELFIKTAGYPLPEGALKELAG
FT                   YASEYVTQKIKMLENGKEKANAVGWLLEACREDYRHLPRAKKGKGKLPRPPGSSKEHDK
FT                   YRELYRLV"
FT   gene            355643..357712
FT                   /locus_tag="Moth_0349"
FT   CDS_pept        355643..357712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0349"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18683"
FT                   /db_xref="GOA:Q2RLK6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK6"
FT                   /protein_id="ABC18683.1"
FT                   /translation="MVNACDAGREGELIFRRIYAWCKGQKPVKRLWLSEATPAAIKEAF
FT                   RHLRVGEELDNLAAAAEARAQADWLVGINTTRAFTCRHNRLLSVGRVQTPTLALVVARE
FT                   REIRAFKPEPYFEVWATFRKSTGETYRGKWFREKQDRLQDKKKAGDLAKQISACGIVEK
FT                   IEQKEVREQPPQLFNLNDLQKEANKKYGLTAQKTLDAAQALYEKHKLLTYPRTDSRHLT
FT                   TALVRDTLAGRLEALTGIPAYAALVPENLPQLGKRYVDDSKVSDHHALIPTAVNPDLSK
FT                   LSPVEQKVYDLVARRFLAIFYPDARYAVTRVVTTAGGESFLSQGRVELERGWKAVYGRQ
FT                   EEDGAESKDEESQTLPQLVEGEEVAVQGVEVKAKQTRPPQRYTEATLLAAMENAGRLVE
FT                   DKEMADTLKTAGGIGTPATRAAIIERLIQVGYLRREKKNLLPTAKGETLIGLVPEEVKS
FT                   VELTARWEEGLKEIEEGQRDCKEWLEGIKNFTTEVVRMAREQEAAPGADPDREVLGQCP
FT                   ICGREVMEYPKSYSCSGYKEGCRFAIWKEIAGKKVTASQAKELLQKGKTGVIKGFKSKT
FT                   GKKFDAALTLGEGGKVNFEFAEGNRETLGKCPLCGKDVTESQKGYGCSGWKEGCKFVIW
FT                   KEIAGKKITAGQAKELLQKGRTGVIKGFKSRAGKEFEAILVLKEDGKLEFEFEG"
FT   gene            357716..358015
FT                   /locus_tag="Moth_0350"
FT   CDS_pept        357716..358015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18684"
FT                   /db_xref="GOA:Q2RLK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK5"
FT                   /protein_id="ABC18684.1"
FT                   /translation="MLRRKILQSVKSFWCFPKPYTFSNDPQKDAGGRFGIRVVITCIGI
FT                   SLIYLLFWIFGLGMVSLAIFKMSKIVILKVFALSLWVYFYFIRWLYAEENAYKD"
FT   gene            complement(358003..358656)
FT                   /locus_tag="Moth_0351"
FT   CDS_pept        complement(358003..358656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18685"
FT                   /db_xref="GOA:Q2RLK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK4"
FT                   /protein_id="ABC18685.1"
FT                   /translation="MQFQLSSMVSNIISLSKRPDKIFLLLVISTIMKLVEPDLFNQGFE
FT                   LISGSSFSPKVLLVLKLACILAAIYGFIGSILFLLFSVLYSLEHGLEKYFGCSKYLTVP
FT                   NWYNGTFRILSTGFIWMWILAGFIWLFWGYNEIPAIIINYSFPTNFLAKAGFIISAPFA
FT                   SLTLPLFLWTFLYELASFGGAKSDPVKIMIIEPIIINKIREPVNIKVKDSNQSL"
FT   gene            358798..359613
FT                   /locus_tag="Moth_0352"
FT   CDS_pept        358798..359613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0352"
FT                   /product="RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18686"
FT                   /db_xref="GOA:Q2RLK3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK3"
FT                   /protein_id="ABC18686.1"
FT                   /translation="MFPEGFKPGLSTLNILYEARNNDWSIEAIVSRVTWPDGQGAVWEL
FT                   IFPDIEEVRGLVPASESGLPKNVPMEALTGQTIRVKVKGIDKENNLAACSRVEVVAEAK
FT                   ERLLKTLVEGEKLDALVRAVLARPSRLVLDIGGGVLVVVPREKAAYNRALPLNAQYNPG
FT                   SLIKAQVEKIDRQEGIIEVAPINPWEKADFRRGDFISGKVIRVYGKRHVLVEVPPGITG
FT                   LAPYPLRKTINQGDQVTCKVMAFNKAKKILHLQWGDYRAAGNRKRRQMG"
FT   gene            359813..360208
FT                   /locus_tag="Moth_0353"
FT   CDS_pept        359813..360208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18687"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK2"
FT                   /protein_id="ABC18687.1"
FT                   /translation="MARWVDVFTAIGPFRLWLPAESRPPLDAQEACRLAVYGLFFSLAK
FT                   NEVPGFSWQLVKARNSPLQAQMAFNGANGPEKWLIDAPRLDEEINPVVDVYILPMEGRK
FT                   REIPGKKFILDELLLQPGMLKEKIKLA"
FT   gene            361206..361517
FT                   /locus_tag="Moth_0354"
FT   CDS_pept        361206..361517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0354"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18688"
FT                   /db_xref="GOA:Q2RLK1"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK1"
FT                   /protein_id="ABC18688.1"
FT                   /translation="MVIAEIPYADEGGGKTRPALVLSSYEHNQNRRDLVVAKISGTGVF
FT                   SPWDVKISKWPEAGLMKPSKVVCDHILVVNKASARKIGHIDPGPLAEVKKKIGLLLSL"
FT   gene            361600..361989
FT                   /locus_tag="Moth_0355"
FT   CDS_pept        361600..361989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18689"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLK0"
FT                   /protein_id="ABC18689.1"
FT                   /translation="MSLKEHIKNANRESSGLGFLRGREKGDFEKLIGQEVALENAAIVQ
FT                   SNYNDGAENVIFTVRGDNRHYYRTSGNVVVNGFKEIAEGLEEEGLSWDIIGVTFSRVKS
FT                   KNGRAYYTARFRDLRSPAEGEEEAI"
FT   gene            362044..362301
FT                   /locus_tag="Moth_0356"
FT   CDS_pept        362044..362301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18690"
FT                   /db_xref="GOA:Q2RLJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ9"
FT                   /protein_id="ABC18690.1"
FT                   /translation="MEETKKEAAMTGEPPHRLVSEEFFFLLNRIDRLDEKMSAGFSEVR
FT                   KELNDVRKEIGGVYRWSFGLLVTMLVGFAGVIVTLALGLR"
FT   gene            362392..363306
FT                   /locus_tag="Moth_0357"
FT   CDS_pept        362392..363306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18691"
FT                   /db_xref="GOA:Q2RLJ8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ8"
FT                   /protein_id="ABC18691.1"
FT                   /translation="MGRKPALILLTEGGKGRAGGPPGRMKYDTEKAREALNRLLAMFAS
FT                   GDLPPAVARTLIRPQGGQSKPSDTWSLGNRLLMYLAGTEDARGFHQWQEAGRMVKKGAR
FT                   AFHILAPCTVKKIVKVTDPETSEEREEERRVIVGFRFIPVFRYEDTEGKPLPDVKYDPP
FT                   EPPPLQEVAKAFGVQEIIYAPGNDGSYGFFSWSNGKKIVLHTHDVKTWFHELGHAIHHT
FT                   FRPLQGGQVPEQEIVAEVFAATMCEIHGVRGYHQYSWEYIRHYARNNPQEALKAVFRVL
FT                   ADVEECLNRVFAARKALKDIRAA"
FT   gene            363360..364346
FT                   /locus_tag="Moth_0358"
FT   CDS_pept        363360..364346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0358"
FT                   /product="TOPRIM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18692"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ7"
FT                   /protein_id="ABC18692.1"
FT                   /translation="MQALKGTCEPFRRVSRREPCPICGKTDWCGINSRLAVCMRVKSNH
FT                   PVSNGGWLHKLAPGVVKEEVYSPAGTNPAAPIATRNRVYRAFLSCLHLLPEHKKDLLRR
FT                   GLSEEGIKRNGYKSVPSSAERWRLCKELKERGYDLAGVPGFYQARGRYGGHYWTFKALP
FT                   GYFIPVRDSQGRIQALQVRLDQPDGTGKYRFFSTPNQTGGSSSGAPCHVARPEELKDRR
FT                   VWVTEGPLKADIASRYLGSVFIGVPGASNWRPAVEAIQELGAREVVIAYDRDKIVKDAV
FT                   RRAERELKADLRRKGIRVFIASWNQEKGIDDALVSGCEITVKEERGA"
FT   gene            364346..364771
FT                   /locus_tag="Moth_0359"
FT   CDS_pept        364346..364771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ6"
FT                   /protein_id="ABC18693.1"
FT                   /translation="MVEELIYYFVDEEHEGNFKELCAAMKSMKGNREYRAAGYILALPE
FT                   LYPKARQYFSDAGFRWFDLLKKVDLSSGHRIMVNLAVDLFGGATDRPLFNVGDAIAVLD
FT                   TKMYRAALAAIQIRRPVFGVSPTRSEGLNRSGRYVSM"
FT   gene            complement(365043..365438)
FT                   /locus_tag="Moth_0360"
FT   CDS_pept        complement(365043..365438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ5"
FT                   /protein_id="ABC18694.1"
FT                   /translation="MPPFGVPETGCARFRPPVSPPASRPAAIRAARLNVYLLSSVNVKA
FT                   VSRFTALFDCPRVPADRHVIGLPPVTVAGLARRPFELSIHTAHAAFGGASPGLAGQIAA
FT                   LTPVGGDPAMGPGQGWRRFDSAAAALL"
FT   gene            365955..366911
FT                   /locus_tag="Moth_0361"
FT   CDS_pept        365955..366911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0361"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18695"
FT                   /db_xref="GOA:Q2RLJ4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ4"
FT                   /protein_id="ABC18695.1"
FT                   /translation="MTKRSARKSGTGIKSPTQEGNGLFRNLEVQFEKVYRQAVKDTQGK
FT                   VSIKTHFRYRDSMKKFLSFCATRFRLQNLRNISDKHLEAYIDYRRGNETSEKTIKGDLA
FT                   AVRFFHRYIENARFQLSGNEKFGLASTPDGRADRAWSDGEYERMIALAERLDRPEVALA
FT                   MRLARYAGLRVHEITRLSRKDAEQALAAGMLHVKGKGGKERDIPLATEAAVALKEACEM
FT                   AASENDKLLVPPGEKTHLVIKRIQNFIRRHRDKVMELGKEVNITFHGLRHAYAREQFRV
FT                   KVGELKKIRRALAEVSEKLGHNRPEVTKIYLGSEWKR"
FT   gene            366984..367250
FT                   /locus_tag="Moth_0362"
FT   CDS_pept        366984..367250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18696"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ3"
FT                   /protein_id="ABC18696.1"
FT                   /translation="MPTICEFLGYKVYMFYQDHSPPHIHVIGKGFRAALSIPEGKLLAG
FT                   TLPRRVQGVAKMWVRQEATALMQNWLRAEAGEVLQQVKPPEGW"
FT   gene            367257..367529
FT                   /locus_tag="Moth_0363"
FT   CDS_pept        367257..367529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0363"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18697"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ2"
FT                   /protein_id="ABC18697.1"
FT                   /translation="MLREIRSAYPVKDYHLILEFDTGEYKIIDLRKFLKGPVFEPLKDP
FT                   SYFKQVKVDHEAGTVTWPNGADLDPDVLYNRSLPLRLPGEDIAQG"
FT   gene            367539..367841
FT                   /locus_tag="Moth_0364"
FT   CDS_pept        367539..367841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0364"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18698"
FT                   /db_xref="GOA:Q2RLJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ1"
FT                   /protein_id="ABC18698.1"
FT                   /translation="MTTTFREHLKEQLQDPQFQKAWEETELAYQVARAVIKLRLDYGLT
FT                   QEELAQKTGVPQSVISRLESGRHLPSLRSLEKISKKLGLQIRLDFIPTQAQPHLN"
FT   gene            367931..369916
FT                   /locus_tag="Moth_0365"
FT   CDS_pept        367931..369916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0365"
FT                   /product="TRAG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18699"
FT                   /db_xref="GOA:Q2RLJ0"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLJ0"
FT                   /protein_id="ABC18699.1"
FT                   /translation="MFNKIFAGLTEKTGNNGIGLFLLAVGFITSLAVLYIIDVWLLGPV
FT                   AAIFAAAYKWLAGGLHGHPNYTAAWWYFQHPVATARAWLGGHLSQPEVRSWWFGLNVLI
FT                   AVMWALRRIAWQFDWTISKNPGIKIKKDDATYGSARWAVKSDLARVCDFGFGPGIVLGA
FT                   LGAAPVRIPPKPKTWMNRHVLVVGAPGSGKSRGYVRPNIFAAVRSGESVLVTDPKGELY
FT                   RSMACWLKSKGYTVKGFNLVQMGQSDHWNPLAEIRTPLDADVFAQVVINTTETGPKKGG
FT                   DAFWDRAEQNLLKALALYVTTELPADKRNFGSLYDILAAGDFEQVDALFAKLPPGHPAK
FT                   GPYNVYAMAGDNVKGGVVIGLGTRLQVFQQEMVRRITGDSDIDLTLPGKGKCAYFIITP
FT                   DTHGAFDFLASLLFTFLFVRLVEVADTSPNGRLPVQVRFLLDEFANIVSIPEFEKKIAT
FT                   VRSRGLDCHVIVQSIPQLERKYGRTWEEIMACCDTKLIIGVKDDTTARYVSRMLGESTV
FT                   ETRSSTREVNPIWGQGLFDDKRSLGITGRELMTPDEIQKMRSKFCLVFLPDGTPPAKLK
FT                   VLDYEQFPEAKELKKVIVTEKKEEEKELETEDELNDGGNEDYHDTIDRQLVEDGEEKLM
FT                   EENIKEGDRVIVTENNTSNGKIIVPW"
FT   gene            370314..371285
FT                   /locus_tag="Moth_0366"
FT   CDS_pept        370314..371285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI9"
FT                   /protein_id="ABC18700.1"
FT                   /translation="MIVDLKDVLAMEVPKAALKYIAQTNELKPGGTSIEHYADVLVHSP
FT                   KTIDIAKVLARQYRYAGRTAVNLFIPTSGISRDWNNPKYFKAEMEKKYGPDIFTDGVKP
FT                   QLTEEPKLIRIHEDGSRYILTFSYLGKPRRVLDNYEIVKRRPQLIDFVLIHFEPFMIEI
FT                   RTPMQDTKKFKSAVLKAMGITKSTFEEEVTWEQITKLTDKEALELAIILRAKLRNAKHQ
FT                   MLEGIYATKEVTASPTVKDLSKEEEYLKEFKDIPCKKRVFNFLFEHSYGLKEDISYQIT
FT                   DQGLNFITPVSEEVISFVLDKIIQIRKKAWGSGSENFPKTGT"
FT   gene            complement(372469..372867)
FT                   /locus_tag="Moth_0367"
FT   CDS_pept        complement(372469..372867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18701"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI8"
FT                   /protein_id="ABC18701.1"
FT                   /translation="MSQEANASTIFDKIKEGPPEKKDPVLEELECIINELQHNKDKKEE
FT                   NNKEEDKKEDKKIGIEFECGDCCKKVINGSKLFFIKHFAVLLPAHGDCLFLKIFSGGKL
FT                   VDKQIMRAIIIPVDRICAIEINPVQVDP"
FT   gene            373185..374132
FT                   /locus_tag="Moth_0368"
FT   CDS_pept        373185..374132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0368"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18702"
FT                   /db_xref="GOA:Q2RLI7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI7"
FT                   /protein_id="ABC18702.1"
FT                   /translation="MNSRTEHEKERNNSPGVAVEGFLATLTSCRLCPRACGVNRLAGEK
FT                   GFCRAGVRPRVALATLHHWEEPCLSGSRGSGAVFFSYCNLRCAFCQNYRISWQGRGREM
FT                   EIEDLTALFLDLQAQGAHNINLVSATPYTPMLVPALREAKKRGLKIPVVYNCNAYESLE
FT                   SLRSLAGLVDIYLPDLKYIDDGPARRYSQAPNYFSVATAAILEMQRQVGILTFDAAGLA
FT                   RRGLLIRHLVLPGQAEAACRVLEWVKANLPRETYLSIMAQYVPVWQAQRYPEINRRLTA
FT                   AEYESVLEYFDALGLENGFCQELDAATTDYIPNF"
FT   gene            374298..374618
FT                   /locus_tag="Moth_0369"
FT   CDS_pept        374298..374618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18703"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI6"
FT                   /protein_id="ABC18703.1"
FT                   /translation="MMIYQDKTLTCKECGAEFVFTAGQQEFFAEKGFTNEPSRCPACRA
FT                   ARKQRTGGGQRRNDFYSGPRQMYKAICSQCGSLTEVPFEPRGDRPVYCRECYSNMRARN
FT                   YR"
FT   gene            complement(374694..375770)
FT                   /locus_tag="Moth_0370"
FT   CDS_pept        complement(374694..375770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI5"
FT                   /protein_id="ABC18704.1"
FT                   /translation="MQRLITLLAIFFLLISPVPPASSTSITDTLKQRLLDNENQENRLL
FT                   QEIMLLDARLQKAEQEGQELANRLAAVRQQLQAARSRQIQAEARLAAGRRDLNRSLRFF
FT                   QVYGTSPFILAAFFSNDLPDFFIRLELLKYLGNHFVGIVRYNLALYRQAREEGSLVAAR
FT                   EQELRQAQATLLESEERLTALRLKRETDLDSLRRQSTTWSQDLLALEKAWSGALPTLYY
FT                   LLQQLPALPWKNLKPDAVSVDLSRGEVQAIFSQRNLNATLLTPAELPGVSLILSGEGLT
FT                   IPGPDFQIRGSLQVAGPHQLLFTPTEVTFAGLPLSPATRNELLPREKLTIDLPPPDYGL
FT                   QFKEINFAPGRMSLILKK"
FT   sig_peptide     complement(375699..375770)
FT                   /locus_tag="Moth_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.354 at
FT                   residue 24"
FT   gene            376031..376846
FT                   /locus_tag="Moth_0371"
FT   CDS_pept        376031..376846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0371"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18705"
FT                   /db_xref="GOA:Q2RLI4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI4"
FT                   /protein_id="ABC18705.1"
FT                   /translation="MEILIMGFLTGILGAMVGIGGGVLLVPFLTLVFHVPIHTAIGASI
FT                   VAVIATSSTSASTYLESRLTNLRLGMTLETATATGGILGGLTAALLSRQVLSGIFAVAL
FT                   VGTAYSMFKKVKGGQPREEVEDTGRLGSTFYDANLKREVRYNVKRLPLGLFISFIAGNI
FT                   SGLLGIGGGVIKVPMMVLGMGVPMRAAAATSNFMIGVTAVASAYIYYTRGFVDPLIAAP
FT                   TAIGVFLGAMLSSRLAGRVNSNFLAKLLAVVLIFLAVQMALSAAGIQVR"
FT   sig_peptide     376031..376159
FT                   /locus_tag="Moth_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.383 at
FT                   residue 43"
FT   gene            376860..377231
FT                   /locus_tag="Moth_0372"
FT   CDS_pept        376860..377231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0372"
FT                   /product="Protein of unknown function DUF1634"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18706"
FT                   /db_xref="GOA:Q2RLI3"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI3"
FT                   /protein_id="ABC18706.1"
FT                   /translation="MAIAGDVEKNKNREYSLDHVVSRVLLAGVLTSVVLMLLGMGLLAL
FT                   NPGLAQANVLPVSQVLKLIPHFHPMALIDLGLLVLLLTPLARVIITGLGFALEGDWLFA
FT                   AIALLVLVVLVISLAVGSA"
FT   sig_peptide     376860..377018
FT                   /locus_tag="Moth_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.912 at
FT                   residue 53"
FT   gene            377277..377352
FT                   /locus_tag="Moth_R0019"
FT                   /note="tRNA-Ala2"
FT   tRNA            377277..377352
FT                   /locus_tag="Moth_R0019"
FT                   /product="tRNA-Ala"
FT   gene            377364..377438
FT                   /locus_tag="Moth_R0020"
FT                   /note="tRNA-Val1"
FT   tRNA            377364..377438
FT                   /locus_tag="Moth_R0020"
FT                   /product="tRNA-Val"
FT   gene            complement(378093..378464)
FT                   /locus_tag="Moth_0373"
FT   CDS_pept        complement(378093..378464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0373"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18707"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI2"
FT                   /protein_id="ABC18707.1"
FT                   /translation="MAKVQNREEICPVTAVQRLIAGKWKIVILWHLSHKTRRFNELQKL
FT                   LPEVSRGVLTQQLRDLERDGLVHREVYKEVPPKVEYSLTEIGQSFIPVLDVIAKWGKYY
FT                   INNTRLSPGPDLARTGSAD"
FT   gene            378601..379167
FT                   /locus_tag="Moth_0374"
FT   CDS_pept        378601..379167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0374"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18708"
FT                   /db_xref="GOA:Q2RLI1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI1"
FT                   /protein_id="ABC18708.1"
FT                   /translation="MICCMKKMVAFIGSPRKEGNTSTIVREIARGAKEAGAEVKIYNLN
FT                   EMTLKPCQSCFYCRQAENCATKDDMQSVYADIKNADAIVIGSPIYMSQVTAQTKLLIDR
FT                   LFPLIDANFKPRFGVKKTVVVYSQGQDEAGAFQRYFEYNANVLKMLGLDIVDTIICSGA
FT                   NDPQTAVKNEGLMAKAFKTGRELVE"
FT   gene            379800..380564
FT                   /locus_tag="Moth_0375"
FT   CDS_pept        379800..380564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0375"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18709"
FT                   /db_xref="GOA:Q2RLI0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLI0"
FT                   /protein_id="ABC18709.1"
FT                   /translation="MAKEKYILQSVDNALRILEAFSANEPELGISELSRKLGLSKSAVF
FT                   RLVLTLQSRGFLSQDPVTGKYLLGLKTLYLGGLVLKQMDLVKIARTHLEELVKKSAEVA
FT                   HLVVLEQGEAVFIGKVESQRPMMMGSYVGARMPAYCTATGKVLLAHLPSEELENYLRNT
FT                   TFTRFTSNTITNPEKLREHLISIRTQGYAVDKEESEEGLFCIAAPVKDNGGKVLAAISI
FT                   SGPAGRLEKRWEEFRELVISAAENISRSLGWN"
FT   gene            380851..381399
FT                   /locus_tag="Moth_0376"
FT   CDS_pept        380851..381399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0376"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18710"
FT                   /db_xref="GOA:Q2RLH9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH9"
FT                   /protein_id="ABC18710.1"
FT                   /translation="MLQLKLYGLGGQGVVTAAKVLASAIAIQEGRYAQAVPAYGHERRG
FT                   APVYADLIVDDEPILVKSFVYQPDYVLIFDLAVIEKGVNVTEGAHKNTCFVANSDKAPI
FT                   EYPFSQGFGPVYYADATKIALEVLNIEIPNSAMLGAFAATGVVKIDSVCAALQEFFQGK
FT                   AGDKNVEAARRCYTSIQRL"
FT   gene            381404..381673
FT                   /locus_tag="Moth_0377"
FT   CDS_pept        381404..381673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0377"
FT                   /product="2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18711"
FT                   /db_xref="GOA:Q2RLH8"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH8"
FT                   /protein_id="ABC18711.1"
FT                   /translation="MKYLYGPVAIAFASTKTGSWRIMRPEVDHDQCTRCGTCAKYCPLD
FT                   IIDVDKESKVQSVTMNLDYCKGCGICANVCPRKCIKMVSERGER"
FT   gene            381674..382891
FT                   /locus_tag="Moth_0378"
FT   CDS_pept        381674..382891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0378"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18712"
FT                   /db_xref="GOA:Q2RLH7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH7"
FT                   /protein_id="ABC18712.1"
FT                   /translation="MATRKLLDGNGAAAEAMRMARVQVISAYPITPQSPIAEKLAEYVA
FT                   NGTLKAKYVRVESEHTAMSVAIGAQLTGVRACTATSSVGLALMHEMLGVASGCRVPIVM
FT                   AVINRSLVSPWSLWCDHQDSMAERDSGWIQLYVENPQEVLDTMFMAYRLAEDPRVLLPV
FT                   MVCLDGFFLSHTPAALIVPDQETVDSFLPPYRPSNLYLDPDDPMFINDLTPSSDFTEMR
FT                   YQQKQAFDQVLQVLPEIQDEFARVFGRQYSMVEAYRCEDAEVVLVTLGSMSGTAKYVVN
FT                   ELRKKGQKVGVLKIICFRPFPAKLIREALKHVPVVGVMDRSAGLGAEGGPVWTEISAAL
FT                   GCLRQGPQVISFIGGLGGRDLAPHIMEKAFEELLAIKRGIKTYQGSCWIDVRDDALRLR
FT                   EVSQGV"
FT   gene            382893..383759
FT                   /locus_tag="Moth_0379"
FT   CDS_pept        382893..383759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0379"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18713"
FT                   /db_xref="GOA:Q2RLH6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH6"
FT                   /protein_id="ABC18713.1"
FT                   /translation="MRTEAKGLVAHGVSTCHGCGMELAVRNILDVLGPRTIIVIPPGCA
FT                   ALFSGFGSETALKIAGIQGNLENSAAIAAGIRAGLEMQGKDDVTVLALAGDGATVDIGI
FT                   QSLSGAMERGDRILYVCYDNEAYMNTGIQASGSTPMQAWTTTTPAKKHVYRKDMLQIAR
FT                   AHRIPYVASASIGYIEDLRKKIARARDAGGPAYVHLQTPCPTGWGYDPARTIEVARLAV
FT                   QTRCWPLYEIIEGRINITVKVNKPRPVEDYLVLQRRFRGIGAEEVERIQRVVDEEYTEL
FT                   LERVEEE"
FT   gene            383756..385879
FT                   /locus_tag="Moth_0380"
FT   CDS_pept        383756..385879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0380"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18714"
FT                   /db_xref="GOA:Q2RLH5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH5"
FT                   /protein_id="ABC18714.1"
FT                   /translation="MNAESLQPIFYPRSVAIVGASNNPDKASHQFLKTLIEERFTGDIF
FT                   PVNPRETKVLGLDCYPSLKDVSGYVELVVIAIPAPGVPEVMRQAAERGDVKGAIIVSAG
FT                   FAETAIPERVKLEKEVVAIARSAGIRVIGPNCNGVINTENRLSTSFAPGLQMIPGNIGF
FT                   FTQSGATGGSILMLTAAQPKPLGFSKWAHVGNMCDVTNLEILEYYASDPSVKVIAGYME
FT                   GVRDGRELMRLAEKITRKKPLLVLKVGRTEVGSRATLSHTGTLAGSDKIYDAAFTQSGI
FT                   VRVDKLEELVDSAKVLVMAPPPRGNRVCILTEAGGLGIIAMDEVGSDPAVRLASLTPET
FT                   QKALAEVLPPMAMICKPNGYIDMTAAAMEREHAEALRLVLEDPNVDAVLLIGLPPTFLP
FT                   AERVAQAIAAVAKKYDKPVLVCFMTGKAMEDGRRYLEERGIPTFDTPDRAARALINLIK
FT                   AGNRLNTGNSNLSAVEKQGYTPHPLVTQASREGRNLLEPEAIEVLRDYGIKMQPGRITH
FT                   SREEAVRCAQEIGYPVVLKIVSPQIVHKSDYGGVKLNLQTAEEVGRAYEELIASVQAKA
FT                   PTAEIKGVLVTPFVSGGTEVIIGVLRDNQFGPVVMFGLGGIFVEVFKDVSFRVAPFSRE
FT                   EALSMIAETKAYTLLKGIRGGQPKDITALADLLVKIGELAISNPQVKEMDLNPVAVLEE
FT                   GFAVLDVRMIIKG"
FT   gene            385892..387322
FT                   /locus_tag="Moth_0381"
FT   CDS_pept        385892..387322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0381"
FT                   /product="Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18715"
FT                   /db_xref="GOA:Q2RLH4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH4"
FT                   /protein_id="ABC18715.1"
FT                   /translation="MPYADLRQFLERLEAEGQLVRVKEPVQAEPDLSSIGRAAANLEQA
FT                   PAVLVENIKGYYQKVALNVHGSWANHALMFELPKDMPVKEQFMEISRRWDNFPVPVRRV
FT                   SSSPVKEIKHHEQINLFELMPLFRVNKFDGGFYLSKAAVVSRDPEDQDNFHKQNVGIYR
FT                   IQVKGKDLLGIQVLPFHDIAIHLRKAEERNQPLPVAIAVGNDPVLTFVASTPMAYEESE
FT                   YEMAGALRGEPFEVIKAETSNLDVPAGAELILEGEILPRRRSPEGPFGEFPGSYSGVRM
FT                   QAEVKIHTVTHRVDPIFENLYLGVPWTEIDYLQALNTSIPLYKQIKASMPEVVAVNAMY
FT                   THGIGVIISTNCRFGGYGKAVAMRLLSTPHGMPYSKIIIVVDDFVDPFNLEQVMWALTT
FT                   KVRPDKDVILIHNAPGMPLDPSSDPPGMHTKLIIDATTPVPPDVVSREVELVDTPAKTA
FT                   LWEKILKELHRNKKGGSM"
FT   gene            387322..387549
FT                   /locus_tag="Moth_0382"
FT   CDS_pept        387322..387549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0382"
FT                   /product="vanillic acid non-oxidative decarboxylation
FT                   gene-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18716"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH3"
FT                   /protein_id="ABC18716.1"
FT                   /translation="MICPRCDQDTAEKLVDSPRGQEWSVYLCHTCYFSWRSTEDESITD
FT                   PRFYSTKFKLSPDSFEKMLCIPPVPPLKST"
FT   gene            387720..389132
FT                   /locus_tag="Moth_0383"
FT   CDS_pept        387720..389132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0383"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18717"
FT                   /db_xref="GOA:Q2RLH2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH2"
FT                   /protein_id="ABC18717.1"
FT                   /translation="MDAKNTAAGSYGKVLAGLLAIIVYIILTNLPTPANLPPQGQKALA
FT                   FMVAVVIVWVFEVIPIGISAALFLMIMDILKVFPMKDAMANFATTTLFFILSAFIIAIT
FT                   FINTGLGNRVSLMVSAIFGQKTDRVLLSFMLPTAIISSVLADIPTAVIFSSIAYPLLQK
FT                   NGCLPGKSNFGKALMLGIPIAAAIGGIATPAGSGLNIMSISLLKNTAGVEINFLQWALI
FT                   GFPMAILLTLAAWYIVLKFYPPEFDHVRGLEDIAKARQDLGPLTVNEKKFIAIFSVTLV
FT                   LWFTQPWNHIDPSVVAIITASSFFLPGVKLATWDDVKGKLSWDVLLLLGTANSLAMAIW
FT                   QLKGAAWLANTVLGGLAGVGLLIVLFAVTAFGIFSHLIIPVGGAVVAVAIPVLAVLAKN
FT                   TGINPALLVIPIAYTASCVFLLPLDPIPLTTYHYKYWKFWDMMKPGFLISLVWLVLMVI
FT                   FMYIGQGVGIIR"
FT   gene            389553..391151
FT                   /locus_tag="Moth_0384"
FT   CDS_pept        389553..391151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0384"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18718"
FT                   /db_xref="GOA:Q2RLH1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH1"
FT                   /protein_id="ABC18718.1"
FT                   /translation="MPLFPYLLVISLCIIVVTVTLGSGTLVMVLVGILLSSTGAFLLWQ
FT                   RWIHPLLLLQRFLSLLEKGDPVAAEKFLKAQKWSRGFHEIAGRVLEAFFRMIGNMQRSS
FT                   DELNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDI
FT                   AHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEF
FT                   VRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAET
FT                   IQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAE
FT                   RAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESVVKLSDMAGRFDELAN
FT                   QYTKEGWDEATKNSLIQNGMQILKSLAENSEIKSMQIEKLRKPFDEAVAGLDFIKYPMV
FT                   VGLDGNIIYSPLKFNQSINWSFRPWFQAAIKGESYIGKPYITQATNRLAVPISCPIKNE
FT                   KGEVLGVLAANIAED"
FT   sig_peptide     389553..389663
FT                   /locus_tag="Moth_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.866) with cleavage site probability 0.595 at
FT                   residue 37"
FT   gene            391306..392103
FT                   /locus_tag="Moth_0385"
FT   CDS_pept        391306..392103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0385"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18719"
FT                   /db_xref="GOA:Q2RLH0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLH0"
FT                   /protein_id="ABC18719.1"
FT                   /translation="MLIIGEKLNSAIPSVRQIINDKNAAAVQDLARRQAEAGADYLDLN
FT                   TAHCDEVADMEWLVRTVQEVTDVPLCIDSTAGEAIKKGLETVKGDKSKVIINSISMEKK
FT                   RLEEVLPLVLEYQCPVIGLTVDDNGIPKTAEERIKITEGLIETLSRKNYDLSNLYIDPL
FT                   VLPLAVNHTNAVMFFQCLRDIKRLFKVKTVSGLSNISFNMPKRKLINRYFLTICMASGM
FT                   DAAILDPLDGKIMTAVTTTDLLLGNDRFGKNFLKAYRKDLLAD"
FT   gene            392221..393390
FT                   /locus_tag="Moth_0386"
FT   CDS_pept        392221..393390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18720"
FT                   /db_xref="GOA:Q2RLG9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG9"
FT                   /protein_id="ABC18720.1"
FT                   /translation="MSKEKLYQERLQRYITAMECGKPDKVPIAFSVGEWAVKYTGSTLE
FT                   EVYYNLDKSIEITCEVVQDLDFDIFGGGPTLWWPPMFDAMGSKLYKFPGIHLEENSQFQ
FT                   YMEEEYMKPEDYDDFIANPTEWLATKYLPRISEEFARPGSYRATVALIKSAAAYAIASN
FT                   VMAKGWEKWTKEHGVVPSTSGFTKAPFDTLGDTLRGMKGILLDIRRRPEKVLAACEAII
FT                   PHNIAYAMIGARGDTTLPCKATLHRGAYPFLSMEHWEKFYWPSLKAVIEGLWAQGKRMY
FT                   FFAEGNWTPYLEKIAELPDKSIVFIIDTTDAKKAKEILGGKFCLWGGVPTTLLTYGTPA
FT                   QVKDCVKQAIDELACDGGFVLAPGGAVMSDAKRENIFAMIEAGREYGVY"
FT   gene            393628..394251
FT                   /locus_tag="Moth_0387"
FT   CDS_pept        393628..394251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0387"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18721"
FT                   /db_xref="GOA:Q2RLG8"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG8"
FT                   /protein_id="ABC18721.1"
FT                   /translation="MLTDTLSKAMAELEEEQVLAQVKERLGGGVAPLEIVKTLQEGMVE
FT                   VGNRFQSGEYFLSELIMAGEIMKGAMDILEPHLGGESGEHKGTIVIGTVKGDIHDLGKN
FT                   IVIMLLKGAGYKVVDLGVDVPKERFVEALQETKAPLVGMSVLLTSCQEAMKETIEAIRG
FT                   AGLDTRVVIGGNYIDETVKNYVGADYYATTATDGVKVAAEVFGA"
FT   gene            394988..396106
FT                   /locus_tag="Moth_0388"
FT   CDS_pept        394988..396106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0388"
FT                   /product="putative anti-sigma regulatory factor
FT                   (serine/threonine protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18722"
FT                   /db_xref="GOA:Q2RLG7"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG7"
FT                   /protein_id="ABC18722.1"
FT                   /translation="MQQCRQCNQKTPERSCPDCDYFMTPGSLRRKPPSPIGINLVAADG
FT                   RRYDGRILVLNMMELGLETDAPVPGKYRIHLHQNLSLDVAGVPTRGKGNIRLFDILTVY
FT                   RDQETATRLSSDEYALLTGSTGDFIEQVSQLVPVHLQKLVKERLLAEIQNSEILKAMQI
FT                   GSVLRYERGRFRHLGGQADLELPPEEIEKLIHKAIRQGTHCRELIVSSDGKRVFDLHGI
FT                   PLDPYSGGLLAFDITEIIHKERQMRRQEMLAYQEAIAAVTNGRLRLSTRAEIASLLSQG
FT                   HELAKGEVQKAADVALARSKLRSILPEVFRGRQHGICLGLTEALTNALKHAGGGEWVAR
FT                   QDDEVLRVIVQDHGQGIKLKDLPKATPLKPRN"
FT   gene            396158..396499
FT                   /locus_tag="Moth_0389"
FT   CDS_pept        396158..396499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0389"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18723"
FT                   /db_xref="GOA:Q2RLG6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG6"
FT                   /protein_id="ABC18723.1"
FT                   /translation="MERRKFTLEFKRQVVEQAIAAGNNSVVARKYDIRPNIVSRWVRQY
FT                   KAGQPMQGSSPKGNATHVTQQEHARLVAENRELDKQNTHLKQLLGEKDLEIAILRDLLK
FT                   KANPHLQIK"
FT   gene            396544..397428
FT                   /locus_tag="Moth_0390"
FT   CDS_pept        396544..397428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0390"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18724"
FT                   /db_xref="GOA:Q2RLG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG5"
FT                   /protein_id="ABC18724.1"
FT                   /translation="MLRIVGVSRSTYYYQLTHEPKPHTTTGGRPFPGHSLTVGGRKVSD
FT                   EQIKEWIMESISGDGYAYGYRKLTHMLRQDHELVVNEKKVYRLCKELDILRPQRNLRRK
FT                   HPRNLAQNRTITAPNQLWEVDVKYGYIAGEDRFFFVLSYIDVYDRQIVGYHIGLTCEAR
FT                   HAVETFRAALWKRQILQRNLPLPIIRSDNGPQFVSHLFESECERWNVLHERIPPKTPNM
FT                   NAYIESYHRLLEDECLSMGEFGTYAEAYQAVVEFVSRYNNRRLHSSLHYLSPAKFYRRH
FT                   IETGLQPRYPVRV"
FT   gene            397714..398043
FT                   /locus_tag="Moth_0391"
FT   CDS_pept        397714..398043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0391"
FT                   /product="anti-sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18725"
FT                   /db_xref="GOA:Q2RLG4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG4"
FT                   /protein_id="ABC18725.1"
FT                   /translation="MLTIEVTRVNDSRCLNLKGELDMETLPMLERMAEAREGEGRLIIN
FT                   LSGVSFIDSTGLRGLLTIQQEWAAKGGRVHFLNPCPEVAEVFRLVGLEELLQGTSGEMV
FT                   EAGEN"
FT   gene            398044..398745
FT                   /locus_tag="Moth_0392"
FT   CDS_pept        398044..398745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0392"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18726"
FT                   /db_xref="GOA:Q2RLG3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG3"
FT                   /protein_id="ABC18726.1"
FT                   /translation="MALDAGRIEKQIIHAGIQGAGCSIPAEVEGGDFFDFIPLGKERLI
FT                   AAIGDVMGKGSRAARHMKDLRAIVHACAGNNMPLLTMMEQINERGGKQLRLARSFATLC
FT                   LISYEMYNARLTSLSAGHPAPLAFSGNKLRILKVKGVALGLLEGYQGTEPDTVSLAPGD
FT                   VVLLYTDGLVEARNGQGQTYGLKRLENITLANSCQNAIQLRDTILNDLFTFTGRKQQRD
FT                   DVTLVILKRGR"
FT   gene            398752..399081
FT                   /locus_tag="Moth_0393"
FT   CDS_pept        398752..399081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0393"
FT                   /product="anti-sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18727"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG2"
FT                   /protein_id="ABC18727.1"
FT                   /translation="MSGLEVSVHREKDRSVLRVAGELDFSNINQLQQEIERQDTKIVEI
FT                   DCSALQFMDSSGAGLLLSIARVLNLQNRILEITHIPEHIYHDLDIIGVFRVLESFKASR
FT                   PTGGN"
FT   gene            399290..400921
FT                   /locus_tag="Moth_0394"
FT   CDS_pept        399290..400921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0394"
FT                   /product="Protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18728"
FT                   /db_xref="GOA:Q2RLG1"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG1"
FT                   /protein_id="ABC18728.1"
FT                   /translation="MPVTSKDKIEILPVDEKQEGYWRIKISGDKLAALLQMRPGIILHR
FT                   CLKDLPPAKVLQLEVLEQESHYPPFTLEDLVRELKSQGIQYGIDWQTCARLVEEPAEGT
FT                   WTIARGQPAFPGKDATVQLLFTTQDRVPVTIKEEDQQVNFRERFQFTSVEPGTVLARKK
FT                   PVTGGRPGRAVTGEIILPPEPREIELVAGQGAILSDNGLEVVATRSGRPMARKTKDRVT
FT                   IEVVPALIHDGNVNLSSGNINFSGDVIVTGQVEEGMAIEAGGNVYVGDTVSRGIIRAGG
FT                   SIEVAGNIFVSVLAAGGITAFQQRLSPLLARIAEELEQLITAIKQLLRHPSFKKDDLKG
FT                   GIGPLVLLLLEKKFQGLSPAIELLQKEVQNLQTISLGEPEGLINDLERLTRSPLAVKNL
FT                   DYLETMLQKVAGWQEGISAPLQGRADVTVNYVVNSTIMASGNIRVLGDGCYHSRLQAGK
FT                   SVTINGVFRGGEIQAQGDVYIRELGSRSGIETRVITRSGARVKAGHVFENTSVQIGPRV
FT                   YSFGREEQGVTLYLDREGELIRSYMN"
FT   misc_feature    complement(400987..401094)
FT                   /note="yybP-ykoY element as predicted by Rfam (RF00080);
FT                   Moth_R0021"
FT   gene            401169..401819
FT                   /locus_tag="Moth_0395"
FT   CDS_pept        401169..401819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0395"
FT                   /product="Protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18729"
FT                   /db_xref="GOA:Q2RLG0"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG0"
FT                   /protein_id="ABC18729.1"
FT                   /translation="MKAFLLSLGLIFIAELGDKTQLVALTLATRFNARVVLAGIFTATL
FT                   LVHVISVALGEFVGVLIPTAWTHFLAGLAFIGFGLWTLRGDSLDDERDNAHRIASPFLL
FT                   VVVTFFLAEFGDKTMLSTVTLATTYSIIPVWLGSTLGMVLSDGLAIWIGQAMGSRLPER
FT                   VIRLGAAFIFFVFGLFSTFQGGLNLSPPVWGLGVAILAILVFIFFRKPVQKGN"
FT   gene            402279..402524
FT                   /locus_tag="Moth_0396"
FT   CDS_pept        402279..402524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18730"
FT                   /db_xref="GOA:Q2RLF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF9"
FT                   /protein_id="ABC18730.1"
FT                   /translation="MKEVISVKVVFLVAMLLATWFLIITGVLYGQISFYKHHKQGLLPR
FT                   GEGERGVHPGSEEVHRPGGCRPDIKGNTSDERWNRG"
FT   sig_peptide     402279..402371
FT                   /locus_tag="Moth_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.960 at
FT                   residue 31"
FT   gene            402921..404174
FT                   /locus_tag="Moth_0397"
FT   CDS_pept        402921..404174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0397"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18731"
FT                   /db_xref="GOA:Q2RLF8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF8"
FT                   /protein_id="ABC18731.1"
FT                   /translation="MAKLLEYQGKEWLRKAGIPVPAGRAASTPEEARQIAAELGKPVAV
FT                   KAQVQAGGRGKSGAVKLVNTPEEARAAAASILGTQIKGYPVRQVLVEEKLDIAHEYYVT
FT                   IIVNSARDARCPMLMFSTEGGMDIESVPEEKIFKLHISPLFGLEVYDAVDLLVKAGIPN
FT                   DQLMNFANFLVKFWGAYKKYDCFTLETNPLVMTASGDLVAADCKMDVDNSSVYRHPEMG
FT                   IEIARDLGHEPTELDVIGWGIEKTDLRGSGFVMSMGFDEKSPGYIGYHPIGGGSAMMGM
FT                   DALNNVNLKPANYADTSGNPVASKIYRVAKVILSQPNIDGYLLGGFMMANQEQWHHAHA
FT                   VVKVLREILPKKPGLPCVLLLCGNKEEESLAILREGLKDVEGATRVEIYGREHVTDTDF
FT                   IGQRLLALVKEYQEEKRK"
FT   gene            404184..404474
FT                   /locus_tag="Moth_0398"
FT   CDS_pept        404184..404474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18732"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF7"
FT                   /protein_id="ABC18732.1"
FT                   /translation="MLEFLEKSIKVTIDTSKCSECETKACIAACKKFARGMLQLKDGVP
FT                   SVAYLSADEVKRRGTECLACEYECWFRGKSAIKIDVPIEGLDEYLRKRGLS"
FT   gene            404513..405409
FT                   /locus_tag="Moth_0399"
FT   CDS_pept        404513..405409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0399"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18733"
FT                   /db_xref="GOA:Q2RLF6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF6"
FT                   /protein_id="ABC18733.1"
FT                   /translation="MGILIDRNTTVVVQGITGREGSLRAAYMKEYGTKVVAGTSPGKGG
FT                   QTVAGIPVYHTVKEAVAEHGPIDFSVIFVPGRALKVAVKEAADAGIKNIVPCVESVPIH
FT                   DIMEMVAYCKMKGTRLIGPGSIGIITPGEAVVGWLGGNVEWANTFFKPGPIGVFSRSGG
FT                   QSGTIPWVLKEGGFGVSTVVHTGTEPVLGTSMADLLPLFEADPQTKGVAVFSEIGGSQE
FT                   EECAEVIASGKFTKPFVIYVAGAWAPEGQRFSHASSIVERGRGSAKSKMEAIRKAGGYV
FT                   AMSPTDIPRILREVIKD"
FT   gene            405422..406318
FT                   /locus_tag="Moth_0400"
FT   CDS_pept        405422..406318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0400"
FT                   /product="Citrate lyase"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18734"
FT                   /db_xref="GOA:Q2RLF5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF5"
FT                   /protein_id="ABC18734.1"
FT                   /translation="MAVMRSILYVPGNNPKMVAKAPTFPADIITLDLEDSVPPAEKENA
FT                   RKLIRENIKAVGANGSEVYVRINNWETEMTNDDLEAVVVEGLAGVTLAKCGHPDNVKRL
FT                   DWKLEELERRRGLPVGSIKVSLLIETAKGVINAYESCIASPRVVSAIFGAVDYCKDMRV
FT                   KLTSEATEQFYARAHVAVAARAAGIVAIDAPYVAYQDLEGFEKNIREGRQLGYEGRMII
FT                   HPSQIEICNRLYAPDPADVEWARGVVKVFEEEGIAKGKAAVSYNGKMVDTPVYLNAKDI
FT                   LAAQAEIDAKNAAMKKA"
FT   gene            406413..407636
FT                   /locus_tag="Moth_0401"
FT   CDS_pept        406413..407636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0401"
FT                   /product="Malate dehydrogenase (oxaloacetate
FT                   decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18735"
FT                   /db_xref="GOA:Q2RLF4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF4"
FT                   /protein_id="ABC18735.1"
FT                   /translation="MSIQERALNLHREWQGKIETRPRVQVRNADDLTMAYTPGVAEPCK
FT                   EIHKDPNLVDVYTRRWNLVAVVSDGSAVLGLGNIGARAAMPVMEGKSVLFKSFAGVDAF
FT                   PICIDSQDVDEIVRTVQLLTPTFGGVNLEDIAAPRCFEIERRLKETTDIPIFHDDQHGT
FT                   AVVVLSAIINACKITKRELSDLKVVINGAGAAGIACGKLLVDVGVSDVILCDSKGIICS
FT                   KRDDLNAIKKEMLQITNKEDRCGTLADAMEGANCFIGLSVKDAVTPEMVRSMDKDSILF
FT                   AMANPVPEILPDVARAAGAAVVGTGRSDFPNQVNNVLGFPGIFRGALDVKASDINDAMK
FT                   IAAAHALADLVGDRLSADFVMPEAFDPRVAPAVAMAVARAAIESGVARDPKDPEWVKRH
FT                   TEELIARQ"
FT   gene            complement(407808..408212)
FT                   /locus_tag="Moth_0402"
FT   CDS_pept        complement(407808..408212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0402"
FT                   /product="Phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18736"
FT                   /db_xref="GOA:Q2RLF3"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF3"
FT                   /protein_id="ABC18736.1"
FT                   /translation="MDALEAIKEKFARDTFPRSLGIELLELAPGYARVALKLGENMVNF
FT                   HGIVHGGAIFTLADTALGLASNSHGDAAVALTVTINYLAPARPGDSLVATAEEEHLTRR
FT                   TGVYRIRVTTGSGENIALARGTVYRKQVIK"
FT   gene            complement(408251..408493)
FT                   /locus_tag="Moth_0403"
FT   CDS_pept        complement(408251..408493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF2"
FT                   /protein_id="ABC18737.1"
FT                   /translation="MPDISLRMGNAITHKDLARVKDTLPRLNPGDHLTITMEAADAHQA
FT                   DMLLEILKDHGLDFQSRGDSDGRTYFIIACRPEGT"
FT   gene            complement(408558..409703)
FT                   /locus_tag="Moth_0404"
FT   CDS_pept        complement(408558..409703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0404"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18738"
FT                   /db_xref="GOA:Q2RLF1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF1"
FT                   /protein_id="ABC18738.1"
FT                   /translation="MRRIVIAPDSFKESLSAPEVAAAIAQGIHRVLPEVETVNVPMADG
FT                   GEGLTATLVAATGGREMTATVTGPLGEPVQASWGILGDGITAVVEMAQASGLPLVPREK
FT                   RNPLVTTTYGTGELIHQALEAGCRRLIVGIGGSATNDGGAGMARALGVKLLDAEGADIP
FT                   PGAGGLERLERIDIQGLDPRVKEVEILVACDVDNPLCGPRGASAVYGPQKGATPEMIPR
FT                   LDAALARLADIVARDLKVDVRELPGAGAAGGLGAGLVAFLGATLRRGIELVIEAVNLDG
FT                   ILAAGADLVITGEGEINRQTAYGKVPAGVAGVAAKYGIPVVALVGSIGEGASAVYDHGI
FT                   QGFMSIVPRPVPLSYCLENAASLLADAAERLMRLLSINIKK"
FT   misc_feature    409831..409997
FT                   /note="ykoK element as predicted by Rfam (RF00380);
FT                   Moth_R0022"
FT   gene            410067..411788
FT                   /locus_tag="Moth_0405"
FT   CDS_pept        410067..411788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0405"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18739"
FT                   /db_xref="GOA:Q2RLF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLF0"
FT                   /protein_id="ABC18739.1"
FT                   /translation="MNRVTNLALTMIMAALLISFAYFAYQGHRVLTLAGGTEVVTSISV
FT                   LPYYAFRSFLRMLGAYLLSLIFTLTYGYKAGTDTRAERWLIPILDILQSVPILGFFPAA
FT                   VYFFVSLFQGRLLGVELASIFLIFTSQAWNMTFGFYESLTTIPRDLLEATVAYRVTGWR
FT                   RFRTLYLPAGIPKLVYNSIMSWAGGWYFLIAAEIIAIGPVEYSLPGLGSYLIRTTERGE
FT                   LGLTMVGLLTLVALITMMNIFIWRPLSTWAENFKYEFGSGGSNRLPSGLGYRLWWQAPG
FT                   FREIRIGVIKGGAFLGRAVGNLGARLAPGPEKWQRWCRYLARVERLVAWGLALLLVYAL
FT                   VRGLLALGTLFLEPWQPQVFSIPAALLFSFFRLMAAYLLSLAWTLPVAIWIGHNERVYE
FT                   FLTPVFEILASVPATALFPIIVFVLIGLTGGMNLAAILLVLTGMQWYLLFNLIAGVKSI
FT                   PGDLKEAAAAFGLRGWGYLRRVVLPAMVPSLITGSITAWGGGWNALIVAEYVVYAGHTY
FT                   TAFGIGSLLDMATYGSGSFQVIWSSLIAMMVTIVLMNRFFWRRLYEMAARRFKIEP"
FT   sig_peptide     410067..410132
FT                   /locus_tag="Moth_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.822) with cleavage site probability 0.756 at
FT                   residue 22"
FT   gene            411805..412554
FT                   /locus_tag="Moth_0406"
FT   CDS_pept        411805..412554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0406"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18740"
FT                   /db_xref="GOA:Q2RLE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE9"
FT                   /protein_id="ABC18740.1"
FT                   /translation="MALLEVNHVYKTYTDANRSLTVLDDISFSIAKGEFVCLVGPSGSG
FT                   KSTLLRMVVGLIQPSRGEIFYRGQQVRGVMDKMAIVFQSFALMPWLTVMGNVALGLEAK
FT                   GISRPEREALASKYIDKVGLDGFEEAYPRELSGGMKQRVGIARALTMEPELLCMDEPFS
FT                   ALDAFTAQNLREEVLDLWLDVTLPVKSVLMVTHGIEEAVFMADRIIVLSRRPARVLADV
FT                   RVDLPRPRNMKDEAFARVTDKIYSLLF"
FT   gene            complement(412557..412925)
FT                   /locus_tag="Moth_0407"
FT   CDS_pept        complement(412557..412925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0407"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18741"
FT                   /db_xref="GOA:Q2RLE8"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE8"
FT                   /protein_id="ABC18741.1"
FT                   /translation="MGQDKIILAGLEFYGFHGNHPAEQQLGQPFIVDLELYLDLEPAGR
FT                   TDALEATVNYGQVYRLVQEIVTGRPYKLLEALAAAISDGILAGFPVDEVLVRVKKPRAP
FT                   LPGSFDYAAVEIRRRRKE"
FT   gene            complement(412946..413503)
FT                   /locus_tag="Moth_0408"
FT   CDS_pept        complement(412946..413503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0408"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18742"
FT                   /db_xref="GOA:Q2RLE7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE7"
FT                   /protein_id="ABC18742.1"
FT                   /translation="MDKEKIRQAVRMIIEAVGEDPDREGLRETPRRIADMYEEIFAGIN
FT                   RDPGEELTVVFDEHHEEMVLVKDIPLYSICEHHFLPFLGRAHVAYIPRGKITGLSKLAR
FT                   VVDIAARRPQVQERLTSQIADIIMEKLNPYGVVVVIEAEHLCMSMRGIKKPGSLTITSA
FT                   VRGLFRRDQAARAEAMSLIQGR"
FT   gene            complement(413769..414779)
FT                   /locus_tag="Moth_0409"
FT   CDS_pept        complement(413769..414779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18743"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE6"
FT                   /protein_id="ABC18743.1"
FT                   /translation="MPENAGQLRPPYHPHDKGYRQLLSDKRVFLELLKTFVRETWVEAI
FT                   DEKDLILVNKSYVLQDFSEKEADIVYRLKTKDRNVIFYVLLELQSTVDYLIPFRLLLYM
FT                   VEIWREIYTNTPQHERESKHFRLPPIIPAVLYNGAGSWTAALSFKEMLDSYQDFSGHLL
FT                   DFHYLLFDVNRYSEEELIRAANLIAGVFLLDQKMRPEELVGRLQKLAGVLRRLTPDEFR
FT                   HITSWLKNVVKPRMPEDFRKKVDRILDASNPWEVERMIYNLELTLEEMQQQALLKGLKE
FT                   GEQKGKLEGKLEGKLEGKREVARNLLLLNVDIETIVKATGLTPDEIAVLKKQLEQ"
FT   gene            414895..415032
FT                   /pseudo
FT                   /locus_tag="Moth_0410"
FT   gene            415029..415574
FT                   /pseudo
FT                   /locus_tag="Moth_0411"
FT   gene            415717..415926
FT                   /locus_tag="Moth_0412"
FT   CDS_pept        415717..415926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0412"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18744"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE5"
FT                   /protein_id="ABC18744.1"
FT                   /translation="MDKEIIFLVEEAPEGGYTARALGHSIFTEGEALDEIRSNVRDAVR
FT                   CYFGDKDMPRVIRLHIVKDEVIAV"
FT   gene            416174..416467
FT                   /pseudo
FT                   /locus_tag="Moth_0413"
FT   gene            416546..416992
FT                   /locus_tag="Moth_0414"
FT   CDS_pept        416546..416992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0414"
FT                   /product="sulfonate/nitrate transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18745"
FT                   /db_xref="GOA:Q2RLE4"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE4"
FT                   /protein_id="ABC18745.1"
FT                   /translation="MVVGLLEMLEDARGREDIFKLAGSLSMELDDIGPVIEAARVLGFI
FT                   ETTNGDITLTRLGSKLLNADINERKDIIAARLQELPAFKEVLQLIKSGRGRQVRREQVV
FT                   RRFARRMSDEDAEVLFKTVVDWGRFAEIIGYDTKGEVLYLDEGA"
FT   gene            417084..417159
FT                   /locus_tag="Moth_R0023"
FT                   /note="tRNA-Ala3"
FT   tRNA            417084..417159
FT                   /locus_tag="Moth_R0023"
FT                   /product="tRNA-Ala"
FT   gene            417236..417532
FT                   /locus_tag="Moth_0415"
FT   CDS_pept        417236..417532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18746"
FT                   /db_xref="GOA:Q2RLE3"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE3"
FT                   /protein_id="ABC18746.1"
FT                   /translation="MFTRNLQRWQLRAAGFFCVTAAEEEEVEPLCLPVSLVLSFATHPP
FT                   GDLDNYIKSLADSLNGIAWLDDRQVARMEVEKVVVVEGDERAEVEVAPWKARF"
FT   gene            417846..418229
FT                   /locus_tag="Moth_0416"
FT   CDS_pept        417846..418229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18747"
FT                   /db_xref="InterPro:IPR024700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE2"
FT                   /protein_id="ABC18747.1"
FT                   /translation="MGTRTDELAAYYAKKYPLTFTDDFSKTDPSLTERYKEAWQVATRA
FT                   AAILKERYGAQKVVAFGSLVDRSRFTRWSDVDLAAWGIPYDRFYAAVGAVTGLSEKFKV
FT                   DLVDPEDCRESLHRAIESEGVEL"
FT   gene            complement(418409..419215)
FT                   /locus_tag="Moth_0417"
FT   CDS_pept        complement(418409..419215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0417"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18748"
FT                   /db_xref="GOA:Q2RLE1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLE1"
FT                   /protein_id="ABC18748.1"
FT                   /translation="MSQVEGHVQSLEKALKILEALAAAGEGIGLSELSRRLNLNKSTVY
FT                   RMLSTLKAYGYVDQEETTEKYVLGLKILDLSGSLLERLDVRAVAHPYLKELADATQEVA
FT                   HMVIRDGAEAVYIDKVEGNRTIRMHSQIGRRVALHSTAVGKAILAFLPEQEVVKIATDR
FT                   GLPRFTPRTITTMASLQAELARVREQGYSVDDGENEEGIRCVGAPIFDHSGQVVAALSV
FT                   SGLTISVTPERVPELGKMVGHAGQEISRQLGFKPATAERSFPSRLL"
FT   gene            complement(419449..421497)
FT                   /locus_tag="Moth_0418"
FT   CDS_pept        complement(419449..421497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0418"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18749"
FT                   /db_xref="GOA:Q2RLE0"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLE0"
FT                   /protein_id="ABC18749.1"
FT                   /translation="MELFPIIPAGGILALLVALYMTSSVLKEDTGPKEMQTIAAAIREG
FT                   AMAFLNRQYRTIAGLALIVAVLLALLTRQYHTAVAFITGAFASALSGYIGMYVAVNANL
FT                   RVAAGARNSLNKALTVAFRGGAVTGLAVTALSLLGVTSLFYAFGGATNPTRAPLDIVGF
FT                   GFGASFVALFAQLSGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADLVGDNVGDCA
FT                   GRGADLFESTAAENIGAMILGIALVPFFGVKGIVFPLVARAAGIIASIIGMFFVRAEEN
FT                   QDPMAALNRGYIVTSILAIIFLYPISRYMLSGPGVNFIYFYGAGIIGIVLSFIFVLITQ
FT                   YYTSYDYRPVKEIARASITGPATNIISGVAVGFESTALPVVFISLAILGAYWLGLKSGL
FT                   PGGGLYGTAVATMGMLSTAAYILAMDTYGPITDNAGGIVEMSGAPEEVRRRTDRLDASG
FT                   NTTKALTKGYAIGSAALATFLLFSAYIDEVKIALNIKGNFPVDIGKPEVFVGAFIAAMM
FT                   VLLFSSTAIRAVGNAAQYVILEVRRQFKEIPGIMEGTAKPEYGACVDIVTRGALKEMVL
FT                   PGLIVVITPIIVGLVLKAEAAAAFLMVGTITGVIVALFLNNGGGAWDNAKKYIELGNFG
FT                   GKGSEAHKAGVVGDTVGDPFKDTAGPSLHVLVKLISTITLVLAGLFI"
FT   gene            complement(421702..422724)
FT                   /locus_tag="Moth_0419"
FT   CDS_pept        complement(421702..422724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0419"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18750"
FT                   /db_xref="GOA:Q2RLD9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD9"
FT                   /protein_id="ABC18750.1"
FT                   /translation="MAKIITFGEIMLRLSTPEYQRFVQAESFNVTYGGGEANVACSVVN
FT                   YGAEAAFVTKVPANPLGQAAINHLRRYGVDTSHILQGGERLGIYFLETGASQRPSKVVY
FT                   DRKYASIAGVQPGEFDWARIFSGASWFHFTGITPALGENVAAVTLEAARKAKEMGLTVS
FT                   CDLNYRKNLWTPEQARATMTELMTYVDVAIGNEEDAEKVFGIKAAASDVTKGEINEEGY
FT                   RQVARELLNRFNLQKVAITLRESFSAFDNGWSALIYDGQEFYRSRRYQIHIVDRVGGGD
FT                   AFAGGLIYALTEGFAPAEALEFAVAASCLKHTIPGDFNHVTREEVLSLMRGDASGRVQR
FT                   "
FT   gene            complement(422912..423556)
FT                   /locus_tag="Moth_0420"
FT   CDS_pept        complement(422912..423556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0420"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18751"
FT                   /db_xref="GOA:Q2RLD8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD8"
FT                   /protein_id="ABC18751.1"
FT                   /translation="MQKLKVMQRIIDCGIVAVVRAENPEQALKIAEAVKTGGVEAIEIT
FT                   LTIPGALDVIRELATTYREGEILIGAGTVLDATTARMAILAGAEFLVSPCLDVEMVKTC
FT                   NRYQKVCMAGAMSIREIVEVMEAGSDFVKFFPGSAFGPEMVKAIKGPLPQAPIIPTGGV
FT                   SLENVAQWIKAGCEAVGVGGELIKGAKTGNYELVKETARKFVSAIRAARGL"
FT   gene            423987..425219
FT                   /locus_tag="Moth_0421"
FT   CDS_pept        423987..425219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0421"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18752"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD7"
FT                   /protein_id="ABC18752.1"
FT                   /translation="MSNEVGNLQLVKKLNRISILNIIRKHNTISRQQLAKLTGLTPAAI
FT                   TGIVRDLVASGYVIEKGLGKSNGGRRPVKLQFNPDSGYVLGAEITRNSTTLGMVNLDAK
FT                   PLILKQYNIDMTDPQQGLSRLADEVTKMIIESGIESKNILGMGVAYPGLVDISTRVVKR
FT                   SPNLGKKWRDIPIENWLQEMTGIKIFVENNSNAAAMAEYCFGRGKETKNMAYINLGEGI
FT                   SAGIILNGMLAYGFRGYTGEIGHLVIDEDGPLCNCGNNGCLESLCAVPALVRKANNELS
FT                   LYNQKDPLKAIWLEKGEVKIEDIMANANNVGSYAQKLIRQAGWYIGKAIAAIINVFNPE
FT                   AIFIGGILAEAGNSLLDPLIESVQKHAFPELVREVRIELSSMRKDTGFYGACAIAIRAL
FT                   FEGGVDALLGV"
FT   gene            425616..426623
FT                   /locus_tag="Moth_0422"
FT   CDS_pept        425616..426623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0422"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18753"
FT                   /db_xref="GOA:Q2RLD6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD6"
FT                   /protein_id="ABC18753.1"
FT                   /translation="MFKWKKLILPLLLLIAMLIMSACGKSPADKQQDSNTYTLKIHMVI
FT                   NEQDPIYQGYAEFKKGVEARTNGKVKVELYPNGVLGNDEDLLQQAMLGGNVAVNSDAGR
FT                   LGVWVPEMGILLAPYLTDNANEMQKLLKSDLVKKWTDELAQKKGLTVLSFNYYAGARHF
FT                   ITKKPISTPEDLNGLKIRTPGSPVWQETIKAMGATPVALPWTETYPAIEQGVIDGAEAQ
FT                   DSATYGAKIYEVAKYITKTGHIQLWNCLVVGTKWFEQLPKEYQQILIEESIKAGDFTTN
FT                   KVLASEKELEDKMAATGAIIKEVDIKPFKTKSEIVYSKLNYQDLRQEVNKVLGK"
FT   sig_peptide     425616..425690
FT                   /locus_tag="Moth_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.654 at
FT                   residue 25"
FT   gene            426714..427181
FT                   /locus_tag="Moth_0423"
FT   CDS_pept        426714..427181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0423"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18754"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD5"
FT                   /protein_id="ABC18754.1"
FT                   /translation="MQRFARMVDKIESFLSIWLLGIIVLLIFFSSLLRYIGFPINGADT
FT                   IAETLFVWLIYIGADQVLRKDRHLGVDFFTQRLPVRIRNFISIVVLLVMLAFLVLVTYF
FT                   GMSLTLANNGRILGDLPISYSFVAMAIPIGTFLMCLTIIVRILVLIWDLKN"
FT   gene            427207..428487
FT                   /locus_tag="Moth_0424"
FT   CDS_pept        427207..428487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0424"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18755"
FT                   /db_xref="GOA:Q2RLD4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD4"
FT                   /protein_id="ABC18755.1"
FT                   /translation="MLLVVLTFIILLLLNMPIAFTLGISGIIYFLTQVSVPLPVVVQRM
FT                   ITGTQSYPLLAVPFFILAGHIMNASGITSRLMKLADALTGHLVGGMAHVSIVLSMLMGG
FT                   VSGSSNADVAMQTRILLPEMRKRGYDDGFSAAVLACGSLSTAIIPPSIGLVLYGFVGQV
FT                   SIGKLLIAGIIPGILMSLIMMFTAYIYAKKRGYDADGKNKKKSFKELISAVKESFWALL
FT                   FPVFLVMTIRFGIFTATEAAAFAVVYAFLVGKFIYRELDWLKLKEALKNCAEDNAMIML
FT                   IISMAAIISYVLAYEKVPVKMASFIVGISDNPFIVMGTIIAFLLVAGMLMEGTVNILLL
FT                   TPIFLPIVTKLGFDPVHFGIIMAIMIQIGGITPPVGVNMYTVCSLGNIPIEDFVKESLP
FT                   FLLALMILIAILIAFPKLSLFLPGLMK"
FT   gene            428519..429550
FT                   /locus_tag="Moth_0425"
FT   CDS_pept        428519..429550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0425"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18756"
FT                   /db_xref="GOA:Q2RLD3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD3"
FT                   /protein_id="ABC18756.1"
FT                   /translation="MNLSQWSIIKKCVNMEELIQVPVGLIVDSPWIPGYVGISTMDYFT
FT                   IPEKWLEANIKIIKDFPEIIFLPGFWVEYGMATEPSGFGCKINFYPDRTPTINHIINSP
FT                   EEAEDIFVPNPQTDGLMPFVLNIYRNIEPKVKDLGRCIKVVAARGPLTIASHLMGVTNF
FT                   LIGLKTDPANTHKLLKKTTTLAKNWLEAQAEVLSEVEGIMVLDDIVGFLSQDDYLEFAH
FT                   PYLKEIFDAFPQCIKMYHNDSDNIVCFSYLQDLSINIFNFTHLQDIAKVRQLVGNKICL
FT                   LGNIPPLDVLTNGTPDMVAEAAVNCLNQHGNKAGIILSAGGGTSPGTPGRNIHALIKAT
FT                   ANY"
FT   gene            429573..430334
FT                   /locus_tag="Moth_0426"
FT   CDS_pept        429573..430334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0426"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18757"
FT                   /db_xref="GOA:Q2RLD2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD2"
FT                   /protein_id="ABC18757.1"
FT                   /translation="MFSFEGKIVWITGSSTGIGRAMALGFARNGANVVIHYNNSEKAAL
FT                   SLAQEIEQMGKKSLVVRGDVSDKNQVDAMVSKIKERFGRIDVLINNAGSMIKRARFEEV
FT                   DEALWDRIINVNLKSVFLVTKAVFPMMKAQGKGKIINITSVAAKNGGGAGSITYATAKG
FT                   GISTFTRALARDLADYNILVNAIAPGLIRTPFHNPEITPPQVFEKMASEILLKRAGTPE
FT                   DIVGAALFLASDYADYITGETIDVNGGLFMS"
FT   gene            430377..431627
FT                   /locus_tag="Moth_0427"
FT   CDS_pept        430377..431627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18758"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD1"
FT                   /protein_id="ABC18758.1"
FT                   /translation="MPVITQENLALVVTKEVEQVRVTDIHTHLYPPNFGDLSLYGIDEL
FT                   LTYHYLVAEFFRYSTMDYEDFFNLSKTQQAELIFQTLFLEHSPVSEAQRGVLTTLKELG
FT                   MDLNVRDLRVFREQINSIPAFDYVDRIFAIAGIKEVVMTNDPFDPKERQLWETKGNKDP
FT                   RFKAALRLDVLLNNYEKNYEYLNQMGFLVDKKLDENTLTEIRRFLRYWIEKTNAIYLAV
FT                   SLPPDFMVPEDSCRSRILEKCVLPICRELNIPLALMIGVRRSINPRLGLAADSLGKADI
FT                   RAIEYLCRTYPENKFLVTMLSRENQHELVVTARKFRNLMVFGCWWFLNNPMIVEEITNM
FT                   RLENLGLSFIPQHSDARVLEHLIYKWVHARKIIADVLTKKYLDLLESGWRVTEEEIKRD
FT                   IEDLFGNNFWKFVGRNV"
FT   gene            431697..431933
FT                   /locus_tag="Moth_0428"
FT   CDS_pept        431697..431933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0428"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18759"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLD0"
FT                   /protein_id="ABC18759.1"
FT                   /translation="MACVITTEGKEIKTFGNKTDDILALIDWLKEKGCTHVAQGKRRHI
FT                   LEPIYKMLEPELVHPLVVNGQHIKESARISAFK"
FT   gene            432103..433719
FT                   /locus_tag="Moth_0429"
FT   CDS_pept        432103..433719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0429"
FT                   /product="Mannitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18760"
FT                   /db_xref="GOA:Q2RLC9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC9"
FT                   /protein_id="ABC18760.1"
FT                   /translation="MLDLDKDSIKYKKAWQDAGIELPEFDYEKMVADTKENPTWVHFGA
FT                   GNIFRGFIAMLQQKLLNLGKAKTGIVAVETFDFEIIDRIYVPYDNLSLLVIMNFDGTLD
FT                   KKVVASISEGLIGDVSREHDWNRLKEIFAKPCLQMASFTITEKGYSLKNASGEYFDDVL
FT                   KDMQNGPGQPRHVMSKVASLAYTRYKSGKLPIAFVSMDNCAHNGERLYESVKTIVKKWV
FT                   DNGLVESGFLAYINDVSKVSFPWTMIDKITPRPSDIVKDSLQSIGFKSTEIVHTKKNTY
FT                   IAPFVNSERSQYLVVEDNFPNGRMPLELAGVLFTDRQTVDKVEKMKVCTCLNPLHTALA
FT                   VFGCLLGYNLIADEMKDSQLKKLVEKIGYEEGLPVVVNPGILSPENFIREVIEQRLPNP
FT                   YIPDTPQRIATDTSQKMSIRFGETIKAYRDRKDLDPANLTYIPLVIAGWCRYLLGLDDK
FT                   GESMPLSPDPMLDVLQSYLSRVKLGDSESVGDSLKPILSNESIFGLSLYDVGLGEKIES
FT                   YFKEMVSGPNAVRNILQKYLG"
FT   gene            433790..434869
FT                   /locus_tag="Moth_0430"
FT   CDS_pept        433790..434869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0430"
FT                   /product="D-mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18761"
FT                   /db_xref="GOA:Q2RLC8"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLC8"
FT                   /protein_id="ABC18761.1"
FT                   /translation="MKMTFRWFGEGYDSISLDKIRQIPGKPGIVSAIYDVPVGEVWPEE
FT                   KIKKLKETVENAGLELEVIESVNVHEDIKLGLPSRDRYIENYQQTLRNLAKFGIKVVCY
FT                   NFMPIFDWTRSDLAKVLPDGSTALSYEEEKVQKVDPNRMVEEVEANSNGFELPGWEPER
FT                   LKTLKVLFEQYKSVDEEKLLKNLGYFLRAIIPVAEEVDIKMAIHPDDPPWSIFGLPRIV
FT                   KSKESLEKIMALVDSPYNGITLCSGSLGANPDNDIPALIRYFGAKGRIHFGHVRNIKIH
FT                   SLRNFDESSHLSSDGSLDMFEIMKAYHDIDFKGYIRPDHGRMIWGEVGRPGYGLYDRAL
FT                   GIAYLNGLWEAIGKMKKVC"
FT   gene            435306..436004
FT                   /locus_tag="Moth_0431"
FT   CDS_pept        435306..436004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0431"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18762"
FT                   /db_xref="GOA:Q2RLC7"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RLC7"
FT                   /protein_id="ABC18762.1"
FT                   /translation="MVELPANLIKATFLSRPNRFTVVAAREGEKLVAFLADPGRLTELL
FT                   LPGAEVYLAPASRQGDRKTAYDVVLLRQNGTFISLDSRLPNRLFAAALQAGSLEPFKGY
FT                   RLRATEVRAGSSRLDFLLQGDGHPPCYVEVKSVTLVRGGLALFPDAPTARGSRHLRELM
FT                   ALHSRGYRAAAVFIIQREDAISLAPNEVTDPCFSSTIREAAAAGVEIYAYRCHIDPVTV
FT                   SLIAPVMVKL"
FT   gene            436345..436680
FT                   /locus_tag="Moth_0432"
FT   CDS_pept        436345..436680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0432"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18763"
FT                   /db_xref="GOA:Q2RLC6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC6"
FT                   /protein_id="ABC18763.1"
FT                   /translation="MLSKSECTLVAEFLQGLANPVRVKILCALREGEKSVSEIVRETGE
FT                   KQSNVSQQLQILLHKGYLSRRREERNVFYAIKKPELFTLMEQIRTLVLAEKRGEEAKRP
FT                   EEAILEE"
FT   gene            436701..437054
FT                   /locus_tag="Moth_0433"
FT   CDS_pept        436701..437054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0433"
FT                   /product="DsrE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18764"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC5"
FT                   /protein_id="ABC18764.1"
FT                   /translation="MAQLCLVVQTGPYTYQNLDTAYGLARAALAKGHGVSLFLYIDGVV
FT                   AANKNIDAPGERNIAAMLQELAAAGVRIASCGACSKFRGITDEMYIDGAEMGSLVDMAD
FT                   MIQEADVLINFGF"
FT   gene            437085..437435
FT                   /locus_tag="Moth_0434"
FT   CDS_pept        437085..437435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0434"
FT                   /product="DsrE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18765"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC4"
FT                   /protein_id="ABC18765.1"
FT                   /translation="MQKVMVLIPSAPYGTAAMVEGYRYAIGMASLEVDTTVVLLDDGVW
FT                   AVYPGQNPKALQMKSLGEAFASIEDMGVKLLVSRESLEERGIPEDKILAGRVVDRAGLG
FT                   EALAGAEGIIQF"
FT   gene            437450..437755
FT                   /locus_tag="Moth_0435"
FT   CDS_pept        437450..437755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18766"
FT                   /db_xref="GOA:Q2RLC3"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC3"
FT                   /protein_id="ABC18766.1"
FT                   /translation="MLVLLTRSPFQRQDYRRNLQLAMTQPGSEVILIQDAVLALHKAPA
FT                   DYQEMVDQARVQGINFYALAADLEARGLDTKATYPGTRVIDYGEMVDLAVKHGKVL"
FT   gene            437795..438022
FT                   /locus_tag="Moth_0436"
FT   CDS_pept        437795..438022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0436"
FT                   /product="SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18767"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC2"
FT                   /protein_id="ABC18767.1"
FT                   /translation="MQADAVLDARGLLCPMPIVKLSQKIKAMDSGQVLEVQADDKGAAV
FT                   DIPAWCQKTGNIYLGSEAGSNYTSYYVKKS"
FT   gene            438035..438511
FT                   /locus_tag="Moth_0437"
FT   CDS_pept        438035..438511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0437"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18768"
FT                   /db_xref="GOA:Q2RLC1"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC1"
FT                   /protein_id="ABC18768.1"
FT                   /translation="MAEDKMAIICFSGDLDKALATFNLATGAAASGMEVTIFFTFWGIN
FT                   LLKKPRGRRGASSLLGRMFDWMMPSGPDRLPLSKFNMAGLGPFFMKKQMRSKKVQAVSE
FT                   FLALAREMGVKFVACIMSMQVMEIPEEDLIDGVEFGGVAAFLQEAANAKISLFI"
FT   gene            438562..438978
FT                   /locus_tag="Moth_0438"
FT   CDS_pept        438562..438978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0438"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18769"
FT                   /db_xref="GOA:Q2RLC0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLC0"
FT                   /protein_id="ABC18769.1"
FT                   /translation="MQIATYNFPDELYYDDKHSWARIEGDVATVGLTDFSQQLAGAFVH
FT                   INLPKAGKTVARGKPLAAVESGKWVGRAYAPVSGEVIAVNENLKKQTGLINSDPYGEGW
FT                   IAKIKMSNPAEVAGLLQGEALKAFIEQEIAKHQK"
FT   gene            439067..439537
FT                   /locus_tag="Moth_0439"
FT   CDS_pept        439067..439537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0439"
FT                   /product="Heterodisulfide reductase subunit C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18770"
FT                   /db_xref="GOA:Q2RLB9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB9"
FT                   /protein_id="ABC18770.1"
FT                   /translation="MQQGNDPLNGWPAFTTMRACYQCARCTSGCPVATLDPEYNPRRIF
FT                   RLAVLGEKEAVLKDEKLWYCLACYTCQERCPEEARPAEVLLALKNLACERGFAPAALLA
FT                   AARLVAEDGRLYNIDEFHNEYREEEGLPALDEETGILGKLLALTGLQGRLVE"
FT   gene            439534..440412
FT                   /locus_tag="Moth_0440"
FT   CDS_pept        439534..440412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0440"
FT                   /product="CoB--CoM heterodisulfide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18771"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB8"
FT                   /protein_id="ABC18771.1"
FT                   /translation="MTGRRYALFLGCNVPVRNLGYELAARRVAAALEIELVDLPGFRCC
FT                   GYPLKALDSYAALLVAAHNLCQAEAAGLPIVTLCNACSGTLTEADLELKEDADLRKRVN
FT                   GDLARVGLRYQGTTRVQHFLRVLDSSPGRQEIRRRVSLPLDSLQIAVHYGCHYFRPTRV
FT                   YHRYGVDPREDAEAPEALDRLVTATGAASISYEGKNDCCGGGLMGLRPDLAREQAGRKV
FT                   REAQGAGADALLVACPTCGLNFSNSQPDDQELTILYFPQLLGLALGLDPDELGLELNQI
FT                   SADGVREKLGV"
FT   gene            440416..442962
FT                   /locus_tag="Moth_0441"
FT   CDS_pept        440416..442962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0441"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18772"
FT                   /db_xref="GOA:Q2RLB7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB7"
FT                   /protein_id="ABC18772.1"
FT                   /translation="MSGKLDVLVVGGGPAGMAAALDLARAGLQVMIVEKEAVLGGRWLD
FT                   YGCKAGEDCSRCNICLGFPLLEEVTSRENITLVTGMVVVGVTGTTGAFTASLRATGPRI
FT                   DWQKCDHCGRCREACPAGAILPPHPRGLPRAYRLDHSCCLRAKEDCQACVAACPRAAIE
FT                   LEPASPESIRARAIVVATGFAPFDAAGLPEYGYGFYPRVTTAMELESALSQGDLDAPGW
FT                   ERLSFIQCAGSRSRKLGHDYCSRVCCGYSLRLARALKYRGLSREITIFYMDLQLNDARL
FT                   QELYRELRATPGLKLVRGMPSEIRRGRDGRVSIHYEDLSTGTLATEEFDRVVLAVGITP
FT                   VRGEILPGLSLERDPAGFLAAVDGPNGIQASTPGVFLAGTCQAPRDIQESITHGRLAAA
FT                   GVRKLLEGSGEKAGMSDISSGAGRSAAADVLVSGRGASALLAARDLMRAGLRVLLLDDD
FT                   GDFDPADPAGELAGPLWSELTDNSKVTYLPGREILGVNGDAGSFSVQVGDGRRVANLQV
FT                   RAILLANRLAAGLPAGIATGAVPILTQQQLAAKLAAGGRIPALTSQGVTGTADGDLLAG
FT                   IRGGGEVVFWLDAAGDLSLAIHALAWQNIAALKERLEPDRTIYVLARQVRVAALPELEA
FT                   LYGRLREAGVIFIKPQEVPSWDGACLEVSDPTRLTPGMPEVTRLHPDLLVVGEELAATP
FT                   VTRRLWQRLGLKAVQGEANGPAGMDSLYYRAVTTNRRGIFLVAAGREPVPAGEAGTAAS
FT                   LAAAAVVSFLKGEEPEAAPVTLAFRPLDGACAACLTCVRTCPHGAMVVQGKALVRTRSC
FT                   QGCGICVAECPAHALELPEYTDVRLLQAAAGDKGGN"
FT   gene            442962..443372
FT                   /locus_tag="Moth_0442"
FT   CDS_pept        442962..443372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0442"
FT                   /product="Methyl-viologen-reducing hydrogenase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18773"
FT                   /db_xref="GOA:Q2RLB6"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB6"
FT                   /protein_id="ABC18773.1"
FT                   /translation="MTNSQEQIIAFCCRHSARRAADRAALEGLALPGAVRLVNVPCSGR
FT                   ISMELILKALEDGAPGVLVLGCHPGACHHLYGSDRARERVTAVRQRLQEAGLNPARVAF
FT                   ASLGPDNAADLTRLLADFVESSWVLTPLASEP"
FT   gene            443402..444994
FT                   /locus_tag="Moth_0443"
FT   CDS_pept        443402..444994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0443"
FT                   /product="Biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18774"
FT                   /db_xref="GOA:Q2RLB5"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB5"
FT                   /protein_id="ABC18774.1"
FT                   /translation="MRQWRLLDTGSRTAAENMALDEVLLTARSQGQAPDTLRFLQFNPP
FT                   CVLVGFHQVVEQEVRLEYCRREGIEINRRITGGGALFWDTNQLGWEVITTLDYPGVARR
FT                   LEGLYAQLCGAVVRALKRLGVPAAYRPRNDIEVGGRKISGTGGTELGGAFLYQGTLLID
FT                   FDVETMLRALRIPTEKLKAKEIASLKERVTCLKWELGRVPLLETIKQVIAEEFCREFAM
FT                   ELIPAGLTPAEEALLAHQLPYFQSEEWINAVQGPEGRTELRSSRRTRGGFLRSSLVLGP
FT                   GNSRIESLYLTGDFFAHPRRSIYDLEARLKGLPADPVLISRQVEEFFRESGARLPGIKA
FT                   AEVAAAINDALVKKDYPRQGIPAAAVNDVFTVVKPLEEITAAPVVLLPYCAKLPTCRFR
FT                   GRQGCSECGRCDIGTAYALARQYGLEPLTIQNYEMLARVLRRLQREGAPGFLGSCCEAF
FT                   LAKHRRDLERIGLPGILLDIDSSTCYELGQERAAHAGRFENQTTLKLDLLELLMARVAP
FT                   GKARRQVAVAAHA"
FT   gene            444987..446012
FT                   /locus_tag="Moth_0444"
FT   CDS_pept        444987..446012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0444"
FT                   /product="Geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18775"
FT                   /db_xref="GOA:Q2RLB4"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB4"
FT                   /protein_id="ABC18775.1"
FT                   /translation="MLKYDAVVAGAGPAGSTAARVVAAAGARVLLIEKRARVGYPVQCA
FT                   EYVPALIASEVDFGEKSIALAVGTLVTFFPDGTVTSTPAPGYILNREVFDASLAEGAVK
FT                   AGAELWLKATVEDLTDTSLIIRQANGRRQEVEAGVIIGADGPLSLVARTRGWPRATLAA
FT                   AVQVEMALPEPMQVTRVYFDPLYRGGYAWVFPKGKTANVGVGLVPGEITPAAALTHFLR
FT                   RLGWQQQNIVRRTGGLIPVAGPYQEVHRGRVLLCGDAGGFTHPVTGAGILTAILSGRLA
FT                   GEAAAAYLGSGAPLATYEESWRDLLGPALARGQAGRRRWQEEWARDGAALSKLLRQTWM
FT                   V"
FT   sig_peptide     444987..445061
FT                   /locus_tag="Moth_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.534 at
FT                   residue 25"
FT   gene            446035..447084
FT                   /locus_tag="Moth_0445"
FT   CDS_pept        446035..447084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0445"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18776"
FT                   /db_xref="GOA:Q2RLB3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB3"
FT                   /protein_id="ABC18776.1"
FT                   /translation="MPATSPEYVKTSTAAAITLGFQPGSFHRDARLTGLNLLLTYNEPC
FT                   AGRCAYCGLSGNRLPDAEPTFIRVDWPVYALDAILKEVRRDSRGLERVCIGMPTHRRSW
FT                   DDLLKVVNRWHRESDLLISALLTPTACRGRDFFELRAAGADMVGIAIDCATPELFERYR
FT                   GRGVKGPHRWEEYWEGVSRAVTVFGRGRVGIHLIVGLGETEAEMIQTIQRAQDMGVRTH
FT                   LFSFFPETGTILARRRQPPLGQYRRVQLARYIINEGLGRAEDMTFNDAGQVMDFGMDIT
FT                   PLVKAGEAFRTSGCPGKDGRTVACNRPYGNERPSQAIRNFPFAPEPGDIRAVERQLRQG
FT                   LKGAVAHAG"
FT   gene            447074..448051
FT                   /locus_tag="Moth_0446"
FT   CDS_pept        447074..448051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0446"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18777"
FT                   /db_xref="GOA:Q2RLB2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB2"
FT                   /protein_id="ABC18777.1"
FT                   /translation="MPVELRRQLAEVYHLPLKELLPAAWRLRLKNFPPVLGLATPGSKH
FT                   YDSGDHRNHRRLFVTISITGQGCRLQCEHCRGELLKSMYPATTPAALLELGRQLKDGGC
FT                   RGVLVSGGADLGGRVPLLPYLEALAGLKGLGLKVIVHTGLADPATARGLKNAGVDQVLL
FT                   DIIGDRETARRVYHLEMDPADYGAALENLLSAGLKVVPHIVAGLNFGRLAGELEALYQV
FT                   LSRDCRDLVLVVLTPLPGTPMAGITPPPPAAVGRLLATARLAGPRLNILLGCARPAGRH
FT                   RLWTELYALRAGVNGMAYPHEATVARARRLGLKPFFSDLCCSLL"
FT   gene            448133..448357
FT                   /locus_tag="Moth_0447"
FT   CDS_pept        448133..448357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0447"
FT                   /product="SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18778"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB1"
FT                   /protein_id="ABC18778.1"
FT                   /translation="MAVFRMDTCGEMCPIPIVRARVKLKQMAPGDILVVTSDHSCTSQS
FT                   LAETMAKMGHRVEVREVANGIWEVTIKKV"
FT   gene            complement(448358..449251)
FT                   /locus_tag="Moth_0448"
FT   CDS_pept        complement(448358..449251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0448"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18779"
FT                   /db_xref="GOA:Q2RLB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLB0"
FT                   /protein_id="ABC18779.1"
FT                   /translation="MNINHLEAFCTVAQVKSISEAARILHMSQSSLSYQIQLLEKDLDV
FT                   ELFTRTTKGVELTEMGEIVYEYGQTFLQLAENLRRDLDNWKSGQEHLIVGASSSIGSYA
FT                   LPCTIYSFKEKYPDANVKLLVGNREETIQKLLDKTIDIGLIEGPVDQPGLATRGVTEDE
FT                   LLLIVPAGWQGQESITLEELCRLPLILREEGSGTRQVIARALAEHGLGIANLNVVLELN
FT                   SNDAIKSAITAGHGVSLLSRLATRREIHNGSLKALQVKGISFRSTFTIVYPAGKPATNL
FT                   QKKFFRFLLANKKAFC"
FT   gene            449331..450515
FT                   /locus_tag="Moth_0449"
FT   CDS_pept        449331..450515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0449"
FT                   /product="Protein of unknown function DUF395, YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18780"
FT                   /db_xref="GOA:Q2RLA9"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA9"
FT                   /protein_id="ABC18780.1"
FT                   /translation="MAPDTQLAHINLKPKSQEPYALILALAAAAIFWRLQGQGIGLGTM
FT                   WLFGLALGYVLQRSRFCFVACFRDPFITGNTSLSRAVVLALAVATAGMALLVLAGGSPV
FT                   EVYPAGWHNLAGGLLFGTGMVLAGGCASGTLMRAGEGHLLQWLALAAFIMGSLWGAHDF
FT                   GWWQQVSLSCSPVLFLPRLVGWGPALVLQLLILGLIYHGLWRIEKQAFPDFSPPGKGRY
FT                   AFKLRHLWSRPWPYWAGGVVLAVLDVALAWCTGRPWGITTAFSYWGAWLWQAFTGHPPG
FT                   WYYYSLPEHTRALGLGFLAEPGTILNLGTIWGAGLSALAASEFRLHLPRRWQVVPAALA
FT                   GGIMMGYGARIAMGCNIGAFFNGIASLSLHGWLFGLGLAGGAYLGGKLLLRFLV"
FT   gene            450976..453144
FT                   /locus_tag="Moth_0450"
FT   CDS_pept        450976..453144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0450"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18781"
FT                   /db_xref="GOA:Q2RLA8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA8"
FT                   /protein_id="ABC18781.1"
FT                   /translation="MLEQKITRRTFLKGSLAAGALATFGGKLIPIEPAKAAAAGQAETR
FT                   VVPTLCEMCGVKCGVLAHVRDGRVWRLTGNPRDPQSGGRLCARGNAGTKTLYDPDRLKG
FT                   PMKRVGEGQFQPISWEQAFQEIGSKLKELKEQYGPQSLVWLAHPELISPLEKHFMAAFG
FT                   SPNYTGHGPTCYSSRNVAFEQMYGGVPGVDYRNVRYYIAFGRNLTGGIKNPDVQKIVAA
FT                   KAEGAHLVAVDPRLSDFAYFADEWLPIRPGTDLAMVLAMINVLINENLYDAAFVAAYTT
FT                   GFEELKKGVSGYTPAWAAGITGIEAGTISRIARELAAAKPAAAVDPGWHAVTGSQYGNS
FT                   VQAGRAIAALNALLGNLGARGGLSLPPTIKLGSPAGIMGPKPPAATAPRWDGAGSEKWP
FT                   LNKDHGMIQTFPERVKQDQPYPVKAVIIQHLNPVRSSTDSLAFIEALKKLDLVVAIDIQ
FT                   MNDTAYYAHYILPEATYLERYDPLMTVGNKVLLRQPAIKPLFDNKGAEEIIAGIGRAAG
FT                   LSEYFNFTLEQYNDALLGPLGLTQAQLALTGVAEVEASKPDYSKLKTPSGKIELACPAF
FT                   VKAGSTLTPAWEPPLVEPRDDSFRLIQGHVPMHTHTTTDNNSYLHAIMPENELWIHTSR
FT                   AGKLGIKTGDLVEVASKVGKVRVKARVTEAIHPEAVFLAHGFGCRVPLRHLAYNRGANG
FT                   GDLIPIMTAPVSGAAAQCETLVTVRKAG"
FT   sig_peptide     450976..451086
FT                   /locus_tag="Moth_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.722 at
FT                   residue 37"
FT   gene            453150..453845
FT                   /locus_tag="Moth_0451"
FT   CDS_pept        453150..453845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0451"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18782"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA7"
FT                   /protein_id="ABC18782.1"
FT                   /translation="MAHYAMLVDLTRCVGCHGCTVACQAKWDLLPEIQFTKVHRYEIGS
FT                   FPKVKGGVVTTQCMHCDDPPCARVCPTGATQKRPDGIVIVDESKCIGCRYCQSACPYDA
FT                   RSFNPQRGIVQKCYFCYDFVAQGRKPACVDTCMAAARVFGDLEDKGGELSRALAAKKAV
FT                   QIKGTSIFYVPPRNLDASYLPPDFREPGAVRIWQDIVHPGGKTVMGLAAGAVVAGLVIN
FT                   NIKGGGANA"
FT   gene            453838..454518
FT                   /locus_tag="Moth_0452"
FT   CDS_pept        453838..454518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0452"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18783"
FT                   /db_xref="GOA:Q2RLA6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA6"
FT                   /protein_id="ABC18783.1"
FT                   /translation="MPEERVERFNLAERLGHWSHGISFVVLLLTGSALVFHGFGGLLGP
FT                   GGLRLFRSVHHLMAYPFTFLTVLILLLGTPRTAGQWLKECLTWRADDLRFIAAFPREFF
FT                   GLKVQLPEQGKFNAGEKLNSLLTIFGSILMASTGWILIFRDSVSPAVAAWALPLHSAGA
FT                   LVMGGVLLGHIYLALGHPNSRESINGMISGRVSAQFARQHHLIWYRELKEKEKDSRGKK
FT                   QKIA"
FT   gene            454692..456773
FT                   /locus_tag="Moth_0453"
FT   CDS_pept        454692..456773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0453"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18784"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA5"
FT                   /protein_id="ABC18784.1"
FT                   /translation="MGVSAVIPAYNEETTVGRIIDTLKQVAAVTEIIVVSDGSEDDTAA
FT                   VARHHGARVLELAVNSGKGAAMTAGAREAREDILLFLDADLEGLLPDHVQALIEPLLAG
FT                   RAEMSVGIFSRGRSMTDLAQVVAPHLSGQRAIRKDLFLAIGADRSRFEVEVQLTSEARA
FT                   RNWRVEKVPLVNMTHIMKEEKRGLYRGVVARMGMYKDIAGFFWRLTRKKLKARPVAVLL
FT                   LLLSLGVTFNYDTQRVASAEAGRMPDLNLPAAGQRLLVVSPHPDDETLGAGGLIAKARA
FT                   RGDTVKVVFMTNGDGFRRGVETTRGILPTSAGDFLTYGERRQQEAITALGNLGVGPADI
FT                   IFMGYPDGGLAAIWSNYWQEDKPYRSACTRKEAVPYRLAFKPGEPYAAPALLADLEEIL
FT                   REYRPTDIYVTDTNDSHPDHWATGAFTLAAVGELKGEDPTFNPRIYTFVIHTGMWQMLP
FT                   VFDRDHKPLLPPGYFLARGTPWYKLPLAPAILELKKQAIAAYRTQEMVMPTFLANFERP
FT                   NEVFSRLPDQEVITTATGMSVDGWVKEWPRDAVIALDPAGDLVTKKVERGGDLKAAYLL
FT                   QSGRTTYLRLDTWGRVGFPVNYTLSIYLLPASPGAGSQRFTWSWAPGEKQVRWLTRPAG
FT                   YDPNAIRVASGGDSLEMALPDLIPPGEHYLMFTAVTSIGRLPLDRIPWRLVKIKGSDL"
FT   gene            456774..457760
FT                   /locus_tag="Moth_0454"
FT   CDS_pept        456774..457760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18785"
FT                   /db_xref="GOA:Q2RLA4"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA4"
FT                   /protein_id="ABC18785.1"
FT                   /translation="MTPLRFGLEEEVFITEPDKPTLQSLYYLARLLWLDPGYYYTHTAC
FT                   NFNRGKDLRWGLMSGIEISTGVFPDTGDLVADLRRRRRELAAVCQGLIVPVGHLFDQVA
FT                   PTNICGMHVHVSGFPDRERAYRNLVYFLPLLALLVINSPIAGSRRYGQSYRWAEAFAIG
FT                   PLREDRLYRFQDLIESKRLGTLEIRVFDPVWDLERIRILLECIRAVLEAGVDYPGDIET
FT                   YNRLRRQVALEGYIQELQPIYRELSKLLPVPEVYFQQTPADALGRLWKEQGTLATYTAL
FT                   DNAYRNGILQPRPLKTMRVRWPLMLAGFCGYYLPRMPYSIKKVLSEW"
FT   gene            457754..458518
FT                   /locus_tag="Moth_0455"
FT   CDS_pept        457754..458518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0455"
FT                   /product="Phosphatidylserine decarboxylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18786"
FT                   /db_xref="GOA:Q2RLA3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA3"
FT                   /protein_id="ABC18786.1"
FT                   /translation="MVTFSMALAILPALFVGLNLLKILLLLAAVITAIMWFLRRVWFYR
FT                   DPVRVPPTEAGTILAPADGKVVYIKPFRNGEVVAEKLGQAIPVREIMKAPGLGDRGWIM
FT                   GIYMSPLDVHFNYAPIAGRVEDMVHTRARVNLPMVDLWEYIRLTYFRRAVDLFCHRYRL
FT                   VNERLTIFLDGEGIKIAMVEIADKFVNKINSFIKPGQVVDRGQKVSFIERGSQVDLVIF
FT                   SEDVEFTVRVGQQVYGARTVVARYRPPGGVVP"
FT   gene            458515..459117
FT                   /locus_tag="Moth_0456"
FT   CDS_pept        458515..459117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0456"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18787"
FT                   /db_xref="GOA:Q2RLA2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA2"
FT                   /protein_id="ABC18787.1"
FT                   /translation="MTALHAYLALFGLLAIEGTGLPGVPFEPAFLAAGYLIERGEMSFW
FT                   GAVLVGTAGNLLGNLIGYWLGARPGRGLIERLLHQGWGEGGMTTARYWLARYGAAVIIL
FT                   ARWFGPIRTPTILAAGVVGMETGIYALYSTLGAFTWTLAWQYASWKGTHYLLGWWQVYR
FT                   RYATWWMDALLILAGLAITTISVYYCWRRWRRDKEPA"
FT   misc_feature    459162..459289
FT                   /note="ydaO/yuaA element as predicted by Rfam (RF00379);
FT                   Moth_R0024"
FT   gene            459403..460650
FT                   /locus_tag="Moth_0457"
FT   CDS_pept        459403..460650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0457"
FT                   /product="glutamate 2,3-aminomutase"
FT                   /EC_number="5.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18788"
FT                   /db_xref="GOA:Q2RLA1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA1"
FT                   /protein_id="ABC18788.1"
FT                   /translation="MGREAKREIALDRAAELKARIVDYLEEREKIASGLEAAAEIEASK
FT                   QRILAYFGAGEAEWQDWRWQLTHRITSVATLAELIPLTEAEKEAILKVERTYRWAVSPY
FT                   YLSLMGPEPDCPIRRQALPSAAELEDNHGVLDPMDEELTSPAPAITRRYPDRLIINVTN
FT                   QCAMYCRHCQRRRNIGEVDRSRSRRELEQALQYIRQNEEIRDVLITGGDALMLSDAMID
FT                   WLLTELDNIPHVEIKRLGTRVPVTMPQRITPELCRVLAKHPPIYLNTQFNHPREVTAAA
FT                   KEACDRLVQAGVVLGNQAVLLKGVNNHPFVMRKLNQELLKIRVRPYYIFHAKPVKGTTH
FT                   FITSIEEGVEIMDKLRGYTSGLAVPTYIINAPHGLGKTPILPQYVIARNDHQVILRTWE
FT                   KRIIFYSNLGRQKEQA"
FT   gene            complement(460703..461452)
FT                   /locus_tag="Moth_0458"
FT   CDS_pept        complement(460703..461452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0458"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18789"
FT                   /db_xref="GOA:Q2RLA0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLA0"
FT                   /protein_id="ABC18789.1"
FT                   /translation="MPVRREGHASKDNHERWLLTYSDLITLLMIFFVVMYAISDTNAQK
FT                   MAALANSLAQTLTGAPTTGILTSGGLTSIVPGIAPAPGQGDEGAELARARAELQQYIQQ
FT                   EGLESQVTLNTEERGLVVSVADAVLFPKGSADLTPEARDLLRQVGRALARLPNYLRVEG
FT                   HTDNLPINTPAFPSNWELSTARATNVVKVLISEAGIKPERLSATGYGEYRPVAPNNSEA
FT                   DMARNRRVDIVVLKEAYNVTEPHKGEK"
FT   gene            complement(461415..462248)
FT                   /locus_tag="Moth_0459"
FT   CDS_pept        complement(461415..462248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0459"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18790"
FT                   /db_xref="GOA:Q2RL99"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL99"
FT                   /protein_id="ABC18790.1"
FT                   /translation="MFLDLNLILGLLIGFGSLIAAFILEGGSPGALLAITAAMIVFGGT
FT                   IGATLIGLRREEVLNIPRLLKVAFREKPLDLNETINAIVNYAVLARKEGFVRLEKELDG
FT                   VKDDFLRTALQLVVDGTDPEQTRNVLEQYIYATSERHHSGISLFEAAGGYAPTMGIIGT
FT                   VMGLVHVLSNLSTPDKLGPSIAMAFIATLYGVSSANLLWLPIATKLKNKDARERLYQEM
FT                   ILEGVLALQAGKNPTLIRNTLAAFLAPGKERAGAGKEEREVSDGAGPQGRARQQG"
FT   sig_peptide     complement(462144..462248)
FT                   /locus_tag="Moth_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.677 at
FT                   residue 35"
FT   gene            462427..463650
FT                   /locus_tag="Moth_0460"
FT   CDS_pept        462427..463650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0460"
FT                   /product="Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18791"
FT                   /db_xref="GOA:Q2RL98"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL98"
FT                   /protein_id="ABC18791.1"
FT                   /translation="MNDLLIRRARLMDGQGTVDIAIKDGYIVAAGNNVAGSARQMVDAS
FT                   GRLLIPAFVDAHTHLDKALTATDGGAGSLEAAIEDFQRRSKDIDKNDLLARGRQVLRLA
FT                   LRHGTTAMRTHITVSENLGLRGIEAALELREEFAGKVDLQVIAMFSGPEPEPAPPLKEL
FT                   LEEALRLGVDGLGGAPHLSPGMQQWVDYIFELAGKYDVPIDLHADETDAPSVASLEYIA
FT                   SKTIQAGYQGRVVADHCCGLAAVDEATAGRTIAAVKEAGLSIITLPSCNLYLMGRNDKG
FT                   LVRRGVTRVRELQAAGVNVAYASDNIRDAFRPFGNANMLEEGLITAQVLQMGTPAELEQ
FT                   VMKMGTYNAAAAMGLQDYGIKVGARADLVLLDATTPAGAIIGQVEKVCVIKGGRVAVRN
FT                   DKKSDIII"
FT   gene            463727..464521
FT                   /locus_tag="Moth_0461"
FT   CDS_pept        463727..464521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0461"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18792"
FT                   /db_xref="GOA:Q2RL97"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL97"
FT                   /protein_id="ABC18792.1"
FT                   /translation="MLVDLNPIAFHLGPLAVRWYGIFMALSFLVGSWYLYREGLRRGLD
FT                   EDFLLNLAIIVIISGVIGARLVFVLANYPGWFLTDRLQILKIYEGGLSWHGGLLGGFLA
FT                   GWLYARSKRVDVNQLADMVIPGLAFGYFLVRIANIFNQEVLGRPTDFWFGRWPAQLIGS
FT                   AIGLILLARYFYVQSKNPPSGYQFWSFIFYHQILRAVIEESVRDNPLSVLGYVVPHWGL
FT                   GFFTLTQVTTPPILILAYYFMWRSRRLGRGGQDSYRLDLTPR"
FT   gene            complement(464606..465811)
FT                   /locus_tag="Moth_0462"
FT   CDS_pept        complement(464606..465811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0462"
FT                   /product="Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18793"
FT                   /db_xref="GOA:Q2RL96"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL96"
FT                   /protein_id="ABC18793.1"
FT                   /translation="MKLFHISPETNLDLLVDNLWDGQQEGYRQQVVISIRRGRIAAVQP
FT                   REMQGTGNGTQQMRLTGLTVLPGLIDAHVHLALDGIDFQASLDRWQDPLLRERVLARAL
FT                   RVTLEHGLVAIRDGSDREGLNLQAREWVRAGKYPGPRVVATGMAVHKKGKYGSFLGPGT
FT                   TDPASIRELVTSLVNRNVDQVKVVVSGLVTFHRYGEVGSLEFATAELVEAVKTAHAAGR
FT                   PVMAHVNSAPGVDLALAAGVDSIEHGYFLTTAQLETMAARGTFWVPTVAAIANRLHTAK
FT                   REVYPEREIDIIRRTQESQQEMVARAHRLGVKLVVGTDAGAPGVYHGESYLDELLYWYQ
FT                   AGIPAAAILRAATVTAAAALGLDGELGQIRPGYRPCLIAVRGNPLENLRVLAQPEMVFI
FT                   DN"
FT   gene            complement(465936..467726)
FT                   /locus_tag="Moth_0463"
FT   CDS_pept        complement(465936..467726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0463"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18794"
FT                   /db_xref="GOA:Q2RL95"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL95"
FT                   /protein_id="ABC18794.1"
FT                   /translation="MLPTRRPLAEVTRELVAVATGKLPADTVIKGGKVVNVFTGEILPW
FT                   DIAIKNGRIASVGDVSAAVGPETEVIDASGYYLCPGFMDGHVHVESSMVTVTQFARAVL
FT                   PGGTTAIFMDPHEIANVLGMDGVKLMVDEGRELPLKVFATMPSCVPAAPGFEDAGASFG
FT                   PEEVAAAMQWPGICGLGEMMNFPGVLAGDPAVHGELRATLAAGKPITGHFAMPADFQGL
FT                   AGYTAAGISSCHESTRTEDALNRLRLGMYAMMREGSAWHDIKATIKSLTETRVDSRRAM
FT                   LVSDDTHPETLLSTGHLNHVVRRAIEEGLNPIRAIQAVTINTAECFGVAQDLGAIAPGR
FT                   YADILFLKDLARVAIDKVMVDGRVVAAGGRLLVDLPAVAYPDRVRHSVHLKEPLTPWHF
FT                   RINAPAGKSRVQVRVMEIIEANVNTRHLTVTVPVVDGQVTAGVEADLAKVAVVERHGGN
FT                   GSIGLGFVRGFGFKAGAVASTVAHDSHNLLIVGMNDADMALAGNTLAGCGGGMVAVRDG
FT                   QVLALLPLPIAGLMSDRPVEEVAARLAAVHRAWQELGCRLVSPFMTMALLSLPVLPELR
FT                   LTNRGLVDTLQFKMVDLITG"
FT   gene            468029..469120
FT                   /locus_tag="Moth_0464"
FT   CDS_pept        468029..469120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0464"
FT                   /product="glycerol 2-dehydrogenase (NAD+)"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18795"
FT                   /db_xref="GOA:Q2RL94"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL94"
FT                   /protein_id="ABC18795.1"
FT                   /translation="MLERIIAPGSYLRGPAVIEKAGQALARLGARACLAGGHRALAAAA
FT                   PALQEALSSAGVEPAGQVWYGGECCPENIARVATTVKETGADFLIGVGGGKALDTAKGA
FT                   AWQAGVPLVTVPTIAATCAAFTSIAIIYDREGHFLAISHEAANPSLVLVDSRIIAAAPG
FT                   RYLAAGMGDTIAKYIELRATSTAAARHLALEGALELARLCYDSILAAGPGARAAVDDRA
FT                   VTPDLEKVIDAVILISGLVSGLGGDDGRTAGAHGVYEGLTASPLTRSYCHGELVAFGNL
FT                   VQLVLEGRERGEIRGVADFNRRVGLPVTLEGVGLSPEDGPSLDLVSRAAAESPDMANMP
FT                   FPVTATMIREALLAADRLGRETA"
FT   gene            469181..470224
FT                   /locus_tag="Moth_0465"
FT   CDS_pept        469181..470224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0465"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonate"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18796"
FT                   /db_xref="GOA:Q2RL93"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL93"
FT                   /protein_id="ABC18796.1"
FT                   /translation="MKRKLKRIAILFLALALAGLALAGCGGGSKQQAADQQTGSSGQGQ
FT                   QLTPVKLTMTTWSGYGPLFLARDKGFFKKHGLDVQLIVIQGLGERKQALAGNQVDGIAT
FT                   TLDIETQIVAAGIPLKQIWALDDSYGGDGILAKPEIKTIKDLKGKNVAYDFGTASHILL
FT                   LSILAKNGMTENDIHHVQMSASDAGSTFVAGKVDAAVTWEPWLSKAVKENKGNLLATSK
FT                   ETPGLIMDTVALRSDWADKHPQALQAMVDALAEAMQYWESNKAEANAIMAKGLGIKQEE
FT                   FESNLQTLRLFNLAQNKEMFGTADKPGTLYTSLQQAIDFGFNNKVIKSKPDAKAMIDPT
FT                   FVNRAKI"
FT   sig_peptide     469181..469315
FT                   /locus_tag="Moth_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.196 at
FT                   residue 45"
FT   gene            470251..471039
FT                   /locus_tag="Moth_0466"
FT   CDS_pept        470251..471039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0466"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18797"
FT                   /db_xref="GOA:Q2RL92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL92"
FT                   /protein_id="ABC18797.1"
FT                   /translation="MGKYFKLNTPIPGKLYFSLSVAAFVLLLLAWQLGVTVGHLPPTHL
FT                   PPPGAVARAAVELAGNGLINDIGISFFRVTTGFLLAAAIGVPLGILMGSLKVVEAFFEP
FT                   LLAFFRYMPASAFIPLTIIWLSIFETQKIGVVFIGIFFQLVLMVMDVTHNVPQDLIDTA
FT                   YTLGARPLEVFRRVILPAALPGIMDTLRVALGWAWTYVIVAELVAASSGLGFLIMNAGR
FT                   QLSTPDMFVGILTIGVLGIICDMSFKVLYRWLFPWTEREV"
FT   sig_peptide     470251..470415
FT                   /locus_tag="Moth_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.748 at
FT                   residue 55"
FT   gene            471042..471866
FT                   /locus_tag="Moth_0467"
FT   CDS_pept        471042..471866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0467"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18798"
FT                   /db_xref="GOA:Q2RL91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL91"
FT                   /protein_id="ABC18798.1"
FT                   /translation="MALAAAPRASGKKLVVVNLTREFTLKRERITALDGISLEVREGEF
FT                   VTILGPSGCGKSTLLRIIAGLAEASSGQVYKDGRLIQGPGPDRGMVFQSYTLFPWLTVR
FT                   KNIEFGLTLKGMDAARRRQIVDHYLDIIGLAAFADAFPKNLSGGMKQRVAIARALANDP
FT                   DILLMDEPFGALDAQTRLVMQELLLKVWEETRKTILFVTHDVEEAVFLGDTVYVMTARP
FT                   GRLKARIPVPLARPRSFEVKNSWPFLELKSRILEQIREESLKAATMMPGGCG"
FT   gene            complement(472441..472698)
FT                   /locus_tag="Moth_0468"
FT   CDS_pept        complement(472441..472698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18799"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL90"
FT                   /protein_id="ABC18799.1"
FT                   /translation="MGRFVLQINIHTLRIADVDTGSAVAIGNNYFYDWHTCSKTNNGFG
FT                   RLSGDYNSMVDPAFQIDDPDWQDMLCNEWLAEPYLHKLLE"
FT   gene            472817..473074
FT                   /locus_tag="Moth_0469"
FT   CDS_pept        472817..473074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18800"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL89"
FT                   /protein_id="ABC18800.1"
FT                   /translation="MAVAVITGIIRINQFRTNAGMGQGKNVFEPWTMNTKSNMALGQVA
FT                   GNLNFFSTGANIINDPDIIDNPIVDNGLKSNFAPANQEVF"
FT   gene            473089..473532
FT                   /locus_tag="Moth_0470"
FT   CDS_pept        473089..473532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18801"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL88"
FT                   /protein_id="ABC18801.1"
FT                   /translation="MFGLIGKRCRVPERSPAGATVLIGLERRVEELQATVNKMAADLTA
FT                   LLGQLVGQDLNVHVDKVCIDKVNLDQLTFNIDGIGVKDLSGSLSIGLNYGGRVIRLGPP
FT                   AKPPGEKKPEGSSIPNPRPLGGKPPRVNFQASRREGENDDRGV"
FT   gene            473513..473980
FT                   /locus_tag="Moth_0471"
FT   CDS_pept        473513..473980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0471"
FT                   /product="Heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18802"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL87"
FT                   /protein_id="ABC18802.1"
FT                   /translation="MMTGEYNPLEALKNIPYLDEDFFKEVTGMSWPGPAGLLNRLTRGK
FT                   WPPVDIVETAGEIIVTVALPGLRQAGDVRVELNGNILRLEGEIYPEIQLLPVVKVHQQE
FT                   KKQGRFSRSVTLPVAVNSKSARATYQRGLLEIRFIKHPGSQGETLNIEFFK"
FT   gene            474254..475309
FT                   /pseudo
FT                   /locus_tag="Moth_0472"
FT   gene            475451..476380
FT                   /locus_tag="Moth_0473"
FT   CDS_pept        475451..476380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0473"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18803"
FT                   /db_xref="GOA:Q2RL86"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL86"
FT                   /protein_id="ABC18803.1"
FT                   /translation="MLSKGKWLAILVIALVAVLAVAGCGKKEFPAPQQGSSQQNSNQQS
FT                   GGSGAITAAGSTALQPLVDEAAKQYMEKNPGVRIVVNGGGSGNGLSQVFQGAVQIGNSD
FT                   IFAEEKDGIDASQLVDHKVAVVGMAAVVNPDVKVDNLTQQQLIDIFTGKITNWKDVGGP
FT                   DQKINIVNRPKGSGTRATFKKYALNGAEEAQGIAMEQDASGTVRKTIAETPGAIGYLAL
FT                   SYIDSSVRPLKIDGVEPTAANIVDNKYKVWAYEHMYTKGQPTGEVKKFLDFIMSDEVQK
FT                   NLVTKMGYIPVTDMKVERDAQGNVTPKK"
FT   sig_peptide     475451..475612
FT                   /locus_tag="Moth_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.458 at
FT                   residue 54"
FT   gene            477483..478286
FT                   /locus_tag="Moth_0474"
FT   CDS_pept        477483..478286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0474"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18804"
FT                   /db_xref="GOA:Q2RL85"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL85"
FT                   /protein_id="ABC18804.1"
FT                   /translation="MMLGKEIRLSRLLDSESKRFVGITVDHAMARGVLPGLVNIKETVR
FT                   KIILGKPNALTMHKGIAEKVFPPYAGKVPLILKSTTFSPYHPKYDTPVADVEEALRLGA
FT                   DAISVGVIVGGPEQAEQITHLAQISKEASAMGLPLIAHIYPRGSEVKDPKNADAVSYAV
FT                   RVGAELGVDIVKTNWTGSAESFAKVVAACPSRVVIAGGSSGNDLSSYLQMIWEGIQVGM
FT                   AGVTCGRFVWEDSNPAAVIEAIKAIVHSGASVEKALEIYRECKER"
FT   gene            478293..479330
FT                   /locus_tag="Moth_0475"
FT   CDS_pept        478293..479330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0475"
FT                   /product="Alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18805"
FT                   /db_xref="GOA:Q2RL84"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL84"
FT                   /protein_id="ABC18805.1"
FT                   /translation="MKALVFEGPNELKLRDVPLPEPGEDEILVKVAACLICGTDLRIFR
FT                   GAKTRGVRIPSILGHEFAGVVEATGVNVKEFHVGDRVGVAPVIPCHTCFYCKNGLENVC
FT                   ANRTALGYEYEGAFAEYVCIPAPAVKGGNVYHLPSNISLEEAALAEPLACCLNGHHNSK
FT                   VKLGDVVVILGAGPIGLMHLQLAKSSGASYVIISEPNEHRRAIAKEFGADRVVDPQTED
FT                   LNSIVKNVTDGLGADIIFLAIGIPALAQDALTLVKKGGTINFFAGFSVGDKAALDVNLI
FT                   HYNEIKITGTSAARRDDYRKALDLIAKGKVKASKMITHRFPLDKAEEAFRIAGSSQGIK
FT                   VAIIP"
FT   gene            479327..480826
FT                   /locus_tag="Moth_0476"
FT   CDS_pept        479327..480826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0476"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18806"
FT                   /db_xref="GOA:Q2RL83"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL83"
FT                   /protein_id="ABC18806.1"
FT                   /translation="MKKPLLIGIDAGTSSVKICIFNINGELVRQGEVKIAFSSPRPGWI
FT                   ELDLKQYWDATCRVLREITTDLTGFAGLGFSVTSPTTVFLDDEGLPVRPAIPYLDIRSK
FT                   EDVEELVKYWGGEEDFQSHVGNKPIPSTYSAGIVRWIMREENNSWNRTKKVGFLNTFLC
FT                   GQLKGEWAVDPTVASFSGLVRLAEPFKWSDELRELLGIPSSKLLTILTPYTKIGEVTPQ
FT                   AAKETGLPTGLPVALGCADTAAASFALGLSQKGDCFESAGTSDVLTFCLDRPDFNSMFL
FT                   NRSHVYPGRWLAHGAMSTPGAAIEWLITNVFPELGTVSELEKEAERSEPGARGLIFLPY
FT                   LAGERSPIFDPNAKGLWLGLRLDTRRADIIRAVYEGIAFGLRQILKYAEAQWDLKIKSL
FT                   PCVGGAAKSQLGLKIKADVLGLEYQTTDFQHVAALGAALLGGIAGGVYMGWEDPEIPYL
FT                   KKFNSCFKPNFTNYKIYDQLFTIYERLYPSTKEAMHALNVY"
FT   gene            481028..482353
FT                   /locus_tag="Moth_0477"
FT   CDS_pept        481028..482353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0477"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18807"
FT                   /db_xref="GOA:Q2RL82"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL82"
FT                   /protein_id="ABC18807.1"
FT                   /translation="MSQIVTETGKTLKKSTNYRWIVLLLIFVAYTINYADRSNIGVVLP
FT                   FIKKDFSLSNLEAGALASFFFLGYAISQIPAGFWFSKFSTRGLVSLSILGFSAFTYLIG
FT                   TALNATVMKWFRLGLGLAEGPTPVGMTTTINSWFPPKEKATATGVYIAATMFAPIIVPP
FT                   IGIWITLHFGWRYVFYLFAIPGIVMSLIWYLLVKSHPEESPFCSAAEVEYIRSESKVTS
FT                   KDNIQSNSLGWLDKLIRAKRVKLIDSNGKVFTSWNIWGDTLAYFMMVSVLYGLMTWIPS
FT                   YLVNTKGYSFMKMGFVASTPWIGGFLGSIIGGWLSDKVFLKRRKPTMIITALTTAIMMV
FT                   VIISLPQNVFAVSIGLFMTGFLLNIGWPAFTAYPMGVTNANSYPVAIALVNSGGNLGGF
FT                   FSPMIVGALLDAFKSYNAAFLYFGLCAIIGFILILTLDEPIS"
FT   gene            482799..483563
FT                   /locus_tag="Moth_0478"
FT   CDS_pept        482799..483563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0478"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18808"
FT                   /db_xref="GOA:Q2RL81"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL81"
FT                   /protein_id="ABC18808.1"
FT                   /translation="MLAAQRREEIRNALQQKGWLSVTELAQIVGASPATVRRDLKELER
FT                   AGVLIRTRGGTCLADRLPEEMTEHVRAQKNSMEKKKIGQVAAKLVENAGSIILDAGTTT
FT                   LEVARALKPAQPLRVITDSVEIAYELRDRENIVVIVTGGVMRPHAYNLFGGMGEQMLAG
FT                   MHAQICVMGCSALSLEEGLTKHDIESMPIRRKMVEISRQLIAVVDSSKFGKTGLVSICP
FT                   VTRISTLITDSGIDPVFRSALESAGVQVIVAE"
FT   gene            483662..484786
FT                   /locus_tag="Moth_0479"
FT   CDS_pept        483662..484786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0479"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18809"
FT                   /db_xref="GOA:Q2RL80"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL80"
FT                   /protein_id="ABC18809.1"
FT                   /translation="MFRVLHLADLHLGYRPDLPAPVREEVYRARNRVLQAAVDLALDPR
FT                   QGISLVLIAGDLFDNHRPEASLVEETIRQLTRLEAAGIQVITVPGNHDEITYNDAVYRR
FT                   EAGRWPGLLVTDPMPAKVATLKVKGDTCHLMAMAYTGGVTRVDGPLKAFPPAEGEGVNL
FT                   AVFHGSLDWDGGERSLPLDGEALAAAGYDYIALGHIHRGGQRRLGRGLAVYAGMVAGKG
FT                   FADPGTGSWTIVTLGDGPARVEQVPARVTPWRLVDLDVTAFQEPEELETAVRDALDPGA
FT                   LMQVRLTGSLAFDLDLEGLQARLGHPCPYLELVNETAGWTPEILESIAAEPTIRGLFVR
FT                   RLQEKLAGSAGPGEAEVIRRAIFRGLLALKGGSR"
FT   gene            484786..488370
FT                   /locus_tag="Moth_0480"
FT   CDS_pept        484786..488370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18810"
FT                   /db_xref="GOA:Q2RL79"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL79"
FT                   /protein_id="ABC18810.1"
FT                   /translation="MPAVTWQRLRLAGFGCYREGVTVVFQEGLNVLVAPNEKGKSTLVA
FT                   GLEAVLFGLPNSGNPEAFGSARFANREEPDRFEGELEFLVDGRAYAVRRQFNNNRVTIR
FT                   TRGAHGWEEVWRGSHNPAAHKHNPVYNEHLASLLGMTSRELFEATFCLGQPLPEGRALS
FT                   SEVQKLLSGSGGHYQEALKMLADDLRALTRYCGDRGVGNNGRKDARLEELQAEIDSLRA
FT                   QQQATGSTIEELAAVRSRLQELTAEIKAVRVQLKKQQDLLAAWDGWRALQLRYKSALRE
FT                   QQQAGAVQERARELEEKICRHKELAARSYPEWAGAPAGSAGKLDRLAELEQEIARLKGE
FT                   AANWEAQLRDLNAEQEALTARLQGELAAVADHPDILRDLEDLQSLLKEREELEGQVREL
FT                   AARAAETAAELAALPDFSLLGNSPATVLEGLQVAARQLLEEWGRFQEQQNRYKELEAEL
FT                   AGDLSCFAGLLPEKETLLANYAATRLALEREEQAARDACRRLEEQKAAYRRREEEFRRE
FT                   FGDLEDLGGEAIQAATDKPRILEELQAREAARKAALAACRRRRLATALGLAGAGLVGGL
FT                   VTGLATGNWLLALATALVLAGLGYAAGSYLGRPGRDILDLTAAITTLQGRLAQLDAILG
FT                   PWAGATAAELGELRQRLRERDRVREELATLAASLPGTAEEEAARQALEAATRVRSDFHT
FT                   ATAAISARFSDVTAAYRRYLTTREEKRRLAAEMESFTIKAVGTPPPAALTVPLAGLGAP
FT                   WPGLASLARLAGQAPATVGELLTWLKELDHAAWEDFLARARRWEELTYLSRQVQEKREQ
FT                   LLKPDKEGRTALERLAKKIAALERHVAPFTAAIDPGAVAPLLEEAGRIKERLGELAGRR
FT                   QAAGSRVKDLREQIQELEPEAAGLREDLAAILAPGGGGAGKALERRQAYEQLAQEWQGW
FT                   QEQLAGLLGEGDLEDLATAYLDAANRTVAVLQEWQDLVREHPGLPEPGGETKGEELEEQ
FT                   YRALRAGIIETEGRLRGLEEEERQLLRRQSQLEGSQIANMAIVAETLAAREKELERLEL
FT                   EAGALALAYRELAAAARDYSQNYRRELARTASRYFNLFTGHRERQVDITEDFQVEVREA
FT                   GVVMALAQLSRGAQDQLYLSLRLAIGDLLSANLTLPFIFDDCFVNCDAARRERIRESLA
FT                   ALALERQLILLSHDPDFAAWGMPVKIEK"
FT   gene            488552..492007
FT                   /locus_tag="Moth_0481"
FT   CDS_pept        488552..492007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0481"
FT                   /product="ATP-dependent deoxyribonuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18811"
FT                   /db_xref="GOA:Q2RL78"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL78"
FT                   /protein_id="ABC18811.1"
FT                   /translation="MALRLVLGRAGSGKTRLCLEEIKAILAEGPAGPALIILTPEQATL
FT                   QMELDLHRAAGVPGFSRVQVLSFRRLGWRVFQEAGGAARPHLGEMGKAMALRAVVSAHR
FT                   DDLGLFAPLAGSPGFIEQLAHTIAELKLYRVTPADLDRILERYRETGREQTILARKLRD
FT                   LALVYRELETYLAGRYLDPDDYLTLLAGRLPEAAFIRGARVWVDGFNGFTPQEEAVLQA
FT                   LMAVAEQVTVTLCLDPTLRHRRLGETELFHPTGETYHRLRQLALAAGVRVEDDVCLAGT
FT                   PPRFREAPALAHLEAHFGRWPLRPFRGDAAGIRLVAAANRRVEVEAAAREILRLAREEN
FT                   LSWRQMAVLVRDLEPYHDLIVNTFRDFNIPLFIDRRRPVGHHPLVELVRAALEAVLEDW
FT                   AYDPVFRYLKSDLVPVPREEIDLLENYVLAHGIRGRRWRDSRPWQYGNSRDLETPSPPG
FT                   SAAGETINAIRERASCHLRRFDGALRGRQLTGREITAALFDLLQELGVPERLAAWSRQA
FT                   AAAGDLDAAQEHEQIWEGLMDLLEELVLALGDTSLELEEYAAILDTGLESLKLRLIPPA
FT                   LDQVVAGTLDRSRQPELQAAFVLGVGEGVLPARLPEDATFSDREREELRAAGLELAPTG
FT                   TLRLFHEEFLAYLALTRSRRYLWLSYPLADAEGKALSPSPLVRRLRQLLPGLREETAGT
FT                   ELPGGDDDLVYLTTPRQAAGHLARLLGRGRPLPPLWQEVYRWLHQDARGQKMLGLLEGG
FT                   GYRNQVDPLEPELARGLYPRPLRLSISQLETFAGCPFRYFLSYGLGLQERRLYQVDPAG
FT                   MGQFYHAALKLFVEELGRRGLDWGRLSDNEAAAIISQVVDSLAPALQHEILSSSARYGY
FT                   LRKKLEQTLQRVMEVLNEHARRGEFRPLAVETSFGCRGKLPPLQLDAGPGRRVFLEGRV
FT                   DRIDVARRQGRPYLRVIDYKSSPTTLDLTAVYYGLALQLPLYLRAALDAAPELLGEAAE
FT                   PAGMLYFAVRNPLIRQRGPVGKEAAARLRRQELKMRGLLLDDVEVIKLMDREIAASPDL
FT                   LPLRLNKDGSLRKGAPVAGREEMALLLDLALARAAELAGAILSGRVEISPYRRGQETAC
FT                   DFCPYRPVCAFDPQIPGSGYRRLGNLPGDFWQLAAAFLGSQMKG"
FT   gene            492017..496234
FT                   /locus_tag="Moth_0482"
FT   CDS_pept        492017..496234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0482"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18812"
FT                   /db_xref="GOA:Q2RL77"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL77"
FT                   /protein_id="ABC18812.1"
FT                   /translation="MTATGKREWTPDQLAAIRARRANILVAAAAGAGKTAVLVERIIQR
FT                   LTDPEDPVSLENLLVVTFTEAAAAEMRQRIGAALEAAVARDPENEALRRQLLLLNRAHI
FT                   STIHSFCLWVLRTYFYRLDLDPGFRVMDPAEVDLMQLEVMDRVLEEAFAAEPDGGPVTD
FT                   LADSLGGRGDANLVDLVLRVWEFSRSLPWPEAWLEQVTSSYKVTPETPLESLPWYGELR
FT                   QMITLELQEAAWYLEQARQAAAAPGGPAVYLDNLENEKEQVTRLLEEVGDLPWEELNAK
FT                   LAAVHFGRLKAARGEDVDPVLKERAGKLRNQARDLLYALKEDLCRDEAAVRAELERSGE
FT                   LVATLVGLVRRFDAALREAKGRRNLIDFSDLEHLCLRVLLDEGAGPGRLQPSDVALELR
FT                   QRFAEVLVDEYQDINTVQDAILALVSRQDVAENNLFMVGDVKQSIYRFRLANPDLFLAK
FT                   YRQYPEGEGGPNRRILLKANFRSRQGVVDGVNFIFRQVFSPLVGELEYDAAAALVGRAG
FT                   YPENPAAATPAVEVYLQEGKVAAGTGAGGRTDLPEAVGAGKGGKISGGAGYGETLSGYG
FT                   AASPGGETGAPDLEDLTALEREALLVARRIRRMVRGTPERPGPEFQVWDQEKKEYRDLT
FT                   YRDIVILLRATRDRAPVFLEALKQYGIPAYADLGSGYFAATEIETILSLLRVIDNPHQD
FT                   IPLAAVLRSPIVGLSAGDLARIRLAAPGEDFFTAVVKAAGAPLLPFTARESAAPSSTAT
FT                   GSGGALDNQPGQDPVCIAPYIEDTQEPWRDDHPGPGAAAGKAVPGKDRDLASLLREFLA
FT                   RLERWRTLARRQPLGDVIWQLYRETGYLEFVGGLPGGAQRQANLRALLDRARQFEGFAR
FT                   HGLFRFLRFIERLQQNEGDLGTARALGENEDVVRVMSIHRAKGLEFPVVIVAGLGKGFN
FT                   LRDLSGDFLLHGRLGLVPLYLDAAAGIKYPTLPYLATGHRLRLEALSEELRILYVALTR
FT                   AREKLILAGTVRDLPRQAENWCASLFLPGEQLPPVLTSRAGNPLDWLLPALARHPDAAA
FT                   IRDLAGVGGGHLLPDPSSWQVEVVRGGELPDRGSEEPGVQVRVTAGYQGTESAGQQENP
FT                   GLLCSGWPGGSRELAGAVTPVQETAGKTVAPPGSNIAEAGVEPGVSPPAGAVSPQDETG
FT                   PTWLQQEVARRLAWTYPRQPLTALPVKLTVTDLKRRFDVFNEGETPLRPGENTFTRRPA
FT                   FLQSHQGLTAAERGTATHLVLQHVDLSRPVTGESLAGLLQEMVEREILTPEQAAAVDIR
FT                   AIVTFFAAPLGKRLLARWEQVKRELPFSLAVPAVELYPGLPAEAAAGEIILVQGIIDCL
FT                   VEEEDGFLLLDFKTGRIPPDPLAAYREQVRFYTRAVETIFNRNVKEVHLYFLDGGVDFK
FT                   VTS"
FT   gene            496427..496648
FT                   /locus_tag="Moth_0483"
FT   CDS_pept        496427..496648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0483"
FT                   /product="Protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18813"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL76"
FT                   /protein_id="ABC18813.1"
FT                   /translation="MASHCFLVVIEQDEDGKYIASVPSLPGCHTQADNLAELEERVQEA
FT                   IKLYLNENSDFIPAPDKFIGIHQVEVQA"
FT   gene            496645..496881
FT                   /locus_tag="Moth_0484"
FT   CDS_pept        496645..496881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0484"
FT                   /product="YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18814"
FT                   /db_xref="GOA:Q2RL75"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL75"
FT                   /protein_id="ABC18814.1"
FT                   /translation="MRRLAIISAEDMERILIHLGFERKRQVGSHVMFAHPDGRCTVVPF
FT                   RKGEDLARSLIRKILRDVDISPEEYEKLRQEIL"
FT   gene            496976..497236
FT                   /locus_tag="Moth_0485"
FT   CDS_pept        496976..497236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18815"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL74"
FT                   /protein_id="ABC18815.1"
FT                   /translation="MDYIKQSVKQLVEKYKTNDPYRLEQDMGIDVDEFPFRRIKGKVAI
FT                   VLNSNLTEWLKRVVLVHELGHRQLSPQGAGYFFLAEHTLME"
FT   gene            497456..498271
FT                   /locus_tag="Moth_0486"
FT   CDS_pept        497456..498271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL73"
FT                   /protein_id="ABC18816.1"
FT                   /translation="MKSYLTRLIVIIMILGIVMYVAGCSSANTTSTSKATQEVLKNDKL
FT                   AELTTEPDKFKNYPVELTGKIFTAPEVKDGKTAFQMWGDPQKSEFNVVVYYNGTSNDIK
FT                   SDNYVKVKGTVKGKFEGSNAFGAKITAVAIMADAVEKVNPVDIIAPAKLKIDVNKAANQ
FT                   KGYSITLQKVEFADNETRVYLAVKNETNNKIYFWEHSAKALQNNKQLDVKMNFDYPRVQ
FT                   PEILPGVVSEGVVVFPALDINAKSATFVFEGSSDDFNIRINPMSFDVSW"
FT   sig_peptide     497456..497539
FT                   /locus_tag="Moth_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.589 at
FT                   residue 28"
FT   gene            498526..498768
FT                   /locus_tag="Moth_0487"
FT   CDS_pept        498526..498768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18817"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL72"
FT                   /protein_id="ABC18817.1"
FT                   /translation="MPCGIPLLDHLTQISSEYGIHPSILNYRNGSCRVLFLRRKMTGTL
FT                   KTKKDFQVRCRIVTNKDLICPGSPANLQGEASGRF"
FT   gene            498816..500273
FT                   /locus_tag="Moth_0488"
FT   CDS_pept        498816..500273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18818"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL71"
FT                   /protein_id="ABC18818.1"
FT                   /translation="MKLFEVIPERLFQVFSGRNRYIYAEALLLLYEQYRVNRFGIQYEV
FT                   MRDLMQELIESQEEAGLAFEVEEEQEQEPAASGLFNGDGEDQARLKAGVILRRLEKLKW
FT                   IQVEVRENFRHYIVLPHYASRLLAVFQELCENRTVEYQRFAFVTYQLLSGEEARQRPGF
FT                   AILEAQRMTQEFLEELRVLANNMKYHMEQVVAKTSIQEVLDHHFEEYKAHIIDRSYHRL
FT                   KTSDHVSRYRQRILATVQEWLLDPEWMARAVEDALRNEFFATREEAAEQLRRALMDIEE
FT                   IYRGLDEIFYQIDLRHNQYLRASFERARYLSQHSSGVDQYLARILEWMAAGIRRGDLPE
FT                   EDCLPGMFNLMRLNQLNEQSLYTPRRRRAPHRPEPQVVVAVPEELKRQLREQNLQRVRQ
FT                   AITREKVSAYVLGRLGERREMGIEELAPTNMEEFLYLLYVYLYGYDGLAGYRLVPRGAN
FT                   RILDIGGYRFYDRRVVRVDTGRKGRAV"
FT   gene            500366..500977
FT                   /locus_tag="Moth_0489"
FT   CDS_pept        500366..500977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18819"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL70"
FT                   /protein_id="ABC18819.1"
FT                   /translation="MLNLGENLSEQEAGRLREVINRLLAVNFLNKEQEREHYLVARRHR
FT                   QVLEEFFRFLGWEIVFDDRHECLFVLSPEAGCRRNLTRDESIWLLVLRLIYQEKRQGLS
FT                   LSEFPVTTLHEIRAKYEAFRLPLFNKTRLQELVRLGTQYKLLEPLNDDIRSDDCAFRLF
FT                   HTLLYAVQADTVEKLYQKIAAYEQGKEELPNEVDAPPAVD"
FT   gene            500946..504569
FT                   /locus_tag="Moth_0490"
FT   CDS_pept        500946..504569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0490"
FT                   /product="Chromosome segregation ATPases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18820"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL69"
FT                   /protein_id="ABC18820.1"
FT                   /translation="MKWMRRLRLINWHYFYDETLEFGRQTLIAGRNSAGKSTIIDALQV
FT                   LLVANQRQIRFNSAAHDEARRSLISYLRGKTGGEERKYLREGDFTSYIVAEFYDQQKRE
FT                   NFVVGVVMDVYGDDTIDDEYFILSGVELADLDFWSPAERWKNREEFHRYCQNLPGRHIF
FT                   ERSKTGYQKALLNRLGQVSERFFPVFVKALSFKPIQNVRDFVYQYILDEKELQLDLLRQ
FT                   NFEIHERYQAELEALEERREQLEAICRQFDTFARLRDTVAIQEYVIRGLKHTREVELRD
FT                   RLEEEIRFLTAEVERLGRELDLARAKQLEAGQKAREAYQKWQSHQARQREQELKEGLAR
FT                   VDKDLREQGRLLAILRQTLEREKALLAGLQEMEADEYWQWQPGERERLGRALELLSGLV
FT                   PAGDADWLPGEDTVAAVRDTGLFLAGLHSRCARAVGRLEDRLALLQQQKAELEGQIRDL
FT                   ENKKRPYPPHVLNLKRLLEERLNRRSPVWIFCEEMDLKDETWRDAVEGYLYTQRFDLLV
FT                   EPRVFAEALAIYEREKGKHQIEGVGLVDTEKEQKYLGTAQEGSLAEEMVTGNPVIQAHI
FT                   DHLLGRVMKARDEQDLRRYRTAITRTCMSYHNLVARQLEKHRYAVPYIGARAIARQLEI
FT                   KRRELAETKEQIEVLKDKREKLAAWLERLADKKSLYAGISEQLDLPARIRRLEEERAAL
FT                   AAELERLDLGEVERLKEEYYYWERRGKELLDEVTEISGLKKSRENELNQKQTELHLQET
FT                   RVQEAQAFWQSWREQYPVELLPRAEERWREAAGQELPVASKLINWENSQKGNTTRREQE
FT                   FQRLRDLRHEYNLRYTYNADPGAPDNEAYRPLLAEIATVDIPRYREKLAEALKQSEEEF
FT                   KSHFIFKLREAIEAARRDFNELNYALKNFPFHEDRYHFEIKPSERYRRFYDVIMDPGVM
FT                   EQGSLFELPEDDRTAVLHELFEKLIRGEAGELEEFTDYRNYLDFDIVVTSGEHRYSFSQ
FT                   VLREKSGGETQTPFYVAILASFNHLYDTGKTVRLVVFDEAFNKMDEERIQTSLRLIKRM
FT                   NLQLIAAVPDEKMQHMAPEVDTTLLVHRNGFHCFVDMISRQEVLAGDEVPTGDGQPAGP
FT                   GDTDGGRAGGHKEAGYGGTGGEDSGDAGDDADDAGNDGPPLNDAASLSRPAGGEDGHRG
FT                   QAGGSGGEDSGRPRRGGVRNGRDGQRPASAVPVQDSLFADQ"
FT   gene            504556..505833
FT                   /locus_tag="Moth_0491"
FT   CDS_pept        504556..505833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18821"
FT                   /db_xref="GOA:Q2RL68"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL68"
FT                   /protein_id="ABC18821.1"
FT                   /translation="MLISKYEGSRSFQTGTPGKQRPQFAMKKSPLAGDYFDEMDHRKRE
FT                   AIHAALAELAAAGVVEVTWPRFQEGRQVEKVYLNFDAIPRAYELAGLVPRAERICRLRQ
FT                   VLAPLATHPWEWVRRWWAGVDASLGERRSAGLDLEDPEGYGELVKVLLALPGLEDSTPE
FT                   RIFSQRVLGDSKAFEQRVKKRLLALLKSYGPEEYETDAEYLDSVGLTDNPKMVLVAGPM
FT                   TFRVGRTTVNVGGLPGGLGLAAHMVRAMEITAVTAPWVLLVENLTSYYQVVQSVSELAV
FT                   PCREGGGGRGLAVEGPAGLVVYTGGFPHRGVQLFLRRLQDYRESPGATARPPVYHWGDM
FT                   DYGGIRICEYIRRNLIPDLQPYLMDVTTYTRYLPAGIPFGDEYAARLRHLAEDPAYAPW
FT                   HPLLQAMLKHRKWVEQESIAINVSWA"
FT   gene            complement(507745..508035)
FT                   /locus_tag="Moth_0492"
FT   CDS_pept        complement(507745..508035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0492"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18822"
FT                   /db_xref="GOA:Q2RL67"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL67"
FT                   /protein_id="ABC18822.1"
FT                   /translation="MYILITYDVSTETEAGKKRLRKVAQVCKDFGQRVQKSVFECSVNE
FT                   AQFEQLKHRLLQCIDEKSDSLRIYRLREPAKKYIQEYGVNLTIDFDAPLVL"
FT   gene            complement(508068..509099)
FT                   /locus_tag="Moth_0493"
FT   CDS_pept        complement(508068..509099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0493"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18823"
FT                   /db_xref="GOA:Q2RL66"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL66"
FT                   /protein_id="ABC18823.1"
FT                   /translation="MHILLNTLYLMTPRTLVRLDHETVKIEVEGELKMQIPLHHLGSIV
FT                   CFGDVTLTTPLIMRCAEDKRLIVFHDQHGRFKARVEGPVSGNVFLRHAQHEALSDSKKT
FT                   TAIARNIVAGKIRNTRQVVLRGAREADNEDDRKALQETARELAHGLDALSRSPDLEQIR
FT                   GIEGNAARHYFATLDRMVRVNREAFKITHRNRRPPLDRMNALLSYIYALLLNDCLSAAE
FT                   GVGLDPQIGYLHVLRSGRPALALDLMEEFRAILADRLALTLVNRRQIDERDFVERPGGA
FT                   VHINDNARKEIAIAYQKRKQEEVLHPVLNRKVPLGLVPHIQARLLARVLRGDAEEYLPF
FT                   MYR"
FT   gene            complement(509171..509815)
FT                   /locus_tag="Moth_0494"
FT   CDS_pept        complement(509171..509815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0494"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18824"
FT                   /db_xref="GOA:Q2RL65"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL65"
FT                   /protein_id="ABC18824.1"
FT                   /translation="MESTILPGWDDRDIVMVSALEHYAYCPRQCALIHVEQTFTENMYT
FT                   LKGRFVHNLVDVECGEMEGGVHIERALPIWSLRLGLIGKADVVEFHGNIPYPVEYKHGP
FT                   KRKHQHDDLQVCAQAMCLEEMTGKQVPRGAIYHHSSHRRREVTFDSYLREQVEAAIIRI
FT                   RMMQRSNILPPPAADERCRECSLQDSCLPQIKEKGRLRMLLCELFKPEGDT"
FT   gene            complement(509899..510792)
FT                   /locus_tag="Moth_0495"
FT   CDS_pept        complement(509899..510792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0495"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18825"
FT                   /db_xref="GOA:Q2RL64"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL64"
FT                   /protein_id="ABC18825.1"
FT                   /translation="MTVYTNPEVRHDFVLLFDVRDGNPNGDPDAGNLPRLDPETMQGLV
FT                   TDVCLKRKIRDWVDMTRGSEANMKIYVQHHGILNAQHQRAYDAIGEKSTGSKQNREIVD
FT                   KARQWMCQNFYDIRMFGAVMTTGVNCGQVRGPMQLTFARSIDPIVPLDISITRVAITRV
FT                   EDAATSEQGEGGKVTEMGRKTLVPYGLYLGYGFFNPHFAADTGVSAADLEIFWEALQRM
FT                   WDVDRSASRGMMACRGLYIFSHASALGNAPADNLFKLITVKRRDGVKAARSFADYQVTI
FT                   NEEDLPPGVTLTRLVG"
FT   gene            complement(510885..512567)
FT                   /locus_tag="Moth_0496"
FT   CDS_pept        complement(510885..512567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0496"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18826"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL63"
FT                   /protein_id="ABC18826.1"
FT                   /translation="MLLESLREYSTRLDLPPVMYVKTPIRWFIDLDSQGNLLGFVSATG
FT                   PETRGKDRGKIMYAPNIVRSSGVKPKLLADKGDYVLGLASEKSKLERVNECHRAFIDLV
FT                   RQCAISTGNKSVQAVLRFLENWDPEGARLPEDFNPGDNLTFRVDGRLPIEDPDVQSFWA
FT                   DYTNPQEGEATTCLLCGQLKTPAERHPVKIKGIPGGQTAGMALVSANAAAFESYGLQAS
FT                   LIAPICYDCAERYGKAANALIENDATHLRLGSCIYLFWTRKPSNFSIASLLSNPQPEDV
FT                   KALLAAVYTGRQADLEDDNLFYATALSSSGGRVAVRDWLETTLGDVKRNLGHYFALQRL
FT                   VDAGGREGPPLGLFPLAWSTVREPKDLPPTTTRALLHFALKGGALPHWLLYEAIKRARA
FT                   EKDQEKITRSRAALIKMVLFSQKPNLAEGSALEKLDTSNRNPAYLCGRLLAVLEGIQWS
FT                   ALPGIKATIVDRFYGTASTAPAAVFSRLLRGSQSHLGKLRKEKPGLYYYWQQALESILG
FT                   NLSSFPPVLTLEEQGYFALGYYHQRAANREGTNSKEDGEETRP"
FT   gene            complement(512577..513278)
FT                   /locus_tag="Moth_0497"
FT   CDS_pept        complement(512577..513278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0497"
FT                   /product="CRISPR-associated protein, Csd5d family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18827"
FT                   /db_xref="GOA:Q2RL62"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL62"
FT                   /protein_id="ABC18827.1"
FT                   /translation="MKSLAGAGSSDQAGVEGWLAVKVWGDLACFTRPEMKVERVSYPVM
FT                   TPSAARGILEAIFWKPEFRWRVRQIEVLKPIRYFSILRNEVNDKMVVSTARGWARNGGG
FT                   YYADQPQHRAQRHTLALREVAYIIRAEQVMAAHARDIHPAKYRDQFRRRVERGQCYHRP
FT                   YLGCREFCAFFGPSSPADQPIKHSEYLGQMLLDLKYNSDGSGEGRPVFFNARLENGILR
FT                   VPQDLYKEIGR"
FT   gene            complement(513340..515514)
FT                   /locus_tag="Moth_0498"
FT   CDS_pept        complement(513340..515514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0498"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18828"
FT                   /db_xref="GOA:Q2RL61"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL61"
FT                   /protein_id="ABC18828.1"
FT                   /translation="MEQFLAHTANSQGKEQSLLDHLEAVANLTQKFNEPLGVPHIGYRT
FT                   GLWHDLGKFHPEFQAYLQGEGGRRGPNHSSAGAMLASKYFEPLAFVIAGHHGGLPARAE
FT                   LKTRLKDKVQLKRYNTALQNARRVIPSLEPKQPLDMELPPFLQEGAGVDVASRVELFLR
FT                   LLFSSLVDADFLDTERHFDPSLTKLRQKEASIANLWSLLAANQQRLMDKSGGHVNQIRR
FT                   EIYEHCCRAAELTPGFFSLTVPTGGGKTRSGMAFALLHALRYQKERIIVAIPYTSIIEQ
FT                   TADVYRDIFGNANVLEHHSAVAPPLDPENPTPEELWARLASENWDATLIVTTTVQLFES
FT                   LFSDRSSSCRKLHNIANSVIILDEVQTLPVHLLEPILDVLQQLVHFYGVTVILCSATQP
FT                   ALETSPFFRGLQGVREIIPDPQKYFALLKRVGYQVPAGNEKWSWEQVAGVIRQSRQAMA
FT                   VVNTKQDALALLEALDDPEALHLSTLLCGAHRRKVLQEVRRRLGNGRPCRLVATQVVEA
FT                   GVDLDFPLVLRAVGPLDRIVQAAGRCNREGKLQEGRVIIFNPEEGCLPPGSYKTGTEIA
FT                   ATLLASVTGVDLHDPGLYRIYFQRLYQSCTLDAKGIQASRRSLNYPEVAQKFQMIEQRV
FT                   VPVIVNYHEGPDDRRVDELISALRHRGVSRLIMRQLQPYLVNINAYTVNSLQREGVVQE
FT                   IFPGLYEWLGGYDEIRGLVTTARDPEELVF"
FT   gene            515720..516409
FT                   /locus_tag="Moth_0499"
FT   CDS_pept        515720..516409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18829"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL60"
FT                   /protein_id="ABC18829.1"
FT                   /translation="MATVLKRKSMGLANVSRQSLARIYFIHRWIAAGRYPNVAILAEHL
FT                   EVSQRTVERDIQLLRDFFGAPIVYDTWHRGYRYEKTFSLPPLQLTEGEFLTIYLGQRLL
FT                   SQFGGTPFGQILRNALAKLKAMLPETVSIDLECLERDISFGIEPLRGDTEQLVAVYGDL
FT                   LMAIQERHSVQIIYYTASRDAVTERLIDPYHLRFFRGAWYVIAYCHYRREIRFFALDRI
FT                   RQWSAGG"
FT   gene            complement(517103..518146)
FT                   /locus_tag="Moth_0500"
FT   CDS_pept        complement(517103..518146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0500"
FT                   /product="Peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18830"
FT                   /db_xref="GOA:Q2RL59"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL59"
FT                   /protein_id="ABC18830.1"
FT                   /translation="MKSINVNTVLAVMLSGLLIMAGGFGLARIYDNMHNQVVAEASKLG
FT                   PIEENHSESAKSQDLKSIIAENQKLVVCLEVELDYGKVQGSGFLYNRQGDVITNAHVVG
FT                   DARTCRVKLSDGTVYQGTVIGRGEQIDVALVRVPELAGKEPMKIARDRMAEVGDEVIAL
FT                   GSPLGLQNTATTGIISGVNRDLDIGDYHYKGLYQISAPISHGSSGGPLLDRHTGEVLGV
FT                   NSAGAEGENIGFSIPITQVLPLVENWSKNPSTAPVQPTTGTVGKISEKELATAASYLVE
FT                   DFYTCVNNGDYVGAYALLGSDWQAKQPYEKFRAGYLNTLSVSDAFLKPGRHSATPQLLD
FT                   WNASVAP"
FT   sig_peptide     complement(518063..518146)
FT                   /locus_tag="Moth_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.444 at
FT                   residue 28"
FT   gene            complement(518159..519379)
FT                   /locus_tag="Moth_0501"
FT   CDS_pept        complement(518159..519379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18831"
FT                   /db_xref="GOA:Q2RL58"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL58"
FT                   /protein_id="ABC18831.1"
FT                   /translation="MFCQYCGKKIEAGSRFCSGCGHELRSINNEDTVVLARPSLDQVKQ
FT                   EEGSEHTTTQQQVPAKGKSIWLLPLATAVLVAVVLGGYYAYEQYINRLVEQDRVQAENL
FT                   ALQGDLDKAEKLISNALNKRPRHKTLQADLAYVREGQEVQSELNEAWEHTKQQQFNQAL
FT                   SLIEQAEKKVSGKEGDFYKYLSQLINDKKAAVNIMQVKQEMNNKNSIEELAALLTKISS
FT                   FKVKEAQEVAKVIKTKICQLIYTKANELLKKKDFAGALALVQQGLGYDSENQQLLSFQK
FT                   TIEQQKAAFEQNEQMILEQAQLAAARENAINHTQAVEVLKCDGSVTAQGDFRVWGTVRN
FT                   VATRPIYMVEIYYTVYDAAGNALTTDSTYVYPNYLNPRDQGSFDNTSYGLWQGNRVKIN
FT                   RITWYLR"
FT   gene            complement(519708..521234)
FT                   /locus_tag="Moth_0502"
FT   CDS_pept        complement(519708..521234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0502"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18832"
FT                   /db_xref="GOA:Q2RL57"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL57"
FT                   /protein_id="ABC18832.1"
FT                   /translation="MISFALWGTALTGWVVAVVLWKRYSNAQADLKEFLDSLGQGDIVR
FT                   AEGFFRTHSFSMALGESTRMVLERFFEIIAFIQKVADELNYTASLFVQETVAGNTSFRE
FT                   MAAALQDIAGGADEQAHASQKTAENVGQFTNLAEEIASRSQMSFTLGKEALSKVQAGRE
FT                   LLEKLIDEMKNVASFNTEAATEMEDLEGKIARINEFVHTIDHLAGQTNLLSLNAAIEAA
FT                   RAGEQGRGFAVVAEEVRKLAEESAGAARHITELAEEIQARAGRAALQVKNSAELVNNNA
FT                   LRSKEVETAFEAIGRAVNQAAKASEEITRYTEQQLTHVKMANDNAARMAAVAEQTAASI
FT                   EQIYASSSEQQNAMARIEKNAREISQMADNFFKLASEYTRNCWDENLCQKLVRDGLDNL
FT                   RRLASTPEVQSMEVDKIKPLLDEAAATMPIVKTIRAVDPDGNTVYSQPPGKVTNWSFRP
FT                   WFQAAKRGQEYHTQPFITQGTGRLAITVAVPVHGGDAGIVGVLAANIAPA"
FT   gene            521514..522992
FT                   /locus_tag="Moth_0503"
FT   CDS_pept        521514..522992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0503"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18833"
FT                   /db_xref="GOA:Q2RL56"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL56"
FT                   /protein_id="ABC18833.1"
FT                   /translation="MLLWQLPQQHREFATHPALIFQDRRVTYGELVEWIGAYAGMFQAM
FT                   GVQPGERVTICAPNCPEFIYSYLGAIQAGAIVVPLNLMLTRDEIAYIVKDAGCSTLVIH
FT                   RAIVERLNLVPQMATALGLKHLVVLDETTAARAKAAPPATMVAAKEEDICVFLYTSGTT
FT                   GRPKGAMLSHRNFLADIKAMDAVSNLGPEDNFLCVLPMFHSFAWTTSVLLPLYLGSTIT
FT                   IKESFQPKDTLKTLSEGDITVFCGVPSIYAVLWRLAEEGQFKSLKFAISGGAPLAAEIQ
FT                   RGFETKFAFPLVEGYGLSEAAPVVCLNPLDGVRKPGSIGIPLPGMEVRLVDDDDREVPR
FT                   GEVGELVVRGPNVMAGYYNHPEETAAALRGGWLHTGDLARQDEDGYFYIVDRKKDLIIL
FT                   GGFNVYPREVEEVLLAHPAVLEAAVVGVGDPVKGETVKAYVVLKEGESADRRQLQDFLK
FT                   EHLALYKIPRLFEFVPELPKSPTGKVMKKLLKTR"
FT   gene            523112..523702
FT                   /locus_tag="Moth_0504"
FT   CDS_pept        523112..523702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0504"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18834"
FT                   /db_xref="GOA:Q2RL55"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL55"
FT                   /protein_id="ABC18834.1"
FT                   /translation="MVPVSVAPEAAALLERLRNHSMTTYQHSCNVGNLASALAEGLGMQ
FT                   QDEVNVITLGGLLHDIGKVRVRTSILHKAARLTPAEWEVMRRHPDFGVQILATLEKFDI
FT                   IEPLVAYHHERWDGKGYYGLEGHDIPLGARIIALADAFDAMTSSRAYQYSKNLQDGIQE
FT                   LATGAGKQFDPRLVELFFDIMPAVLKRNSRRAS"
FT   gene            complement(523889..524332)
FT                   /locus_tag="Moth_0505"
FT   CDS_pept        complement(523889..524332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18835"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL54"
FT                   /protein_id="ABC18835.1"
FT                   /translation="MSVRNIDLDKMQHFIDRCCKTESECGKCDRARCLVGFAQTALAYA
FT                   RQKNTTRIPRGHELVPQDDLRVYYQEDLINALAEVLHQCQNCRDNHEEECVINVTRRAL
FT                   ELALLGENFDYEGSASAYLMQVGRHNPEVGPKLLQAYQSRKNS"
FT   gene            complement(524367..525077)
FT                   /locus_tag="Moth_0506"
FT   CDS_pept        complement(524367..525077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0506"
FT                   /product="Nitrite and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18836"
FT                   /db_xref="GOA:Q2RL53"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL53"
FT                   /protein_id="ABC18836.1"
FT                   /translation="MGDAIFKQRSGYLGVGIVARCGILTPDQLAGLGDLARALDCQYCK
FT                   LTTRQTLIFIIPEDRLEDLRAGVTALGLQVGVFGEIVRNIKACAGNKDLCQRSLSDVFE
FT                   LGGVLQDRFMNRPTPCDFKIALAGCHRGCTDPQCADYGIIATGNDTYDVYLGGRGGSRK
FT                   PIHATRIATGITGKGVEDLLAWILERYDALAEPRERLCNTIARVGLEAFLPPEGFLEGY
FT                   RPREDNAFLTFAGL"
FT   gene            525513..526673
FT                   /locus_tag="Moth_0507"
FT   CDS_pept        525513..526673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0507"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18837"
FT                   /db_xref="GOA:Q2RL52"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL52"
FT                   /protein_id="ABC18837.1"
FT                   /translation="MGSTKLTKELKEWAAARGLVLGVAPVRPFERGRQALAWLARRGLA
FT                   TPFATGRPEERYRPDLLYPAARSLIVVARPHPQPVRPPGPGEGRIARYALGPDYHLELR
FT                   ASLEALAGMLQRAGARLTAVQVDNGPLLEREAAYLAGLGYYGASCNLIIPGLGTGCALG
FT                   LLITDLELEAGQPLTQATCRNCGRCLAACPTGALVAPGRLHPELCLSYLTQKRGVIPVE
FT                   LRPALGRHIWGCDACQEVCPENRAEFSPADQGASRAGPDGQWQGPGRDLPDGGTGTGLI
FT                   YPELATIITMDKAGFNRVFGGTALAWRGKTLLQRNAAIALGNLGDARALGPLQQALRAP
FT                   AAVLRGHAAWALGRLGPPARPALAVALATETDPWVRREIRTALDSC"
FT   gene            complement(526758..527492)
FT                   /locus_tag="Moth_0508"
FT   CDS_pept        complement(526758..527492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0508"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18838"
FT                   /db_xref="GOA:Q2RL51"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL51"
FT                   /protein_id="ABC18838.1"
FT                   /translation="MILGKHFTVESNGLLTFAAGVLAPEPDVRRLADALPVLYADVPPS
FT                   DRPLYYMYRGVCLENDRELYQQHDIRYDITVILPGTIGKEYIKTVGHFHPLKPHSSETY
FT                   PEYYEVLDGEAIYLFQKNNRSGDVEEVMAIEAKKGDKVFIPPAYGHVTINPGNKPLVMA
FT                   NLIESHFSSLYGPFREKRGAAYYYLEGEDSKGDFVKNPRYQNSVALKLVAAPSLTQPVS
FT                   AVKNKSLYEAFIAEPEAFKILK"
FT   gene            complement(527579..527992)
FT                   /locus_tag="Moth_0509"
FT   CDS_pept        complement(527579..527992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18839"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL50"
FT                   /protein_id="ABC18839.1"
FT                   /translation="MIIVASAKNIGEVMGVGYKYEFTWLIRLPVDELPQEPGEQKGDGE
FT                   NLLLWKRSSGNIILGFFRQGHKLAHPVGMEALIVTKSEEVLGYGRIVKSEIYELPDGSL
FT                   TTVVEFTITRLFDEEEKRVITKIFREMYGQKQV"
FT   gene            528115..530007
FT                   /locus_tag="Moth_0510"
FT   CDS_pept        528115..530007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0510"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18840"
FT                   /db_xref="GOA:Q2RL49"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL49"
FT                   /protein_id="ABC18840.1"
FT                   /translation="MEILQRLEKYRQEARKLHWEGTFAEYLKMVIANPKLARLAHARIY
FT                   DMIAGYGVEEIDGVKHYRFFEGEIFGLERTLEKLVEEYFHSAARRLDVRKRILLLMGPV
FT                   SGGKSTIVTMLKRGLEKYSQTDAGALYAIKGCPMHEEPLHLIPRELRPELQKEYGIYIE
FT                   GNLCPVCQLMVEEKYEGRVEEVPVERIILSEEKRVGIGTFSPSDPKSQDIAELTGSIDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLYNLLSLSQEGNFKAGRF
FT                   ALISADEMIIAHTNEAEYRAFISNPKNEALQSRIMVIPIPYNLKVREEVKIYQKLIRQS
FT                   DIDVHIAPYALQAAAIFSILSRLKESKKQGMDLLKKMKLYDGEDVEGFKQKDVLELMNE
FT                   AEAEGMSGVDPRYVINRISSALITADTRCINALDILRALKDGLDQHPSITREEKERLIN
FT                   FIAMARQEYDEYAKKEVQRAFVYSYEESARALFNNYLDNVEAFVNKTKVRDPITDEELD
FT                   PDEKLMRSIEEQIGVTENAKKSFREEILIRLSSYARKGKTFDFNSHERLREAIEKKLFA
FT                   DMKDIVKITTSTRTPDPEQLKRINAVIDRLISQHGYCPICANELLKYTGSLLNR"
FT   gene            530025..531188
FT                   /locus_tag="Moth_0511"
FT   CDS_pept        530025..531188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0511"
FT                   /product="Protein of unknown function DUF444"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18841"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL48"
FT                   /protein_id="ABC18841.1"
FT                   /translation="MPVEYNLSREDWSLHRKGYLDQQRHQEKVREAIKKNLPHIIAEES
FT                   IIMGRGKKVVRVPIRSLEEYHFRFNYNQGQHAGQGSGGTRKGTVIGREVIEGAGGGAGA
FT                   GDEPGMDYYEAEVTLEEVQEMLFRDLELPNLREKKKPVMASPAYEFRDVRRKGLMGNLD
FT                   KKRTLLENLKRNAMKGKLAIGGITPEDLRFKTWEEKIRYETSAVVLAMMDTSGSMGTYE
FT                   KYIARTFFFWMVRFLRSRYQQVELVFIAHHTQAREVTEEEFFAKGESGGTRCSSAYRLA
FT                   LEIIDRRYPPADYNIYPFHFTDGDNLPSDNEACLEAVQELLPRVNLLGYGEIVNPYYRT
FT                   STLMNVLKRIKDDRLVTVAVKDKSEVYQALRQFFAGSKGGEAGGTRI"
FT   gene            531172..532572
FT                   /locus_tag="Moth_0512"
FT   CDS_pept        531172..532572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0512"
FT                   /product="SpoVR"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18842"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL47"
FT                   /protein_id="ABC18842.1"
FT                   /translation="MEQEFKTIAQAIETIHDQARKFGLDFFPVYFELCPADVLYAFGAY
FT                   GMPTRFAHWTFGKHFYKMKLQYDFNLSRIYELVINSNPCYAFLLEGNDLIQNKLVIAHV
FT                   FAHSDFFKNNIYFTATSRQMVETMAVHAAKIREYEFKYGHREVEIFLDAVLAIQEHIEP
FT                   PGPFGYKEEENEENEDTRPHRRETPYDDLWILDGRPKEPPPERNRKIPPRPTKDMVGFI
FT                   MANSPELEDWQREVMAMIREEMQYFWPQMETKIINEGWAAYWHARIIRELDLTPAETVD
FT                   FARLHASVLQPGYRQINPYLVGSKIFEDIEKRWENPSQEERERYGRTGGEGRSKIFEVR
FT                   SCENDISFLRNYLTRELVEELDLYLYQKVGSEWVVVEKDWEKVRDGLVSRLINCGYPYI
FT                   VVEDADYQRRGELYLKHRYEGLELDVSYLEKTLPHVYLLWGRPVHLETIIDGKTTVFSY
FT                   DGKKNCRR"
FT   gene            532657..533955
FT                   /locus_tag="Moth_0513"
FT   CDS_pept        532657..533955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0513"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18843"
FT                   /db_xref="GOA:Q2RL46"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL46"
FT                   /protein_id="ABC18843.1"
FT                   /translation="MYWNERYECMPEAELQELQLERLQATVRRAFFDVPFYRRAFQEIG
FT                   LEPGDIKSLDDLQRLPFTTKQDLRDNYPYGMFAVPMSEIVRIHSSSGTTGKPTVVGYTR
FT                   HDIDVWSELMARALVCGGATRHDIIQNAYGYGLFTGGLGIHYGSERLGASVIPISGGNT
FT                   KRQVMIMKDYGSTVLTCTPSYALHIAEVMAEMGIKPEEIKLRCGIFGAEPWSESMRQEI
FT                   EKRLGISAVDIYGLSEVIGPGVGIECQEKNGLHIFADHFLIEIIDPVTGKQLPPGQRGE
FT                   LVITSLTKEALPVIRYRTRDITSLIPGPCPCGRTHPRVARFTGRTDDMLIIRGVNVFPS
FT                   QVESVLLEMGGTEPHYLLIVDRQGSLDTLEIKVEVSETLFSDKVRRLEDLEKRLRHELE
FT                   STLGISVKVTLVEPKSIQRSEGKAVRVIDKRKI"
FT   gene            533971..534402
FT                   /locus_tag="Moth_0514"
FT   CDS_pept        533971..534402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0514"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18844"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL45"
FT                   /protein_id="ABC18844.1"
FT                   /translation="MKIKQISVFLENKSGRLAAVTRLLAGHGINIRALSIADTSDFGIL
FT                   RLIVDDPDRAYTELKGAGFTVSLTEVLGVEMPDRPGGLSNILSILEENGINIEYLYAFI
FT                   GRGDNGALVIFRVEELDAAIDVLQARGITVLDGEKIYRL"
FT   gene            534374..535534
FT                   /locus_tag="Moth_0515"
FT   CDS_pept        534374..535534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0515"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18845"
FT                   /db_xref="GOA:Q2RL44"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL44"
FT                   /protein_id="ABC18845.1"
FT                   /translation="MMVRKSTASNRRLQDKGDEEPVATVPKCREAILSIKPYVPGKPIE
FT                   EVQRELGVKDVIKLASNENPLGPSPDAVQALQEASDRIFLYPDGNCYYLKEALAAKLGV
FT                   KQENLIIGNGTDEILKMLAETYINPGDEIVVADPTFSEYEFAAQVMGGRAIKVPTRNFR
FT                   HDLAAMAAAITPRTRLVFVCNPNNPTGTIVGQAALDGFLKQVPPSVLVVLDEAYSDYVT
FT                   AEHYPNSLAYVRAGRANVIILRTFSKIYGLAGLRVGYGVAVPEIIRDLNRVREPFNVNL
FT                   LAQVAAVAALKDEAHVGKSREVNSEGKDYLYSQFESLGLKYVPTEANFIFVDIQRDSRE
FT                   VFRQLLQKGVIVRTGDIFGYDTFLRVTIGTRRQNETFIRALREILA"
FT   gene            535612..536214
FT                   /locus_tag="Moth_0516"
FT   CDS_pept        535612..536214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0516"
FT                   /product="Spore germination protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18846"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL43"
FT                   /protein_id="ABC18846.1"
FT                   /translation="MRWRKYLAVVTGLLLMVVMVSGCGLTDRLRGDTQPQVKVQVPPPE
FT                   ASVPTPAPENKVGEPAKTTQVVLYFSDSSGNYLVAEKRSIPAVEGIARATIEELIKGPA
FT                   PDSKLLPTIPKGTVLKDINIRPDGLARVDFSKELVANHSGGSLGESLTVYSIVNTLTQF
FT                   PTIKQVQFLVDGQYVQTIAGHVDVSAAMSRNESLIKK"
FT   sig_peptide     535612..535707
FT                   /locus_tag="Moth_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.670 at
FT                   residue 32"
FT   gene            536384..538357
FT                   /locus_tag="Moth_0517"
FT   CDS_pept        536384..538357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0517"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18847"
FT                   /db_xref="GOA:Q2RL42"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL42"
FT                   /protein_id="ABC18847.1"
FT                   /translation="MVRRLTNGRWGLTLLILALMYIIALGLMARPAAADPGITLVLNGS
FT                   RVNPSVPAYTDSNGRTMVPVRFVMEHMGGRVEWLDAEQGIVVSRGATTLKMWIGKRQAQ
FT                   VNGQAIDLDTVPVLQDGTSMVPVRFVAQAFGGKVEWDDASRTVSIWLGTASPAGQVRIT
FT                   GSYVNVRTGPGTSYGVIDVLPRDTLVQLLATGDGWYQVQLPDGRQGWVSASYSEVLQGN
FT                   NQPQDTNPPGNNQPGNGQSPGNNPSPGNNQPGNEEPPSGQPLGTAIIGNKPVAILAGPN
FT                   PVEKQVGMAPAGSRLPIWQQQGDWWLVELDNGLRGWLASSLATFSPEKPGQDNGGSETG
FT                   NGGTAPGEGNQGVGNSDSNSLKITGVTVNPGPDWIEVTVQGTRPFTFKSSRWADHLIFD
FT                   IPGATLAVAPGQDKVEVNRQPLARVRLGQYDANTVRVVCDLNGAANFTTTTAGSTITIR
FT                   LQKPSVRGAKIVIDPGHGTDPQGSDPGAIGPSGVQEKDVNLAISRKLAELLRAAGATVY
FT                   MTRDGETTPYTLSGRAYYANEVGADLFICIHSNASLSPSASGTSTYFYAPPGTALGEQR
FT                   DARQRLATLIQRDLVAAIGRRDLGVKEANFAVLRNTKMPSVLVETAFISNPTEEQLLAS
FT                   PDFQALVAQGIFNGISDYLSGQ"
FT   sig_peptide     536384..536488
FT                   /locus_tag="Moth_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.943 at
FT                   residue 35"
FT   gene            538523..539353
FT                   /locus_tag="Moth_0518"
FT   CDS_pept        538523..539353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0518"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18848"
FT                   /db_xref="GOA:Q2RL41"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL41"
FT                   /protein_id="ABC18848.1"
FT                   /translation="MLPVQPVGVFDSGVGGLTVAREITRQLPAETIIYFGDTAHVPYGS
FT                   RPVDELIHFADTIVGFLIARGAKAIVDACNTTSAVALPYLQQKYSIPIIGVIEPGVEAA
FT                   LQATKNGRIGVIATEATIASDAHRRALLSRGKEVQVFTRACPPFVPLVEAGIVAGPRVE
FT                   GVVAECLESLLQAGIDTLILGCTHYPFLAPVIQDLAGPGVTLVDPAAATVRELKSVLAA
FT                   GGGLRGPHGSRAHEFYVSGDPRSFNEVGFKLIGWPELAGTRKLALDFREKGTPG"
FT   gene            539375..540127
FT                   /locus_tag="Moth_0519"
FT   CDS_pept        539375..540127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0519"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18849"
FT                   /db_xref="GOA:Q2RL40"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL40"
FT                   /protein_id="ABC18849.1"
FT                   /translation="MLRANGRGLRELRPVTIERHYLKYAEGSALITVGDTRVICSATVE
FT                   EKVPPFLKNTGKGWITAEYSLLPRSTKERTIREVTRGRLTGRTQEIQRLIGRSLRSVVD
FT                   MSLLGERTIWLDCDVLQADGGTRTAAITGSFVALAEALAGLVAAGGVPAMPLKDFLAAV
FT                   SVGLVDDELILDLDFQEDSHAGVDMNVVMTGSGQLVEVQGTAEGRPFTREQLTAMLDLA
FT                   GEGIESLIAIQKQVLGDIASRVGTGNDK"
FT   gene            540117..540722
FT                   /locus_tag="Moth_0520"
FT   CDS_pept        540117..540722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0520"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18850"
FT                   /db_xref="GOA:Q2RL39"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL39"
FT                   /protein_id="ABC18850.1"
FT                   /translation="MINKLVLATKNAGKAREFRELLQDLGVEIETLLDFPGFNLPPETG
FT                   STFVDNALFKARLTASMTGLPALGDDSGLEVDFLEGAPGVYSARFAGEPTDDRRNNAKL
FT                   LQLMEGVPWERRTARFRCVLALVTEDGDTHLAEGTLEGLIATEPRGHQGFGYDPLFYLP
FT                   EYDLTLAELGGEVKNKLSHRARAVKKMWPILRRLWPAK"
FT   gene            540866..540939
FT                   /locus_tag="Moth_R0025"
FT                   /note="tRNA-Gly1"
FT   tRNA            540866..540939
FT                   /locus_tag="Moth_R0025"
FT                   /product="tRNA-Gly"
FT   gene            540945..541021
FT                   /locus_tag="Moth_R0026"
FT                   /note="tRNA-Arg3"
FT   tRNA            540945..541021
FT                   /locus_tag="Moth_R0026"
FT                   /product="tRNA-Arg"
FT   gene            541034..541110
FT                   /locus_tag="Moth_R0027"
FT                   /note="tRNA-His1"
FT   tRNA            541034..541110
FT                   /locus_tag="Moth_R0027"
FT                   /product="tRNA-His"
FT   gene            541123..541198
FT                   /locus_tag="Moth_R0028"
FT                   /note="tRNA-Gln1"
FT   tRNA            541123..541198
FT                   /locus_tag="Moth_R0028"
FT                   /product="tRNA-Gln"
FT   gene            541206..541281
FT                   /locus_tag="Moth_R0029"
FT                   /note="tRNA-Lys1"
FT   tRNA            541206..541281
FT                   /locus_tag="Moth_R0029"
FT                   /product="tRNA-Lys"
FT   gene            541289..541373
FT                   /locus_tag="Moth_R0030"
FT                   /note="tRNA-Leu1"
FT   tRNA            541289..541373
FT                   /locus_tag="Moth_R0030"
FT                   /product="tRNA-Leu"
FT   gene            complement(541638..542510)
FT                   /locus_tag="Moth_0521"
FT   CDS_pept        complement(541638..542510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0521"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18851"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL38"
FT                   /protein_id="ABC18851.1"
FT                   /translation="MPTVKSLISEKLYTIDPLASVGRAAAIMERYGIGSLPVVEEGKLV
FT                   GIITSRDVRRFHPNRLVADAMTRKVITISPTASLTEAQKLMVKNKIERLVVTSESNIVG
FT                   IITYAQIMLELGKYTDSLTGLNKAEIFYEKALELLRRGQEIAIIFLDLDNFGGINKEYG
FT                   HIYGDNVLRQATIILKNLINMNEDTLCRYAGDEFAIVTTRSLAAAEKLARQIVTAFANE
FT                   NWPGKIKVTISAGVAGGRRSKIRECGKDSSYIVKNLVNMASLASTKAKRLKKPVVVVEA
FT                   VEFKETACM"
FT   gene            complement(542510..542872)
FT                   /locus_tag="Moth_0522"
FT   CDS_pept        complement(542510..542872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL37"
FT                   /protein_id="ABC18852.1"
FT                   /translation="MAQETSSSREPLRKADVNIKLSEFEIPPMQDILFVGKKAPIGPEA
FT                   VRRMVDAVSPEQYEIVRLNHETFEAVVVKKSLLRLLPKEKLLPVVIEESNRIADDKMVL
FT                   KAQINITIQVSRTVDL"
FT   gene            543193..544089
FT                   /locus_tag="Moth_0523"
FT   CDS_pept        543193..544089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0523"
FT                   /product="Copper amine oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18853"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL36"
FT                   /protein_id="ABC18853.1"
FT                   /translation="MKYKKLISMLAIASLLLPAGMAYARPGNGNSDHGAGKYVMASGTG
FT                   NNHEEDSQLGDELKDQERGEQGEANIEEENGLNEQEREAKGESQENDSHHSEQQLKKEV
FT                   RQREEIQVREEAQHAGLEKFQGRIRVKNKEINFDVPPVIKAGRTLIPVRAVTEGLGATV
FT                   NWDEATNAVTIAKNGVTVVLIPGSAEVTVNGTKINLDVPALLISNRTFVPLRFLSEVFK
FT                   EKVNYNDATGDIDVEEGEGEATSTTPATSPSTSPTATEVPAGTDTVSTAGNTASTTTTS
FT                   PPSIPAPTTTTSSIPAA"
FT   sig_peptide     543193..543267
FT                   /locus_tag="Moth_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            544656..545078
FT                   /locus_tag="Moth_0524"
FT   CDS_pept        544656..545078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0524"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18854"
FT                   /db_xref="GOA:Q2RL35"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL35"
FT                   /protein_id="ABC18854.1"
FT                   /translation="MLYLYLAVGGFCGAVGRYFLASFINRLWPGSFPLATWIINLGGCL
FT                   AMGFILTYTLERLVMGPELRLGLTTGMLGAFTTFSTFSVETLHLLQGEKIPLALLYLFA
FT                   SLAGGLICMQTGIFLARLPLSSKALSSIITREDGEE"
FT   gene            545078..545446
FT                   /locus_tag="Moth_0525"
FT   CDS_pept        545078..545446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0525"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18855"
FT                   /db_xref="GOA:Q2RL34"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL34"
FT                   /protein_id="ABC18855.1"
FT                   /translation="MAWLYVGCGGIAGTLARFLLSRWLGNRVRGTWPLGTLFVNLSGAF
FT                   LLGLLLALPQGRLPANVTLALGTGFVGAYTTFSTFTYETVTMIGDGEGKRALAYSLGSI
FT                   LGGLLLAWLGWLAAGSLF"
FT   gene            545462..545833
FT                   /locus_tag="Moth_0526"
FT   CDS_pept        545462..545833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0526"
FT                   /product="Protein of unknown function DUF190"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18856"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL33"
FT                   /protein_id="ABC18856.1"
FT                   /translation="MTGTRAKRLTVYLGEGMKWQGMALYHALVLELKAAGLAGVTVVRG
FT                   IEGYGKRKQLYASRLLELSADLPVLVEAVDSPEKINAVLPRVREMVQQGLITLADVEII
FT                   SSAGTASNKENSPGPGRRA"
FT   gene            545895..545969
FT                   /locus_tag="Moth_R0031"
FT                   /note="tRNA-Gly2"
FT   tRNA            545895..545969
FT                   /locus_tag="Moth_R0031"
FT                   /product="tRNA-Gly"
FT   gene            546155..547495
FT                   /locus_tag="Moth_0527"
FT   CDS_pept        546155..547495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0527"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18857"
FT                   /db_xref="GOA:Q2RL32"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL32"
FT                   /protein_id="ABC18857.1"
FT                   /translation="MKAAVEKLDKNQVLLEVEVEAPRVQKAIDQAYRRLVKQVNIPGFR
FT                   KGKAPRFILEQYIGKEPIYNEAAEIVIPPAYEEAVAEHQLEPIDRPEVEIVKVEDGEPL
FT                   VFKARVEVKPEVQLGPYTGLEVERQEVEVTEADIDAYLKRLQERYAELEVIEDEPAAAG
FT                   DIVTIDFKGTVDGQPYPGMEGNNYPLELGSGTFITGFEEQLVGARVNEERTVNVTFPSD
FT                   YHEKDLAGKEAVFQVTVRGIKRKKLAPLDDEFAKDVSECETLADLRQDIRRRLEESQKQ
FT                   RVEAAVRQAVVEKAVAAATVELPEVMVERRIDARIRELERNLQAQKMTLEEFLKNTDKT
FT                   IGDLEKEFRPGAERDVKTELVLEAIAKAENIQPSQEEIDAEIERMARIFRQDPDTVRKN
FT                   LGDLSVLKYDIMIKKTIDFLVEHSKPVPPREQGAAGETAETAEATPA"
FT   gene            547537..548136
FT                   /locus_tag="Moth_0528"
FT   CDS_pept        547537..548136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0528"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18858"
FT                   /db_xref="GOA:Q2RL31"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL31"
FT                   /protein_id="ABC18858.1"
FT                   /translation="MSVLVPMVVEQTSRGERAYDIYSRLLKDRIIFLGSAIDDHVANLV
FT                   IAQMLFLEAEDPDKDIHLYINSPGGSISAGMAIFDTMQYIRPDVSTICVGLAASMGAFL
FT                   LAAGAKGKRFALPNSEIMIHQPMGGTQGQAVDIEIHAKRILAIRDNLNRILSEITGKPL
FT                   EQIARDTDRDHFMTAREAREYGLIDEVITKRELPAK"
FT   gene            548157..549416
FT                   /locus_tag="Moth_0529"
FT   CDS_pept        548157..549416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0529"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18859"
FT                   /db_xref="GOA:Q2RL30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL30"
FT                   /protein_id="ABC18859.1"
FT                   /translation="MYKYTDDKGQLKCSFCGKLQDQVKKLVAGPGVYICDECIELCNEI
FT                   IEEELSEDLNLEMGELPKPKEIREILDQYVISQDQAKKALAVAVYNHYKRINLGMKMDD
FT                   VELQKSNIIMLGPTGSGKTLLAQTLAKILNVPFAIADATSLTEAGYVGEDVENILLKLI
FT                   QAADYDVEKAEKGIVYIDEIDKIARKSENPSITRDVSGEGVQQALLKILEGTIASVPPQ
FT                   GGRKHPHQEFIQLDTTNILFICGGAFDGLDKIIKNRISQKTMGFGAEIRGKNDVQVGDI
FT                   LKQVLPVDLLKYGLIPEFVGRLPVIVTLDALDETALIRVLTEPRNALVKQYQKLFEMDG
FT                   VTLEFKEDALVTIAREAIKRETGARGLRAILEEIMLDVMYEIPSRNNISKCIITKDVVL
FT                   RKEEPLLLTVERKKKKEETA"
FT   gene            549550..551268
FT                   /locus_tag="Moth_0530"
FT   CDS_pept        549550..551268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0530"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18860"
FT                   /db_xref="GOA:Q2RL29"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014251"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL29"
FT                   /protein_id="ABC18860.1"
FT                   /translation="MTEWGQGLGGVLGFVQIFFAVVIGLYFWNLLRNQQGSRVAVERES
FT                   RKELEKLQRMREISLTEPLAEKTRPSTFAEIIGQEEGLKALRAALCGPNPQHVIIYGPP
FT                   GVGKTAAARLVLEEAKANPLSPFKENAKFVEVDGATSRFDERGIADPLIGSVHDPIYQG
FT                   AGPMGMAGIPQPKPGAVTRAHGGILFIDEIGELHPIQINKLLKVLEDRKVILESAYYSS
FT                   EDTNIPSHIHDIFRNGLPADFRLVGATTRLPQEIPAAIRSRCQEIYFRPLLPHEIGLIV
FT                   QNAARKINLHIAPEAVEVIKQYATNGREAVNMVQLAAGLALTDRRQEITRADIEWVVTS
FT                   GQYTPRMDSKVPPEPQVGVVNALAVYGPNMGLVVELEASVNFVGHRRGQVIVTGVVEEE
FT                   ETGSGDGRRVRRRSMARNAVDNVQTVLRRLLQVDLRDYDIHLNFPGGVPVDGPSAGVSM
FT                   LTAVYSALTETPVNNLVAMTGEVAIRGGVRPVGGVVAKVEAARLAGAKKVLIPRDNWQE
FT                   IFRSLPGIQVIPVQNVNEVLAEALLPPAQVASPERFKARPQILSAAPNIGRPVGC"
FT   gene            551366..553672
FT                   /locus_tag="Moth_0531"
FT   CDS_pept        551366..553672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0531"
FT                   /product="ATP-dependent proteinase, Serine peptidase,
FT                   MEROPS family S16"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18861"
FT                   /db_xref="GOA:Q2RL28"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL28"
FT                   /protein_id="ABC18861.1"
FT                   /translation="MRRALPLLPLRGVIVFPYTVIHLDIGRERSVSAIEAAMLGDRVIF
FT                   LAMQKEAQDDDPGEDDIYTTGTIAEIKQLLKLPGGTIRILVEGIRRGEIKEYISHDPFL
FT                   KVEVEEAPEPAETSPEIEALMRCLIDEFETYVKMAKKIPPETVVAVVSLEEPGRLADVV
FT                   ASHLNLKLTDKQAVLEAVDIKTRLNILCDILAKEKEILELERKISLRVRKQMEKAQKEY
FT                   YLREQIKAIQKELGEKDDRVAEAEELRERIAKARLPKEIRERALKEVERLEKMPPMVAE
FT                   VTVVRNYLDWILALPWHKQTRDRLDIKVAEEILDEDHYGLKEVKERILEYLAIRQLAKK
FT                   MRGPILCFVGPPGVGKTSLAKSIARALQRKFVRISLGGTRDEAEIRGHRRTYVGALPGR
FT                   IIQGMKQAGTKNPVFLLDEIDKLSSDFRGDPASALLEVLDPEQNYMFSDHYIEAPFDLS
FT                   KVMFITTANVEYSIPRPLLDRMEVIRIPGYTEEEKVKIAELHLLPKQLEEHGLKKQQLE
FT                   VSENALRRIVREYTREAGVRNLEREIATICRKTARDIVSGKTKAVKVTANNVEQYLGIP
FT                   RFHHTQAIRNEMVGVVNGLAWTEVGGEVLNVEVSILKGKGNLTLTGKLGDVMKESAYAG
FT                   FSYLRSRAAELGLEEDFHEKFDLHIHVPEGAIPKDGPSAGITMATAMASALKGVPVRSD
FT                   LAMTGEITLRGRVLPVGGIKEKILAAHREGIKNIILPRENEKNLEDIPANIKRKMNFIL
FT                   VEHMDEVLKEALGNN"
FT   gene            553821..556463
FT                   /locus_tag="Moth_0532"
FT   CDS_pept        553821..556463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0532"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18862"
FT                   /db_xref="GOA:Q2RL27"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL27"
FT                   /protein_id="ABC18862.1"
FT                   /translation="MAILDKVYNPKAVEEKWYHYWSENGYFRGHLPAKGQPAFSIVMPP
FT                   PNVTGSLHLGHALDNTLQDILTRWHRMRGDATLWIPGTDHAGIATQARVEEELAKEGLS
FT                   KYDLGRDRFLERVWEWKHQYGDRITRQLRLLGSSCDWSRERFTMDEGCSRAVREVFVRL
FT                   YEKGLIYRGSYIINWCPRCRTTISDIEVEHIEEAGHLWYIRYPFKDGSGSIVIATTRPE
FT                   TMLGDTAVAVNPSDERYRDVVGKTLVLPLINREIPVIADEYVDPAFGTGAVKITPAHDP
FT                   NDFEVAARHNLPSITVIGKDAVMTEEAGPYAGMERYACRGQLVDDLKAQGFLVKVEEHT
FT                   HAVGHCYRCGTTIEPLVSPQWFVRMAPLAEPAIQAAKEGRVRFVPERFTKIYLNWLENI
FT                   RDWCISRQLWWGHRIPVWYCQQCGEEICSREDPEECPACGSTALEQDPDVLDTWFSSAL
FT                   WPFSTLGWPDRTPELEAFYPTSVLVTGRDIIFFWVARMLFMGLEFMGEVPFREVLIHGL
FT                   VLDAQGRKMSKSLGNGVDPMEVIEKYGADTLRLMLVTGNTPGNDLRFHPERLEGTRNFA
FT                   NKIWNAARFALMNLEDYEPAPLERENLTLADRWILSRLNKLVLEVNACLEAYEIGEVAR
FT                   MLYEFFWGEFCDWYIELIKPRLYGENRRERQVAQEVLVTVLGKSLQLLHPFMPFITEEI
FT                   WQHLPGERGSIMLSSWPRPVPQDEDEQAETAMGLVMAVIRAVRTLRSEMNVPPGRRAEV
FT                   ILVSGSPEDREILQRESVYLENLAAADRVQVVAALDRPPSRAATAVTSGVQIFLPLAGL
FT                   IDLEKEQARLEKELQKARAELEKVEKKLARPDFRAKAPAAIVAKEEARAAELKSTITAL
FT                   TKRLSYLGS"
FT   gene            556475..557797
FT                   /locus_tag="Moth_0533"
FT   CDS_pept        556475..557797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0533"
FT                   /product="FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18863"
FT                   /db_xref="GOA:Q2RL26"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL26"
FT                   /protein_id="ABC18863.1"
FT                   /translation="MNYQEALEFLRQLTKFGFNLGLGRIKELMRRVGSPQERLRFIHIG
FT                   GTNGKGSVSAMVASILKAAGYRVGLFTSPHLHSYTERIQINGQNIPEERLAALLTWFKP
FT                   LLTAMVADGYEHPTEFEVGTAVALKYFADEGVDLVVLEVGLGGAIDSTNVINTSLVSVI
FT                   TNVGMDHMQYLGNTIAEIARVKAGIIKPGGIVVTASRLPEALEVISTTCREKGATLYQV
FT                   GRDVTWRERRVSLAGGEFDCRGLLATYEGLKVHLLGRHQLENAATAVAVIEAAVRHHGL
FT                   KVTPDHLRQGLAAATWPARLEIIQREPMVIIDGAHNFDGAVSLRLALEEIFRYRRLILV
FT                   LGMLADKEREKVVAVLAPLAAAVIVTRPNNPRAGNWQSLADSVRRYVGVVEVIEAIPAA
FT                   VERALALAEPSDLICVTGSLYMVADAREWLKKFKKEESPGG"
FT   gene            557846..558493
FT                   /locus_tag="Moth_0534"
FT   CDS_pept        557846..558493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0534"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18864"
FT                   /db_xref="GOA:Q2RL25"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL25"
FT                   /protein_id="ABC18864.1"
FT                   /translation="MKTLKIPEATITQLSVYSRYLAQVDRHGVTTISSGEIAEGVGVSP
FT                   AQVRKDLAYFGEFGTRGVGYNVKDLYWHIIKILGLNTTWSVVIIGAGNLGTALSMYGGF
FT                   RERGFKIVGIFDNAPHKIGYRLNGVEVYPMERLEEIIEREKAQIAIITVPAEHAQEVAD
FT                   QLARTSIQGILNFAPRVLNVPDHIELRNVDLSVNLEILTFNLAFRRAMKNGK"
FT   gene            558516..559100
FT                   /locus_tag="Moth_0535"
FT   CDS_pept        558516..559100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0535"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18865"
FT                   /db_xref="GOA:Q2RL24"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL24"
FT                   /protein_id="ABC18865.1"
FT                   /translation="MSKLVLASASPRRRELLARLGLPFTIQPSRIDESVYRHLPPAARV
FT                   EALALAKARAVAAGLTDALVLGADTLVVCEGRVLGKPDSPAAAARMLAFLSGRTHTVYT
FT                   GVAVVQAPRGPEGVTHARTAVTFRHLTPDQIEAYVATGEPLDKAGAYGIQGRGALLVAG
FT                   IEGDYFNVVGLPLVQVEELLAIFGVDVWGRV"
FT   gene            559101..559790
FT                   /locus_tag="Moth_0536"
FT   CDS_pept        559101..559790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0536"
FT                   /product="DNA replication and repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18866"
FT                   /db_xref="GOA:Q2RL23"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL23"
FT                   /protein_id="ABC18866.1"
FT                   /translation="MTGGQGVTIKELPAELRPRERLLAAGVQALSNAELLAILLRTGTR
FT                   TESALDVARRLLSGPDGLQFLAGATLEELQQQKGIGLAKAAELKAALELGRRLAAFTLS
FT                   RTVIRNPRDVAGLLLDEMRYLDRENFRTVSLNTKNQVLGIDNVSVGSLNSSLAHPREVF
FT                   KDPIRRSAAAIILAHNHPSGDPTPSQEDIMVTRRLVEAGHILGIEVLDHLIIGDGRFTS
FT                   LKERNLL"
FT   gene            559915..560955
FT                   /locus_tag="Moth_0537"
FT   CDS_pept        559915..560955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0537"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18867"
FT                   /db_xref="GOA:Q2RL22"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL22"
FT                   /protein_id="ABC18867.1"
FT                   /translation="MIFARDLGIDLGTANTLVHVRNKGIILREPSVVAIQRGTGNVMAV
FT                   GEEAKRMIGRTPGNIVAIRPLKDGVIADFDVTQSMLRYFIEKAIPKGFLVRPRVVVGVP
FT                   SGVTAVEERAVREAALQAGAKEAYLIEEPMAAAIGAGLPVYEPTGNMIVDIGGGTTEVA
FT                   VISLGGIVTSRSIRIGGDEMDEAITQYIKRTYNLMIGERTAEEIKIELGAAYFGDTDED
FT                   RERQQRTYAVRGRDLVTGLPKTIEITATEVQEALSEPVAAILEAIKVCLERTPPELAAD
FT                   LMDRGIVLAGGGSLLWGLDRLVSQETGMPVNMAEDPLTAVAIGTGKVLENIEVLKRVLL
FT                   PARRSG"
FT   gene            560971..561885
FT                   /locus_tag="Moth_0538"
FT   CDS_pept        560971..561885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0538"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18868"
FT                   /db_xref="GOA:Q2RL21"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL21"
FT                   /protein_id="ABC18868.1"
FT                   /translation="MSRRWRKLVAPLILVLAAAGLVVVMRWSAQERSHLTILEGSLRDV
FT                   LAPAERGITLVVSKGTGLLAAIKDYGRLQAENQALKQQVADLKAATVQMEEYRQENSRL
FT                   RALLNYKTTYQQAFDFVVAPVIARNPNNWYHTLILGLGSRDGLQKDQVVVTSQGVVGRI
FT                   IAVTPRTAEVLLILDREGAIGGMIQANRTPGIVEGSPDYRGYLQMVHVPRDAQIMPNQV
FT                   VITSGLGGVFPRGLLLGTVIKTLPEPDGLTQRAIIAPAVDFDRLEEVLVITRIKGGIND
FT                   AVSGVTGAGAGGTGPGSNPATGP"
FT   sig_peptide     560971..561057
FT                   /locus_tag="Moth_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.798 at
FT                   residue 29"
FT   gene            561812..562321
FT                   /locus_tag="Moth_0539"
FT   CDS_pept        561812..562321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18869"
FT                   /db_xref="GOA:Q2RL20"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR017225"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL20"
FT                   /protein_id="ABC18869.1"
FT                   /translation="MQFLGLLALGLGGLVLEATLLPALKLAGVKADLLTIVLTIYALFQ
FT                   GPSRGAVLGFGYGLLEDLYLGRYVGLNALSKMLTGYIIGLGKDRLNQDNWLVPGIMAFF
FT                   AIICQGLLVLFLTLLAGFRFPLLAGLEAVILPMSFYNACLALLGYNLYQGGIKWATRKR
FT                   RIGSPG"
FT   gene            562282..564351
FT                   /locus_tag="Moth_0540"
FT   CDS_pept        562282..564351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0540"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18870"
FT                   /db_xref="GOA:Q2RL19"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL19"
FT                   /protein_id="ABC18870.1"
FT                   /translation="MGNQEKENWKPRLNQRLKGFLAAIIFIFLLLSSRLFFLQIVNAQE
FT                   FSKQSAENRIRINPIEARRGDILARGGEVLATSQVVYVITIRTMPNQDLDTVINNLANL
FT                   LGDPELTPAAIKDLIKKNPYRYEPTEIKRIPANDPAAAALIARLEEHREEVPGVNIIEE
FT                   PQRYYPNGPLAGHVLGYVGQITQEELDAHKEDNYSPNDKIGKSGIESFLEYSNVNGQEI
FT                   GLRGKNGAEQVEVDALNRKVRDLVTLPPTPGDTVQLTIDFKLQQTLEKAMDQVIASTKK
FT                   INPKAGGGAAVVLNVKTGAILALASKPDIDPNDFVNGNYAKKASYYNDPQLRPMFNRAI
FT                   QGVYAPGSIFKPITAMAALDAGVVKPSDTIYDAGRYWKPGGITCWVPSGHGNVDLNRAM
FT                   AVSCNTYFQWAGDLAGIGKIDDVGRQFGLGQPTGIIGLQGEARGVLPSPEWKKEINAPI
FT                   WDRWLKNKEAEIEKKYAGLLAAASPEEKDKLLQQKENELKAVRAKYQINYNFDTAWQPY
FT                   NTYNTSMGQGDNSYTVIQLANYIATLANGGTRWRPYLIEKVIGADGSLKKEYQPQVAGR
FT                   VTVSQQAMAEVRRAMLEATQSREGTASFLFSDFPPNIKVGAKTGTAQSGPGGELNGTFV
FT                   AFAPYDDPQIALAVVIEHAKHGGDSAGVVAREVLAQYFNLPDILNKPFNGVSVE"
FT   sig_peptide     562282..562413
FT                   /locus_tag="Moth_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.838 at
FT                   residue 44"
FT   gene            564499..564948
FT                   /locus_tag="Moth_0541"
FT   CDS_pept        564499..564948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0541"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18871"
FT                   /db_xref="GOA:Q2RL18"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL18"
FT                   /protein_id="ABC18871.1"
FT                   /translation="MLSANEGETSAGISQGAIPSGTRAQPGKDNHTFLVCRTVRSGQVI
FT                   KYPGNVVVMGDVHPGGEVVATGHVIIMGTLKGVVHAGAEGNEKAVVLAFHLQPTQLRIA
FT                   GYIGRAPDDGDNTGTGGPEMARVQDDTVVIEKYQPGNEKRWLTQS"
FT   gene            564970..565761
FT                   /locus_tag="Moth_0542"
FT   CDS_pept        564970..565761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0542"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18872"
FT                   /db_xref="GOA:Q2RL17"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL17"
FT                   /protein_id="ABC18872.1"
FT                   /translation="MGEVIVITSGKGGVGKTTTTANLGTGLASLGKKVVLVDTDIGLRN
FT                   LDVVMGLENRIVYDLIDVVEGRCRLKQALIKDKRLENLYLLPANQTRDKTAVSRQQMID
FT                   LTSQLREEFEFVLIDCPAGIEMGFKNAIAGAEKALVVTTPEVAAVRDADRIIGLLEAAE
FT                   MEPPRLIINRLRPDMVRKGDMMDIEDMLEILAIDLIGVVPEDQYIVISTNRGEPAILDK
FT                   HSRAGQAYRNISRRLLGEEIPFINWESGGFMSRIKKLMGLG"
FT   gene            565780..566076
FT                   /locus_tag="Moth_0543"
FT   CDS_pept        565780..566076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0543"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18873"
FT                   /db_xref="GOA:Q2RL16"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL16"
FT                   /protein_id="ABC18873.1"
FT                   /translation="MLEFLLRFFGRDTASSKKVAKERLRLVLVHDRAGVSPHLLESLKN
FT                   DLIKVISEYLDIDTDGLEVSLTHENDAVALVANIPILRVKRTFKSVQEPAFKV"
FT   gene            566191..567327
FT                   /locus_tag="Moth_0544"
FT   CDS_pept        566191..567327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0544"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18874"
FT                   /db_xref="GOA:Q2RL15"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL15"
FT                   /protein_id="ABC18874.1"
FT                   /translation="MFERRLWRNLDYYFVGGVIALLAIGLVVLNSASANVMPDPYYFVK
FT                   KQLIWILFGLVGLVAVLSIDYEQLKHYHLPLYVLNIIMLAAVALVGHEAKGAQRWINLG
FT                   FFLLQPSEFAKTITVITLACFLDKRQGKLNCWQDLVVPFLYVAVPLVLILKQPDLGTAL
FT                   VLLAILFGMLYVSGANWKLLLMIFGGGLLLTGLALFAHFHFGLPLPLQDYQMRRLVVFL
FT                   NPYNDGKGGTGEGYHVIQSQIAIGSGGWWGVGLHQGSQVQLNFLPEAHTDFIFSVVGEE
FT                   LGFVRTVGIIALYFLVLYRMIRIAGQAKDMFGALLVGGVASMFAFHILVNVGITTGIMP
FT                   VTGIPLPLFSYGGSAMLANMLALGLVLNVNLRRQKILF"
FT   sig_peptide     566191..566295
FT                   /locus_tag="Moth_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            567441..567725
FT                   /locus_tag="Moth_0545"
FT   CDS_pept        567441..567725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0545"
FT                   /product="Chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18875"
FT                   /db_xref="GOA:Q2RL14"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL14"
FT                   /protein_id="ABC18875.1"
FT                   /translation="MLKPLADRVVIKVLSSEEKTQGGIVLPDTAKEKPQEGEVIAVGPG
FT                   KILDNGTRVAPEVKKGDVVVFAKYSGTEVKYEGQEYLIIRDSDILAIKE"
FT   gene            567766..569385
FT                   /locus_tag="Moth_0546"
FT   CDS_pept        567766..569385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0546"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18876"
FT                   /db_xref="GOA:Q2RL13"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL13"
FT                   /protein_id="ABC18876.1"
FT                   /translation="MAAKQLAFDVEARRALEKGVSTVAQAVKVTLGPKGRNVVLERKFG
FT                   SPVITKDGVTVAKEIELKDPYENMGAQLCREVASKTNDVAGDGTTTATVLAQAIMLEGL
FT                   KNVAAGANPIFVKKGIDRAVETVVDEIKKISIPVESKESIAHVASIAANEREIGELIAD
FT                   AMEKVGKDGVITVEESKGTATTVEVVEGMEFDRGYVSPYFVTNTEAMEAEFEEPYILIH
FT                   EKKISAINDLLPLLEKVVRTGKPLVIIAEDIEGEALATLVVNKLRGTLNCAAVKAPGFG
FT                   DRRKAMMEDIAILTGGTFLSEDLGVKLENVDLNMLGRAKKVKIAKEKTTIVEGYGKKEA
FT                   VDGRIAQIKKQIEETDSDYDREKLQERLAKLAGGVAVIRVGAATETELKEKKHRVEDAL
FT                   AATRAAVEEGIVPGGGATLVHAIPAVEKIQAEGDEAVGVRIVRRALEEPLRQIAANAGL
FT                   EGSVIVERVRSEQPGIGFDAVKEEYVDMIKAGIVDPAKVTRSALQNAASIASMLLTTEA
FT                   IIAEIPKEEKAPAMPPGGGMDY"
FT   misc_binding    569533..569640
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059); Moth_R0032"
FT   gene            569739..570275
FT                   /locus_tag="Moth_0547"
FT   CDS_pept        569739..570275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0547"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18877"
FT                   /db_xref="GOA:Q2RL12"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL12"
FT                   /protein_id="ABC18877.1"
FT                   /translation="MAGADYFQLREKDLPAGELYNLAREIKRVLPSRVRLIINDRLDVA
FT                   MAAGADGVHLGEASLPTDVARRLLGPGKILGVSVHSVAAARQAAAAGADYLLFGHIFPT
FT                   ASKESLPPRGLVSLREVAASVGIPIFALGGITVDRVASCLAAGAGGVAVMSGVMAAADP
FT                   AGAVAAYRKALDMVG"
FT   gene            570409..571143
FT                   /locus_tag="Moth_0548"
FT   CDS_pept        570409..571143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0548"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18878"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL11"
FT                   /protein_id="ABC18878.1"
FT                   /translation="MRDNWDWEEIKGEPLGGWSGPARTLPPSRYPRRWLRQAVVAGLLW
FT                   LGITLLFRLEGPGVQQLQVGLRHYLADPTADYTAVVASAVRSGMWMDAYDRWVFHTLKN
FT                   PAAAVPTTANPSRVVMALPLSGQITRPYGRVEEDNQQYFHNGIDIRADGETAVRAALDG
FT                   RVVRVGEDPVLGLVVEIDHGQGLVTVYGTLGQVKVTRGQEVSRGTVIATLTAGKSARLH
FT                   FEVRQDGQAVDPAPYLGAQDKI"
FT   gene            571147..572028
FT                   /locus_tag="Moth_0549"
FT   CDS_pept        571147..572028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0549"
FT                   /product="Peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18879"
FT                   /db_xref="GOA:Q2RL10"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL10"
FT                   /protein_id="ABC18879.1"
FT                   /translation="MRVGRLGSTTLVLNDYFLLLMGLYFLLGVLPQALLLFAAVACHEG
FT                   CHALVASRLGWQVKSVELFPFGGVSRLYRPAGWRLREEAIIALSGPAASSLLAAAVTLA
FT                   VNYARPAPVWLLFFRQVNLILALFNLWPGLPLDGGRIYRALRARSHGLARATLEGSYGG
FT                   QLLAVFLGIGSIAGFYLHLVDLQGLVLALFIFYTARQEGEMAPYMFWQDFWRQRGIKKV
FT                   NPSRAGRVFWLVADPDLPLSRVIRSFAPDSFNLVAIVGRKGGLEGIVTETEILEELLSG
FT                   GSATTLTSLLKK"
FT   sig_peptide     571147..571263
FT                   /locus_tag="Moth_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.794) with cleavage site probability 0.766 at
FT                   residue 39"
FT   gene            572291..572635
FT                   /locus_tag="Moth_0550"
FT   CDS_pept        572291..572635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0550"
FT                   /product="nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18880"
FT                   /db_xref="GOA:Q2RL09"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL09"
FT                   /protein_id="ABC18880.1"
FT                   /translation="MPYPYGGAAFFISQAVLGFPGLTACKVLGRGKQKGILGEVTFNVS
FT                   PELQKQEGAMKYVPKRVISLVVADKDVPLVVAVLIKINRTGKVGDGRIFVCPVEEAVRI
FT                   RTGERGQAAL"
FT   gene            572664..574124
FT                   /locus_tag="Moth_0551"
FT   CDS_pept        572664..574124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0551"
FT                   /product="Nitrogenase component I, alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18881"
FT                   /db_xref="GOA:Q2RL08"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005974"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL08"
FT                   /protein_id="ABC18881.1"
FT                   /translation="MPMVKMKCDELIPERYKHIYYTEKGRSVIPACNIATIPGDMTERG
FT                   CAFAGARGVIGGPIADVIAMVHAPVGCAWYTWGTRRHLSDLYTWATPTRLTNVAFNRRY
FT                   CVCTDMQEKDVVFGGIKKLEQACLEAIRLFPEAKGLIIFTTCTTGLIGDDVQAVARSVE
FT                   KKTGRLVFTAESPGCSGVSQSKGHHDFNIQFYRQVRSLRERRPELKMPETEKTPYDICL
FT                   IGDYNMDWDLKAIRPLFEKMGLRIVAVFSGNERIENLVKMPDVKLNVVHCQRSAEYIAH
FT                   IEKDGYNIPFIRVSLYGIEQTCKALRETAAFFGLEERAEAVIAEEMARVEKSLAFYREK
FT                   LQGKRVAIYVGGPRVWHWIKLMEELGMQVVAVACTFAHEDDYEKINARAPEGMLVIDAP
FT                   NEFELEEMLTSTKPDLFLTGLKEKYLGRKMGIPTVNSHSYEKGPYEGFAGMVNFARDIY
FT                   QGIYAPVWKFQWGLDSTPGMTGRDEQCS"
FT   gene            574115..574669
FT                   /locus_tag="Moth_0552"
FT   CDS_pept        574115..574669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0552"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18882"
FT                   /db_xref="GOA:Q2RL07"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL07"
FT                   /protein_id="ABC18882.1"
FT                   /translation="MQLKEIPITGIPYDQLYIEKLPATPEYCRRPAELLPAGNRSVVVN
FT                   PNRTCMPLGAMWGAHLSRLKEKVDLELEFHGHNDFGLATANALAAVRAGVRWIDTTVGG
FT                   LGERAGNTSLEELYRVLTRLFDLDPGLNSRYLPGLERYVTRAAGRLPPAPVDNVPEGPT
FT                   FPRPPAPRGPRVATGNLALFN"
FT   gene            574786..576519
FT                   /locus_tag="Moth_0553"
FT   CDS_pept        574786..576519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0553"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18883"
FT                   /db_xref="GOA:Q2RL06"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL06"
FT                   /protein_id="ABC18883.1"
FT                   /translation="MRIAMAQLDPTIGDIGGSLAKIRQAVAEARQHGAGLVIFPELAVT
FT                   GYPPRDLLCRHDFLERVERALAEDIAPLSRETAIIIGAPVRGRGNPAFLYNAALLYSGG
FT                   ELCGRQDKSLLPNYDVFDESRYFKPATRRLPVFLEGLRLGLTICEDIWNDKDYWNRQLY
FT                   DIDPVAEMLAQGAEILINISASPYHYGKIALRADMLRSLARKYGRPILYINQVGGNDEL
FT                   IFDGTSLAIDANGNVVSLAASFAEDLVLLDLERPQAGAALTLKPVKRARPGAIPAGVAP
FT                   EAGRNETEFLTGEEIVISEDISYVYRALVLGIADYLHKTGFRKALVGLSGGIDSSVTAA
FT                   LAAAAMGPENVLGVAMPSRYSSPGSRSDARKLAANLGIAFREIPIEGMFKAYLEAMNGG
FT                   GPPRGDLAEENVQARIRGNILMFISNREGYLTLTTGNKSEMAVGYCTLYGDMSGGLAVL
FT                   ADVPKVMVYDLARYINRDREIIPADVLVKPPSAELRPGQVDQDSLPPYEVLDAILQAYI
FT                   EEEKSAEEIAGRGFDLDLVREIIRKVDRAEYKRRQAAPGLRVTSKAFGMGRRMPIAWRV
FT                   G"
FT   gene            576789..578669
FT                   /locus_tag="Moth_0554"
FT   CDS_pept        576789..578669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0554"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18884"
FT                   /db_xref="GOA:Q2RL05"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL05"
FT                   /protein_id="ABC18884.1"
FT                   /translation="MPDTVIMKLLSQVTKPARYLGTEWNAVHKDWEENPARMVFIYPDL
FT                   YEVGMSHLGLAILYGAVNEQPGMLMERAFAPGPDMEALLRENHIPLFSLESHRPLADFD
FT                   VIGFTLQYEMSYTTILNILDLAGIPVLATERGAGYPLIIGGGPGVANPEPVAPFFDCFL
FT                   LGDGEEALPEFLNLVGQLKKEGLWDHRREVLDRIASLPGFYVPSFYDVTYNSDGTVAAV
FT                   VPNRPGIPERVSKRVLPDLDEAYFPTRPIVPFLEVVHDRIMLEVMRGCTHGCRFCQAGA
FT                   IYRPVRERDLAVLLRQAEELVRHTGHEEISLTSLSTADYSRVEELARALVAAYGDLGVS
FT                   VSLPSLRVDAFSVRLADAVQQVRKSSLTFAPEAGSQRLRDVINKGVTEDDILTATAEAF
FT                   RAGWQAIKLYFMLGLPTEGEEDLQGIAGLARRILYQGRELAPGKKPTVTVSVSSFVPKA
FT                   WTAFQWEPQDQVAVLKEKQQLLRNHIKGPGLRFNWHDAEISYIEAVLARGDRRLAAAIM
FT                   AAWRRGARLEGWSEYFSYACWERAFQETGLDPAFYANRERREEEVFPWDHLDFGVSKTF
FT                   LLRERRRARAGQLTADCRSGRCTGCGVCPGLGVDLRLKGGPEDRAPADKV"
FT   gene            578647..579312
FT                   /locus_tag="Moth_0555"
FT   CDS_pept        578647..579312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18885"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL04"
FT                   /protein_id="ABC18885.1"
FT                   /translation="MRLRIKYSKTGQMAFLGHLEMLRLWQRAMRRAGLPVAMSQGFNPH
FT                   PRLAFGPALALGLESLAEYLDVELAADREPDRVQVELQAQLPPGLEILLVRTIPDQAPA
FT                   LTAVIDVAAYRVTWLKEVDPGLLQQRVESLLARQEVLVRRTGRDGRPRVKDIRPGILKL
FT                   VLDPSPDLVMLLQCSQAGSVRPEEVLKALALETPARMVRTGLFARRGDDLLAPEDISG"
FT   gene            579345..581033
FT                   /locus_tag="Moth_0556"
FT   CDS_pept        579345..581033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0556"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18886"
FT                   /db_xref="GOA:Q2RL03"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL03"
FT                   /protein_id="ABC18886.1"
FT                   /translation="MLKEILIQDDAEETAVALLEDGRLMEIYLERDSNQRLVGNIYKGR
FT                   VANVLPGMQAAFVDIGLEKNAFLFVDDTSGIEALEGEIVSRSRRRISDVVREGQEILVQ
FT                   VAKEPQGTKGARVTTQITLPGRYLVLMPTVNYIGVSRRISHEEERERLKNLARAVKPRR
FT                   MGLIVRTVAAGAGLEELQADCQNLTRTWKRIRQAARRSKAPRLVHHDVELSLRILRDLY
FT                   ADDVNRLVVNSPATYAKVLEVLAGRAPNLRQRVILRENADLFAVYGVQNQIEQALKRKV
FT                   WLRCGGYLIIDQMEALTAIDVNTGKYVGRHNLAETVLTTNLEAAVEVARQLRLRNIGGI
FT                   IVVDFIDMDNPLHREQVIKVLEGELTKDKTKTQILGFTRLGLLEMTRKKAQQRLESVLQ
FT                   QDCPYCHGTGKVLSAETVTLKARKEILQLAAVSKARAILAEANPAVAAPLIGVGGANLR
FT                   TLERRAGKKLIIKGNENFHLEEVRLRELFDREEIANLSTPVKVGQVLQVTIEGVHTGNG
FT                   GDGIARVAGFVLDIPGGAAYLGREVPVEITRVFRTYARARLLANA"
FT   gene            581159..581473
FT                   /locus_tag="Moth_0557"
FT   CDS_pept        581159..581473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0557"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18887"
FT                   /db_xref="GOA:Q2RL02"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RL02"
FT                   /protein_id="ABC18887.1"
FT                   /translation="MYAIIMTGGKQYRVSEGDTLRVEKLPAEVGEKVVLDKVLAVGEGA
FT                   DLKVGNPYVEGAKVTASVQAQDKAPKIIVFKYKPKKNYRRKQGHRQPYTQLQIEKIEIQ
FT                   "
FT   gene            581470..581814
FT                   /locus_tag="Moth_0558"
FT   CDS_pept        581470..581814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0558"
FT                   /product="Protein of unknown function DUF464"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18888"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL01"
FT                   /protein_id="ABC18888.1"
FT                   /translation="MIRVTFWRGRDGELGGFRVTGHAGYGPKGGDIVCAAVSALAQTAV
FT                   LGLEDQLEGKPQVTIRDGDLQCRLPADLSPAGARTARVILRTLEVGLNTIATDYRPYVQ
FT                   VEYKTLTSET"
FT   gene            581971..582243
FT                   /locus_tag="Moth_0559"
FT   CDS_pept        581971..582243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0559"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18889"
FT                   /db_xref="GOA:Q2RL00"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RL00"
FT                   /protein_id="ABC18889.1"
FT                   /translation="MFMDLQLFAHKKGVGSSRNGRDSEAKRLGVKKQDGQLVKAGNIIV
FT                   RQRGTRIHPGRNVGIGKDDTLYALIDGKVHFERKGREKKQVSVYA"
FT   gene            582351..582887
FT                   /locus_tag="Moth_0560"
FT   CDS_pept        582351..582887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0560"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18890"
FT                   /db_xref="GOA:Q2RKZ9"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKZ9"
FT                   /protein_id="ABC18890.1"
FT                   /translation="MAWQAREIISLLRWQRHDFLNHLQVISGYLQLKKNDRALAYLRQV
FT                   IDQLEQIGRIMHLQEPALALTALARIEGAVARGISLEMKISTRMEKLALEPGTARALWE
FT                   AAWDLALALAGDGNTLRVELTSEAEGYRLLFYTPVPATLPAGAADTLADLTRRQELPFT
FT                   WQPETGKLSLIFKSR"
FT   gene            583138..584409
FT                   /locus_tag="Moth_0561"
FT   CDS_pept        583138..584409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0561"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18891"
FT                   /db_xref="GOA:Q2RKZ8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKZ8"
FT                   /protein_id="ABC18891.1"
FT                   /translation="MFYDEAKIYVKGGDGGNGIVAFRREKYVPRGGPNGGDGGRGGSVI
FT                   LEADAGLRTLVDFRYRAHYRAERGQHGQGKNKHGRSAPDLILRVPVGVVVRDATSGQVL
FT                   ADLVEDGQRVVVAAGGRGGRGNARFVTSTDRAPTFAEKGEPGEERWLVLELKLLADVGL
FT                   IGLPNAGKSTLLARISAARPKIADYPFTTLTPNLGVVRLEDGDSFVVADIPGLIAGAHQ
FT                   GAGLGLKFLRHIERTRVLVHVLDTSQPGEDVLAGWRTVNDELAHYNPELARRPQVVAAN
FT                   KMDIPGGEEKVAFLRERLGDSYRIFPISAATGEGVQELLYHVSGLLATLPPPAPVTAPE
FT                   EEKVTALAPEELTIEREGQVFIVKNPDVERRVAMTYLDNEEAVRRLQVYLKQKGVDDAL
FT                   RRAGAATGAIIRIGKFEFEYVEEP"
FT   gene            584614..585750
FT                   /locus_tag="Moth_0562"
FT   CDS_pept        584614..585750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0562"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18892"
FT                   /db_xref="GOA:Q2RKZ7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKZ7"
FT                   /protein_id="ABC18892.1"
FT                   /translation="MTERECRLALSQARRLVIKVGTSTLTHKTGKLNLGRMERLVRELV
FT                   DQVNAGRQVVLVTSGAVGAGMGRLGLKEKPRTLPEKQAAAAVGQGLLMHMYEKFFSDYG
FT                   LLVAQVLLTRADLADRSRYLNSRHTLAALLRLGVVPIVNENDTVAVEEIRVGDNDTLSA
FT                   LVAGLVDADILFLLTDTGGLFTANPVTSDDAVLLPCVTEITPEIEALAGGAGSTWSTGG
FT                   MATKIQAARLATSFGIPVVIASGLQAGQIEAVLKGEEIGTIFLPREHRAHTRKRWLAYA
FT                   PAVQGQIQVDAGAARAICKNGKSLLPGGVIAVDGDFDQGAIVSIVDPAGKEIARGMANY
FT                   PAAAISRIKGRKTGEIGEILGYKDYDEIVHRDNLIVLG"
FT   gene            585769..587025
FT                   /locus_tag="Moth_0563"
FT   CDS_pept        585769..587025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0563"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18893"
FT                   /db_xref="GOA:Q2RKZ6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKZ6"
FT                   /protein_id="ABC18893.1"
FT                   /translation="MNVALEVQTKGQRAREAARILAGLGTSKKNEALLAMARALEEEQE
FT                   AILAANARDMVAGKEKGLSRALLDRLLLNEKRIRDMAAGLRELAALPDPVGEVTSMWTR
FT                   PNGLQIGRVRVPLGVIGIIYEARPNVTVDAAGLCLKTGNAVILRGGSEAFYSNQALTRV
FT                   ISRAATAAGAPEGAIQLIETTDREAVNLLLRANDYLDVLIPRGGAGLIRTVVENATVPV
FT                   IETGVGNCHVYVDAEADLDMAQRIVINAKTQRPGVCNAMETLLVHEKVADSFLPSLAAA
FT                   LKEKGVTIRGCERTRAIIPWAEVATETDWATEYLDLILAIRVVDSLESALEHIHRYGTK
FT                   HSEAIVTTNYQTAREFLARVDAAAVYVNASTRFTDGYEFGFGAEIGISTQKLHARGPMG
FT                   PEQLTTFKYIIFGSGQIRQ"
FT   gene            587063..587716
FT                   /locus_tag="Moth_0564"
FT   CDS_pept        587063..587716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0564"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18894"
FT                   /db_xref="GOA:Q2RKZ5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKZ5"
FT                   /protein_id="ABC18894.1"
FT                   /translation="MNLVTRPGRVGIMGGTFDPIHYGHLVTAEAARWEFALQKVIFVPS
FT                   GRPPHKKDYPVTDAEYRYQMTLLATASNPYFEVSRSEIDREGFSYTVDTVAEFRREYGP
FT                   EVQLYFITGADAILEILTWKDVDTLLRECHFIAATRPGFQLNRLEESRPQLPVEGRHRI
FT                   HLIEVPALAISSTDIRWRVKNNKPIKYLLPEAVEEYIRSRGLYRPRLDGVYEKG"
FT   gene            587763..588008
FT                   /locus_tag="Moth_0565"
FT   CDS_pept        587763..588008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0565"
FT                   /product="RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18895"
FT                   /db_xref="GOA:Q2RKZ4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKZ4"
FT                   /protein_id="ABC18895.1"
FT                   /translation="MRTLYVGNLPWATSEEELARAFASHGEVLSARIITDRQTGRSRGF
FT                   GFVEVNDADADQMIAAMNGAELGGRILTVNEARARS"
FT   gene            588107..588682
FT                   /locus_tag="Moth_0566"
FT   CDS_pept        588107..588682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0566"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18896"
FT                   /db_xref="GOA:Q2RKZ3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKZ3"
FT                   /protein_id="ABC18896.1"
FT                   /translation="MANYQEILAARLSEKRYLHSLGVAGTAARLASKNKVDPEQARLAG
FT                   LLHDYARDLPPGELLTLAAGAGLITCELERRLPILLHGPVGALLIKQDLGIKDRAVLQA
FT                   VARHTVGAVAMTALDKIIYLADVIEPERRFPGVEELRRLAAADLNAALLKAFETSILYL
FT                   VGKGQPLHPVTIEARNYLLLSGQEETSA"
FT   gene            588854..589201
FT                   /locus_tag="Moth_0567"
FT   CDS_pept        588854..589201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0567"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18897"
FT                   /db_xref="GOA:Q2RKZ2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKZ2"
FT                   /protein_id="ABC18897.1"
FT                   /translation="MDAGRVAQLAAQAVLEKKGIDPVILDLQGITLIADYFVIASGTST
FT                   VQVQAIAGRVEEILDAAGVELLHREGLEAARWVLLDYGAVVVHIFLEEERRFYDLERLW
FT                   GDARRVAIESP"
FT   gene            589226..591715
FT                   /locus_tag="Moth_0568"
FT   CDS_pept        589226..591715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0568"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18898"
FT                   /db_xref="GOA:Q2RKZ1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKZ1"
FT                   /protein_id="ABC18898.1"
FT                   /translation="MEARYNFKEIEPKWQRRWEASDLYRVTEDPDKPKFYCLEMFPYPS
FT                   GNLHMGHVRNYSIGDVVARVKRMRGYNVLHPMGWDAFGLPAENAAIHRGIPPAEWTWSN
FT                   IANMRRQLHAMGISYDWDREVATCHPNYYRWTQWLFLQMYKHGLAYRKKAAVNWCPSCA
FT                   TVLANEQVVDGACERCHTPVMRKDLEQWFFRITDYADRLLEDLKKLPGWPDKVKIMQEN
FT                   WIGKSSGAEVVFRVEGSGEEIPVFTTRPDTLYGVTYLVLAPEHPLVEKLTAGTPYEGPV
FT                   EEFVQAARYLSALDRTATEKEKEGLFTGAYAINPVNNERVPIWIANYVLMEYGTGAVMG
FT                   VPAHDQRDFEFARKYDLPVKVVIRPASSELPAGELAAAYVEDGIMVNSGPFNGLPNREG
FT                   IQKVTEYLESIGRGRARVNYRLRDWLISRQRYWGAPIPMIYCDQCGIVPVPEEDLPVIL
FT                   PEGVEFRPTGESPLTYCPEFVNTTCPRCGGPARRETDTMDTFVCSSWYFLRYTSPHSQD
FT                   RAFERDKVDYWMNVDQYIGGVEHAILHLMYARFFTKALHDFGLVGVEEPFQNLLTQGMV
FT                   LKDGSKMSKSKGNIVSPEEIINRYGADTARLFILFAAPPERDLEWSDQGVEGCYRFLNR
FT                   VWRLVGSYADAVRRAGGSLEIRSHADRELWRLLHATIKKVTEDVEERFNFNTAISAIME
FT                   LVNGCYRYQDTVPEEEQNLVLMGEVLRKLVTLLAPFAPHITEELWQGLGGQESVHRESW
FT                   PQYDPEALVEEEITLVIQINGKVKDRMQVPAGLAREKIEELVLNRDKVAALLAGQQVVK
FT                   VIVVPDKLVNVVARRAS"
FT   gene            591931..593439
FT                   /locus_tag="Moth_0569"
FT   CDS_pept        591931..593439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0569"
FT                   /product="transporter, UIT6 family"
FT                   /note="TC 9.B.53"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18899"
FT                   /db_xref="GOA:Q2RKZ0"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKZ0"
FT                   /protein_id="ABC18899.1"
FT                   /translation="MFFYYGIGPKIVFSEKGQVEMSIKRVAVLTLLLCGSFLPLGGVAW
FT                   AATGNELGKMLPLWSVLPFVGMLLSIAIWPLVNASWWEHNMGKVSLFWSLVFFVPFLIA
FT                   FGSGTAFTQAVEVYLLDYLPFIILLFGLFVVAGGIILRGTLRGNPGVNVLLLLVGTILS
FT                   SWIGTTGASMLMIRPVIRANEWRRYKAHIIIFFIFLISNIGGALTPVGDPPLFLGYLRG
FT                   VPFFWTMRLILPMGFNVLILLTLYYFLDSYFYRKEKVPRAKGGQDPLRVEGLQNLIYLG
FT                   IIVGAVILSGILAKNPAFADQQTGNLYGITIFRHGEEAVVLPYTNIIRDLAILLAAFLS
FT                   WKTTSMDIRKDNRFTWGPIKEVAILFAGIFMTMIPALAILHARGAELGLTHPAQFFWAT
FT                   GALSSFLDNAPTYLVFLTTATSLGATTGVPTTLGVVAPKMLLAISCGAVFMGANTYIGN
FT                   APNFMVRSIAEENNIRMPSFFGYMGWSIGILIPLFILDTLIFFR"
FT   sig_peptide     591931..592071
FT                   /locus_tag="Moth_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.997 at
FT                   residue 47"
FT   gene            593574..594248
FT                   /locus_tag="Moth_0570"
FT   CDS_pept        593574..594248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0570"
FT                   /product="Competence protein ComEA helix-hairpin-helix
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18900"
FT                   /db_xref="GOA:Q2RKY9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY9"
FT                   /protein_id="ABC18900.1"
FT                   /translation="MWEWDRRVRWLAAALAVALIFGAGIQYGSWRERQAAADLPRVIPG
FT                   EQAGAPGNSSNGAGQGQAAANNPATIQVHVAGAVKMPGVYELPAGARVNEAIHLAGVLP
FT                   EANPNALNLAAPLSDGQQVIVPRQGEEARVNAPAGAATGPGAAPGNPAGSSSSRTGGKV
FT                   NINTAGLAELDSLPGIGPTLAQRILDYRTQKGPFRTIEDLQNVSGIGAKKFADLKDLIT
FT                   VN"
FT   gene            594348..595133
FT                   /locus_tag="Moth_0571"
FT   CDS_pept        594348..595133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0571"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18901"
FT                   /db_xref="GOA:Q2RKY8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKY8"
FT                   /protein_id="ABC18901.1"
FT                   /translation="MTVLQAIVLGLVQGVGEFLPISSSAHLILTPWFFRWPDPGLTFDV
FT                   ALHLGTLIAVVAYFWRDIIELVLSGLGQPRSQDGRLFWYLIVASIPGAIFGVLFEKQAE
FT                   TIFRSPLLIALTLTLMGLGLWWADRVGRKRRQLDDVNLFDGIIVGISQALAIIPGVSRS
FT                   GITMTAGLLTGMERETAARFSFLMSVPIIAGAALLKLKELPLHEVNLAFIAGVLTAAVV
FT                   GFLAIKFLLQYLRRGSYLLFTGYRILLAALIVAVFWLRR"
FT   gene            595317..596054
FT                   /locus_tag="Moth_0572"
FT   CDS_pept        595317..596054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0572"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18902"
FT                   /db_xref="GOA:Q2RKY7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY7"
FT                   /protein_id="ABC18902.1"
FT                   /translation="MVANDAYAEQLRFLTLSEAELGLMEAEKEIFIKEADAVVKTFYDH
FT                   LLQYPYLENMIKQHSTLERLTQTQKAYFISLTAPRIDGEYISGRLRIGKKHQKIGLYPK
FT                   WYLGAYRIYLSEIRRVIWHYHADDPDLCLRLLEAFTKRIIFDMQLAIENYIIDQLQQLG
FT                   HFQDEIAAVAKIIGDIAEQTKILSLNASIEAARAGEHGRTFSVVAQAVRDLAARTSQSA
FT                   RDITQKVQENHRLLARMQQTGKE"
FT   gene            596206..597162
FT                   /locus_tag="Moth_0573"
FT   CDS_pept        596206..597162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0573"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18903"
FT                   /db_xref="GOA:Q2RKY6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKY6"
FT                   /protein_id="ABC18903.1"
FT                   /translation="MQWVEVEVLTTAEAVEAVAVILEDYGATGVVIEDSADLTRKWEDR
FT                   YGEIYALDPANYPASGVRVRAYLPVVSWQEERAGEIQTRVKALAAVGLDPGAATVRYRL
FT                   AREEEWAYGWQKYYHPVRVTKGLTIKPTWEEYTPSPGETVIEIDPGMAFGTGTHPTTIL
FT                   SLQALERVLKPGARVVDVGCGTGILALAAAKMGAGAVLALDLDPVAVAVARKNIARNGA
FT                   ADKVTVRNNDLLAGLEGPFDLVVANILAEVILKMIPDAGRVLPAGGTLIASGISRGKAG
FT                   VVEDALLANGFAVEDTLTSGEWVTFIVRNLLPDPVEC"
FT   gene            597213..598178
FT                   /locus_tag="Moth_0574"
FT   CDS_pept        597213..598178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0574"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18904"
FT                   /db_xref="GOA:Q2RKY5"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY5"
FT                   /protein_id="ABC18904.1"
FT                   /translation="MATKKNRSLLEIIPKYFTLWVIVFAALALLSPNSFQFLGKYISYL
FT                   LGVVMLGMGMTLTMGDFAGVLQQPLNVVVGVALQFIIMPLLGFAIATILRLPPELAAGV
FT                   VLVGCVPSGTASNVMTFIAQGDVALSVTISSITTLIAPFITPYLYLLLGGKFIPVEPLA
FT                   LLIDIAKIVLLPIIIGLVIRQVLGNERARVVNQVMPSVSVIAIVIIIAAVVAGSAAKLV
FT                   NVAGAVILAVILHNGLGFLMAYFVARYLCRMTEAQARAVSFEVGMQNSGLGAALAMKFL
FT                   TPVAALPSAIFSVWHNLSGSFLANFWARRAPAPAARLARR"
FT   gene            598246..600675
FT                   /locus_tag="Moth_0575"
FT   CDS_pept        598246..600675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0575"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18905"
FT                   /db_xref="GOA:Q2RKY4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY4"
FT                   /protein_id="ABC18905.1"
FT                   /translation="MRDRPLLWVTVAYIVGLLLARFQEGAAGAVAPGDTAVLLSPLVIA
FT                   LALWALAYLFWRPPQRPAWMYLLLAGFVAMGFFISTWDNCLHQSQLAGDRDTYLDLTGM
FT                   VTGEPQLYPDRVVYTLAAREVSQGAYSKKIKENVQVVIYRRDRNKSLPRYHYGDVLRVH
FT                   GQLTAPPPARNPGEFDYRAYLARRYIYNRMLLNDPRAIVKLEKEAGNPLVRLALAAKGR
FT                   VKTAIAAALPPRQAGILAALLFGDVEELTDQDSDTFKNLGVFHFFAVSGSNTALVLLIV
FT                   MAIAGLLGLRAETAVALGLAGLIFYAAVTGFTPSVNRATIMAGLGLIAFWRRQRRDFYT
FT                   ALALAALLILLVRPRSLYDSGFQLSFTATWGIVYLYPLLDDLLAWLPAWRAYLVIPLAA
FT                   QVATLPLVAYYFSFVSLLSLPANLITAGLVGAIVTLGLAASALALVSLPLAGTVFNALG
FT                   PLVNLMLAFLAGLAGLPGMTLPLATPSPLGVAGYYLVLIILRELWLRRREPRWLALWRW
FT                   HLRELGVVAALTLATLLVYLYHPGQPGELGVTFIDVGQGDAIYLATPGGRHILVDGGGR
FT                   PFEQGDFDVGERVVVPFLHRQGVRRLDAVVSTHPDTDHLGGLMAVVRQMPVSLVVVPPL
FT                   RGSMVNEYRPFLAELQARGIPWQEAGRGATLALDPVVDLQVLHPGREISGSNSDSNNNS
FT                   LVMKVVYRDFSLLLGADIEAEAMADLERAGMNVRSTVFKVPHHGSRFGLEPSFLQQVSP
FT                   QAVVFSVGERNNFGHPAPEVVGYWQGRGVPIYRTDRQGAISIRSDGDSWQVKTVLP"
FT   sig_peptide     598246..598335
FT                   /locus_tag="Moth_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.663 at
FT                   residue 30"
FT   gene            600795..601787
FT                   /locus_tag="Moth_0576"
FT   CDS_pept        600795..601787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0576"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18906"
FT                   /db_xref="GOA:Q2RKY3"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY3"
FT                   /protein_id="ABC18906.1"
FT                   /translation="MDWQAMVEEVKQGYIAPVYLFYGSEGYLKERALKILEKKLIPPET
FT                   GDFDYQELDGRELTGAEVIMLAATLPAMAERRLVVIKDPAGEIWQDEDFLKYLTKPEPA
FT                   TCLVLVVNGSIDKRLKAVKEINSTGRVVECSPLQGEDLAAWLIKEARQEGYNLPPATAL
FT                   ILARAGGGDLRQARNELDKAMAYTGKPGTITPATVQALIPEIEAENTIFQLVDALGNRK
FT                   PELAIGFLRQLLERGEAPLGIVAMLARQLRLIYRAHLGGDKRNLAARLGVKPFVARKVA
FT                   AQARNFSLPVAGQALEELLKVDTALKTGQGEAGPLLEQAIWTIIAMGEH"
FT   gene            complement(602094..602411)
FT                   /locus_tag="Moth_0577"
FT   CDS_pept        complement(602094..602411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0577"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18907"
FT                   /db_xref="GOA:Q2RKY2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKY2"
FT                   /protein_id="ABC18907.1"
FT                   /translation="MLLLPGSHVKIVREVNKVPNIKSAMKRVELTRIRTLRNKAIKSSV
FT                   KTAIKKFRTALEQGDNHNAAVNLRQAIRAIDKAVTKGVLHPNTAARKKSSLQRYFNKTT
FT                   A"
FT   gene            complement(602425..603462)
FT                   /locus_tag="Moth_0578"
FT   CDS_pept        complement(602425..603462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18908"
FT                   /db_xref="GOA:Q2RKY1"
FT                   /db_xref="InterPro:IPR010897"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY1"
FT                   /protein_id="ABC18908.1"
FT                   /translation="MRIQVITSRQARALGAFLKGVLLAGLIIMGLVTGAWQLIRTGSQV
FT                   LSGSPARLPMPLLEGILREGLPALGLQAGEAPRNTSGEALTTALQVLASPLVVLPGQEK
FT                   TPSLLTTEEEYVQPEPPVEESPPPAPSEVETTSSKNPLVAIYNTHNAESYQPSEGSAKF
FT                   PGKNGGVSQVAATLADSLSKDYGIPVVRSTTIHDYPDFTLAYANSEKTLKRMLAANPSV
FT                   LVALDVHRDAGLPSPPVVEIDGQKVAQVLIIVGSNARLEHPNWRQNEAFARQLAKKMDE
FT                   LYPGLCLGVRVQEGRYNQHLLPRALLLEFGSDNNTLQEAEGSARLVARVLAAVIKDLRQ
FT                   ENPAS"
FT   gene            603584..604354
FT                   /locus_tag="Moth_0579"
FT   CDS_pept        603584..604354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0579"
FT                   /product="NCAIR mutase (PurE)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18909"
FT                   /db_xref="GOA:Q2RKY0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKY0"
FT                   /protein_id="ABC18909.1"
FT                   /translation="MNQEQLKDLLLAYKNGQTDLETVMNHLKHLGDEDLGFAKVDHHRA
FT                   LRNGFPEVIFGQGKTREQVVAIACRLAAAGSTVLVTRTDRETYQEVAARLPAAEFNELA
FT                   RTIVVDAGEIRPTGGRVAVLSAGTADLPVAEEAAVTAAVMGNEVERIYDVGVAGIHRLL
FT                   GRVDLVRQADVVIVVAGMEGALASVVAGLVDRPVIAVPTSVGYGASFGGLAALLTMLNS
FT                   CASGIGVVNIDNGFGAAALATTITRLKGQPAEKD"
FT   gene            604428..604766
FT                   /locus_tag="Moth_0580"
FT   CDS_pept        604428..604766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18910"
FT                   /db_xref="GOA:Q2RKX9"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX9"
FT                   /protein_id="ABC18910.1"
FT                   /translation="MTNWVGAVVRFVVSALVLMLVGFILPGIRVAGFTGALIAAVVIAI
FT                   LGWAVEAVLGKKVSPHGRGIVGFIVAAIVIYVAQFIIPAYLSVNILGALLAALVIGIID
FT                   AFVPTELR"
FT   sig_peptide     604428..604526
FT                   /locus_tag="Moth_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.799 at
FT                   residue 33"
FT   gene            604847..606655
FT                   /locus_tag="Moth_0581"
FT   CDS_pept        604847..606655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0581"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18911"
FT                   /db_xref="GOA:Q2RKX8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKX8"
FT                   /protein_id="ABC18911.1"
FT                   /translation="MSVEQKYIRNFCIIAHIDHGKSTLADRLLEYTGALSKREMVDQVL
FT                   DTMDLERERGITIKLQAVRLHYKARDGQEYVLNLIDTPGHVDFTYEVSRSLAACEGALL
FT                   VVDAAQGIEAQTLANVYLALEHNLEIIPVINKIDLPSAEPERVRREIEDVIGLDASEAI
FT                   LASAKTGVGTEEILEAIIRRVPPPRGDGEAPLQALIFDSIFDSYRGAIPYFRVVQGRVR
FT                   KGDRIRFMATGAEFEVNEVGVFTPAPRPVESLAAGEVGFLSASIKNVKDTRVGDTITSA
FT                   ERPAPAPLPGYRKVMPMVYCGLFPVESERYDDLRDALEKLQLNDASLTFETETSVALGF
FT                   GFRCGFLGLLHMEIIQERLEREYGLELITTAPSVVYRVVGTNGSVIMVDNPTALPAPNL
FT                   IDHIEEPFVEATIMTPKDFVGPVMELCQEKRGSFLNMDYLSEKRVALKYDLPLAEIIYD
FT                   FFDQLKSRTRGYASLDYSLKGYRPSELVKMDILVNNEVVDALSLITHRDQAYQRGRALV
FT                   ERLRQLIPRQLFDVPIQAAIGSRVIARETIPALRKNVLAKCYGGDVTRKRKLLEKQKEG
FT                   KKRMKQVGTVDIPQEAFMAVLKAGKS"
FT   gene            606658..607824
FT                   /locus_tag="Moth_0582"
FT   CDS_pept        606658..607824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0582"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18912"
FT                   /db_xref="GOA:Q2RKX7"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX7"
FT                   /protein_id="ABC18912.1"
FT                   /translation="MGTMSQAGFVNKASHIYIHIPFCVRKCNYCDFISYPEQSPEVMAV
FT                   YCRLLEEEMKLAAGTWQPGPAATVFLGGGTPTILPADLLERILVAVEGYFNRQPEAEVS
FT                   VEANPGTITLEKLRVLRSAGVNRLSLGVQSFDDRLLKAMGRIHRRRDIYQAYHLARRAG
FT                   FANINLDLIFGLPGQTLENWQATLREALALQPEHLAAYSLQVEEDTPWGRLAAAGNLNL
FT                   PGEELELAMYQEAREKLAAAGYQQYEISNFARPGYRCRHNVTYWLNHPYLGLGAAAASS
FT                   WRGERWQNYKNLEQYGAALSAGRLPRAEIEVTTPRQQMAETMFMSLRLLAGVNLQAFRQ
FT                   RFGKDAREVYAGEMERLLRAGLIEVQGHHLKLTERGLPLANEVFAAFV"
FT   gene            607924..608958
FT                   /locus_tag="Moth_0583"
FT   CDS_pept        607924..608958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0583"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18913"
FT                   /db_xref="GOA:Q2RKX6"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKX6"
FT                   /protein_id="ABC18913.1"
FT                   /translation="MRMDERKQKVLAAVIQDYILTGEPVGSRTIARRYNLGVSPATIRN
FT                   EMADLEEMGLLEQPHTSAGRIPSDQGYRYYVDCLMPPAHLTPEEEEYVRRRYNQKMLEI
FT                   EQVLAETTRLISEMTSYAAIALGPDQGRASLEEVQVLPIQVANKALLVAVTSTGVVEHR
FT                   VLTIPEGVTPEDLNRISRVLNARLQGRALEDLRQMVLSDIYQELAQHRNLVNLVRDLLQ
FT                   QLLSLESGERVYRNGTLNILNQPEFKDLDRVREILSFLDQDEALRRIFMTTPSTGLTIR
FT                   IGQENKIEGIDKCSVVTISYAVEGKIMGKVGLLGPTRMQYSRAISVLRCVADALSQTLE
FT                   QLYR"
FT   gene            609055..609732
FT                   /locus_tag="Moth_0584"
FT   CDS_pept        609055..609732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0584"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18914"
FT                   /db_xref="GOA:Q2RKX5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX5"
FT                   /protein_id="ABC18914.1"
FT                   /translation="MKDEMTCPEPGPGAAAPETTGAGTTGDEPVPAKGGAGPEQAEAMD
FT                   AAGEIVNLTEEINSLRAEVENKTAALAELQQRYLRLQADFDNYRKRTRREQEELTRMAA
FT                   ARLITSLLPVLDNLERALAAVTDNKAEGLATGVEMTLRQLKEILEQEGLTPIAALGQPF
FT                   NPELHEAVAREETENPEQANMVVAEFRRGYTLKGKLLRPAMVKVAVAGATVKENGQEVD
FT                   KDE"
FT   gene            609725..611563
FT                   /locus_tag="Moth_0585"
FT   CDS_pept        609725..611563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0585"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18915"
FT                   /db_xref="GOA:Q2RKX4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKX4"
FT                   /protein_id="ABC18915.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVMEGGEAVVIPNAEGGRTTPSVVAFTKE
FT                   GERIVGQVAKRQAITNPDRTVISIKRHMGTNYKVKIDNKEYTPQEISAMILQKLKADAE
FT                   AYLGEKVTQAVITVPAYFTDSQRQATKDAGRIAGLEVLRIINEPTAASLAYGLDKGEDQ
FT                   TILVYDLGGGTFDVSILELGDGVFEVKATSGNNRLGGDDFDQRIMDYLVDICRREHGVD
FT                   LTQDKMAMQRLKEAAEKAKIELSGMTSTNINLPFISATPNGPVHLDVNLTRAKFEELIA
FT                   DLVEKTVGPTRQALADAGLEPKDIDKVLLVGGSTRVPLVQETVRKILGQEPHKGINPDE
FT                   CVALGAAIQGGVLAGEVKDVLLLDVTPLSLGIETLGGVFTKLIERNTTIPTSKSQIFST
FT                   AADNQTTVEIHVLQGERAMAADNKTLGRFQLTGIPPAPRGVPQIEVKFDIDANGIVHVS
FT                   AKDLGTGKQQAITITSSSGLSEEEIQRMVKEAEASAEADRRRKEEIETRNQADSLIYQA
FT                   ERTLKEFKDKADQNDVDRIEKAKKELQEVLDSKNNDKIKEKMEALSQALYTLTTKVYQQ
FT                   AGAQAGAQGQGAAGGQKQDGNVYDADYKVVDDDKKE"
FT   gene            611577..612725
FT                   /locus_tag="Moth_0586"
FT   CDS_pept        611577..612725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0586"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18916"
FT                   /db_xref="GOA:Q2RKX3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX3"
FT                   /protein_id="ABC18916.1"
FT                   /translation="MAKRDYYEVLGVSRDASEAEIKKAYRQLARKYHPDMNPGDKEAEE
FT                   KFKEVQEAYEVLSNAEKRARYDQFGHAGTEAGGGPGFGGFDFGGAGADFGFGDIFDMFF
FT                   GGGFGGAARRQGPQRGDDLRLDLEISFEEAAFGVEKEVGIPRQEKCPECGGSGAAPGTH
FT                   PKTCPTCHGTGQIRIAQRTPLGQFQTIRTCHQCHGQGTIIETPCPRCRGRGVVQRTRKI
FT                   RVKIPPGVDTGARLRMAGEGESGLRGGPPGDLYIYINVRPHKLFRRDGYDVFCEVPVSM
FT                   VQAALGDSIKVPTLDGKEELHIPPGTQSGTSFRLKGKGIPRLNGVGRGDQHVRIHVETP
FT                   TNLNEKQKELLREFARLYGSEPRGAREQDKGFFRKVKDAFMG"
FT   gene            612879..613619
FT                   /locus_tag="Moth_0587"
FT   CDS_pept        612879..613619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18917"
FT                   /db_xref="GOA:Q2RKX2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX2"
FT                   /protein_id="ABC18917.1"
FT                   /translation="MAHHFFLPIVVAPGETVLLEGENAHHAIRVLRLRQGESITLADSN
FT                   GQGYRAEIVAITEGRVAAAIKDPLDSPEPRVRVTLYQGWPKGDKMDLIIEKCTELGVDR
FT                   IVVLATERSIPRPDQQTCARRRERWQQKAHAAARQSRRHRIPVVDGPLGLAEALVKLRP
FT                   DTLLLVPWEEERTRDLKSILATVPADRELALLIGPEGGLSRAEVDLACRFGGLPLTLGP
FT                   RILRTETAGLACLAAIMYAMGELG"
FT   gene            613656..615008
FT                   /locus_tag="Moth_0588"
FT   CDS_pept        613656..615008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0588"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18918"
FT                   /db_xref="GOA:Q2RKX1"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX1"
FT                   /protein_id="ABC18918.1"
FT                   /translation="MPAPRVALVSLGCKVNQNEVEALKHLFQEAGYQVVPFPEEADVYV
FT                   VHTCTVTHISDRKSRQLIRRAIRANPEAVVAVTGCYAQVAPGEVLAIPGVDLVVGTRDR
FT                   HRLVELVARAREGTAPINAVRPHEKGETFEELPLVEVSRARAFLKIQEGCQEFCTYCIV
FT                   PYARGPLRSRDPELIRAEVRRLVDAGYLEIVLTGVHTGAYGRDLAGDIDLAGLLKNLVQ
FT                   VPGLRRLRISSIDPLDFTPELKAVLTGEGIICPHFHIPLQSGDDAILGRMGRRYTGQYY
FT                   LELIASLRSGRPGAAFTSDVMVGFPGETEAQFQNTLAVVKEASLAGIHVFPYSPRRGTP
FT                   AAAMPGQVAAEVKKDRERRLLQLGRRLSRQYAREFLTQTLDVLVEGPLPGCPDCQEGLT
FT                   GNYLRVAFPAPADLTGQLVPVRLQELRGSLIWGKLEKDVSDRQENGWRGRT"
FT   gene            615082..615426
FT                   /locus_tag="Moth_0589"
FT   CDS_pept        615082..615426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0589"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18919"
FT                   /db_xref="GOA:Q2RKX0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKX0"
FT                   /protein_id="ABC18919.1"
FT                   /translation="MAEDCIFCQIAAGKIPSEVVYQDDRVVAFKDIRPVAPVHILIIPR
FT                   KHIPDLTAITPEDGDLIGYIHLVAVKLAREFGLADRGFRVVNNCKEEGGQAVYHLHFHL
FT                   LGGRQLQILG"
FT   gene            615517..615693
FT                   /locus_tag="Moth_0590"
FT   CDS_pept        615517..615693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0590"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18920"
FT                   /db_xref="GOA:Q2RKW9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKW9"
FT                   /protein_id="ABC18920.1"
FT                   /translation="MSEVKIGKNESLDAALRRFKRICQKSGVLSEARRREHYEKPSVRR
FT                   KKKSEAARKRRWH"
FT   gene            615832..616134
FT                   /locus_tag="Moth_0591"
FT   CDS_pept        615832..616134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0591"
FT                   /product="Protein of unknown function DUF1429"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18921"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR022477"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW8"
FT                   /protein_id="ABC18921.1"
FT                   /translation="MAKHSLRRRLAARVRHIEKSVTEFLDLPPEAALDLPRLTLVGNSR
FT                   LLLENHRGIVTYKPDLVKLKLTAGELEIKGTGLFLREIKPDAIALEGTIRSLEFC"
FT   gene            616150..617439
FT                   /locus_tag="Moth_0592"
FT   CDS_pept        616150..617439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0592"
FT                   /product="Putative stage IV sporulation YqfD"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18922"
FT                   /db_xref="GOA:Q2RKW7"
FT                   /db_xref="InterPro:IPR010690"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW7"
FT                   /protein_id="ABC18922.1"
FT                   /translation="MTVHNWQAYLTGYLVLTISGDDPEAFLNLALARGLTLLDVTRTGK
FT                   GQILVKMPVSEYRLLRPLARESHCRVRIVDKRGLPFFSRRLRGRQLLLAGVLFFLVAIY
FT                   ILSACVWVVDVRPEKGTLRQVTPDQVIAAARAEGLKPGAWKGRIDIRALEYGLEQRLPQ
FT                   LAWVGVSFHGTRAEIKVVEKIPPPAGDDYELPASIIAAKDGVIKQILVMNGEGRVAVGD
FT                   TVRRGEVLISGLILPPEPEKKPGENQPQQQPRPEPRLVRARGIVRARVWYEEEKEIERL
FT                   QVREQATGRQQRAIIIKTPGRQVVLRGPARSPYAHYLQENKVITLPSWRNFPPPVELII
FT                   STYREIRIQKQQLGYEEAVRVAGQQALASLKARLPAGVTITGEKIIPLTGTGEQRVRVR
FT                   AWVETEEDIGQVVPLHGRTPPGGNPPATPG"
FT   gene            617517..618518
FT                   /locus_tag="Moth_0593"
FT   CDS_pept        617517..618518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0593"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18923"
FT                   /db_xref="GOA:Q2RKW6"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW6"
FT                   /protein_id="ABC18923.1"
FT                   /translation="MIKPLADIYEVKLTTGNNGEAANIFGHQDENLKFIESHTPARIIA
FT                   RGNEITLSGDRREVQVLEKLFRQLIKLARAGTTINTATINYTWNLVRRQDGSQDQPDLA
FT                   QALGEVIYVTPRGKQIRPKTLGQLRYIQAMRRYDIVFGIGPAGTGKTYLAVVMAVNALR
FT                   ARSVERIILARPAVEAGEKLGFLPGDLQEKVNPYLRPLYDGLYDVLGLETAQKYMEKNI
FT                   IEVAPLAYMRGRTLDDAFIILDEAQNTTSEQMKMFLTRIGFGSRAVITGDITQVDLPRE
FT                   TTSGLVEVQRILKGIEGIAIEYLTEADVVRHPLVQEIIKAYERSDQMCHGSG"
FT   gene            618500..620668
FT                   /locus_tag="Moth_0594"
FT   CDS_pept        618500..620668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0594"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18924"
FT                   /db_xref="GOA:Q2RKW5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW5"
FT                   /protein_id="ABC18924.1"
FT                   /translation="MPWQRLETLLHPLLARLGPRFLTRRAVWGMALFVIAVAIMALDFL
FT                   PQKLDLTVGQPSPRDFKAPQGIVYESEVLTQKAREEAARQVAPVYRVDNTVVASLTGQV
FT                   DSIFQSIREINNSTGDANERVARLKERLNQFKLTPAIIQALATADSGTINNLATATKSI
FT                   INQVMGEAVPQDALNTARDKMLAAVETSGIDARYRPLVAALLRELDLKPNLIYDVAATM
FT                   QKQEKARAEVVPVQVTIRQGEKIVSDGELVTAEDIEALQKLGLLRTGTSWGGFIGLILF
FT                   QGILVALMLLYLRFFKPDIYGDNHLLLLLGLLWLIFLVFSRGVVAISLGGRPDLARLVG
FT                   YLMPVAAGSMLVAILLDAQVAVIFTVFLGLEAGIISGNYYQFAAAGFISGLTGIYCVAH
FT                   LSHRSDLARSSLFLMLANLLSVVALGLMLKDTLFQLSIAAGLALANGLLSTVLTIGFLP
FT                   FLENSFGITTAVKLLELSDPNHPLLKRLLLEAPGTYHHSILVGNLAEAAANAVGADSLL
FT                   ARVGAYYHDIGKLKRPYFFIENQVTPENPHDRLAPTLSTLIISCHVKDGLEMAREFHLP
FT                   RVIQDIIAQHHGATLMSYFYHKACENSRDEKEVAADDFRYEGPKPQSKEAAIVMLADSV
FT                   EAGIRSLPKATPGRMEGFIRKIIKEKLEDNQLEASDLTFRELTVIAEAFMRVLNGIFHT
FT                   RVEYPEVVVKEIERRKNRNGVLHKQSAG"
FT   gene            620637..621107
FT                   /locus_tag="Moth_0595"
FT   CDS_pept        620637..621107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0595"
FT                   /product="Protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18925"
FT                   /db_xref="GOA:Q2RKW4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKW4"
FT                   /protein_id="ABC18925.1"
FT                   /translation="MECSINNQQADYPVGEELLSTLNRVLQAAAAAEGVAGEAEVSLTL
FT                   VDDAAIKELNRTYRGVDAPTDVLSFALEEKGPDEPAYADPGGDKLLGDIIISVPTAVRQ
FT                   AGEYGHSLARELAFLAVHGFLHLLGYDHDTAAGAADMEARQEAILAGVGLRR"
FT   gene            621107..621448
FT                   /locus_tag="Moth_0596"
FT   CDS_pept        621107..621448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0596"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18926"
FT                   /db_xref="GOA:Q2RKW3"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW3"
FT                   /protein_id="ABC18926.1"
FT                   /translation="MLAKFRAAGAGIVYCLRTQINMAVHLLAAMVVIGAGWYFRIAAWE
FT                   WVALTITITMVLAAEALNTAVEVTVNLYTKQYHPLARIAKDVAAGAVLITALGAVAVGY
FT                   LIFGPRLGF"
FT   gene            621460..622149
FT                   /locus_tag="Moth_0597"
FT   CDS_pept        621460..622149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0597"
FT                   /product="Protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18927"
FT                   /db_xref="GOA:Q2RKW2"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW2"
FT                   /protein_id="ABC18927.1"
FT                   /translation="MRRLRRFFLTGIIVTMPAAATIYALWLVFSFLDQLAGQAVGLFLG
FT                   RRVPGLGLALTLAVVLIAGFLATNFIGRFFLNLWDEVMYRIPLVNSIYRTVKQLVEAIW
FT                   RDDKKAFQHVVMVEYPRRGIYSLGFLTGPAPAEASMRAASDLVNVFVPTTPNPTSGFLL
FT                   LVPREEVIPLEMPVEDGLKLIISAGVVGPAGRTASGGAGWGRLLQGLTANGTINNPGWR
FT                   RSRNTAE"
FT   sig_peptide     621460..621579
FT                   /locus_tag="Moth_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.299 at
FT                   residue 40"
FT   gene            complement(622078..622566)
FT                   /locus_tag="Moth_0598"
FT   CDS_pept        complement(622078..622566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0598"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18928"
FT                   /db_xref="GOA:Q2RKW1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW1"
FT                   /protein_id="ABC18928.1"
FT                   /translation="MEKRCYPSQPLVGVGAVVVREEKLLLVRRGKPPSPGLWSLPGGAQ
FT                   ETGETLPRAVEREVYEECGLIIAAGPPIAVLDSIYTDNRGRVKYHYVLIDFWAEYRGGS
FT                   LNPADDATAACWVPLPKIADYPLTSGLKELLAEWGLLGGIPASPPTGVVYRTIGGQSL"
FT   gene            622681..623070
FT                   /locus_tag="Moth_0599"
FT   CDS_pept        622681..623070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0599"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18929"
FT                   /db_xref="GOA:Q2RKW0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKW0"
FT                   /protein_id="ABC18929.1"
FT                   /translation="MKYDLQDLIAMAAAARDKAYAPYSHFRVGAALLTAGGRVYTGCNI
FT                   ENASYGLTVCAERVALFQAVAAGEREFTALAVVGGDLEACFPCGACRQVLAEFAPDLEV
FT                   ITGRPGGSIHRRRLKELLPDTFTLK"
FT   gene            623083..623988
FT                   /locus_tag="Moth_0600"
FT   CDS_pept        623083..623988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0600"
FT                   /product="GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18930"
FT                   /db_xref="GOA:Q2RKV9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV9"
FT                   /protein_id="ABC18930.1"
FT                   /translation="MAEAYRSGFAGLIGRPNAGKSTLLNRLVGRKVAIMSDKPQTTRNK
FT                   ILGVLTATAYQIVFLDTPGIHKPRHQLGEYMVAVARNTLAEVDVVLYVVDAAEEPGAGE
FT                   EYIISRLKEVDVPVILILNKMDLVAGETLIRREEFFRARLDVAAVRAVSALVGTNLDTL
FT                   PDLISTYLPPGPQYYPPDMVTDQPEKFVMAELIREQVLRATREEVPHAVAVVVEEIAER
FT                   PNDYLYVDAVIYVERDSQKGIIIGEGGQRLKEIGSQARREMEALLGNKIFLNLRVRVKK
FT                   NWRQQELTLRQLGYDRRHIQ"
FT   gene            624289..625092
FT                   /locus_tag="Moth_0601"
FT   CDS_pept        624289..625092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0601"
FT                   /product="DNA replication and repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18931"
FT                   /db_xref="GOA:Q2RKV8"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKV8"
FT                   /protein_id="ABC18931.1"
FT                   /translation="MPGLFQAEGIVLKSRDYQETDQLLTILTRTHGKLEAIVKGVRKPR
FT                   SSLRSGTQQLCRSRFLFYAGKSLATVTQCEVQEIYGPLRQDLKRLAYAYYLVEIADGVV
FT                   MPGQVNQAMYLLLQQGLEALGELEPALVARAFEARTLKLLGLAPRLEACALCQRELKGN
FT                   GRVAIAPAAGGALCPECRGHQGREYLVSRGGVKTWQQLNRLNWSYLKRLQINPMLMGEL
FT                   GEVMPAFLEYYLDRRLRSRAFINEIGGDNIDGPGKNRPVAQAPGT"
FT   gene            625043..625477
FT                   /locus_tag="Moth_0602"
FT   CDS_pept        625043..625477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18932"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR025642"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV7"
FT                   /protein_id="ABC18932.1"
FT                   /translation="MTDLEKIDQLRKRLGLSYREAKEALDRAGGDLLEALIQYEEGVKE
FT                   ETQGALGNWGSKLMERIRNILHQGNVTRIKIKKDGKTVAEIPATAGALGILGVLASSEL
FT                   AVLAGLSTVAALFNRYTLEVERPDGQVEEHSLASDEQVDK"
FT   gene            626030..626989
FT                   /locus_tag="Moth_0603"
FT   CDS_pept        626030..626989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0603"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18933"
FT                   /db_xref="GOA:Q2RKV6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKV6"
FT                   /protein_id="ABC18933.1"
FT                   /translation="MNFQELIMTLQRFWAEQNCVIQQPYDLEKGAGTMNPATFLRVLGP
FT                   EPWRVAYVEPSRRPTDGRYGENPNRLQHYYQYQVILKPSPDNVQDLYLQSLEAMGINPL
FT                   EHDIRFVEDNWESPTLGAWGLGWEVWLDGMEITQFTYFQQCGGFDCHPVSAEITYGLER
FT                   LAMYIQQVNSVYDIEWVDGITYGDIHHQTEVDYSHYNFTFADTAMLFNLFNAYEAEAMR
FT                   VVEQGLVQPAYDYTLKCSHTFNLLDARGAISVTERTAYIGRVRHLARLCAAAYLEQRQK
FT                   LGYPLLKARQQQPEAPAPGPAAVVGGRDRKDACDVKEG"
FT   gene            626992..629076
FT                   /locus_tag="Moth_0604"
FT   CDS_pept        626992..629076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0604"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18934"
FT                   /db_xref="GOA:Q2RKV5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKV5"
FT                   /protein_id="ABC18934.1"
FT                   /translation="MARDLIFEIGTEEIPARFMNPALEQMAAVASQLLQEYRLPCQKVA
FT                   TYGTPRRLALYLTALAENQEELVQEIKGPPVKAAFTADGQPTKAALGFARSMGVAVEEL
FT                   VTREYNGGQYVFAIKREQGRPAVTVLPELLLAVVNALSFPKPMRWGSLEIRFARPIRWL
FT                   LALFGSEVIPVELAGLTASNQTYGHRFLAPGPHQVPTASAYFQVLEENYVLVDQHRRRQ
FT                   LIWEQITGLASREGGRVEKDPELLEEITYLVEYPTALAGHFDPEYLKLPQEVVITPMRD
FT                   HQRYFPVWNAQGELLPRFITVHNGTADHLENISRGNERVLAARLADAAFFYQEDRQTPL
FT                   AAKVPKLEEIVFQESLGTMLAKTRRLQRLAVNLVNTLDLPAELVPLVERTAELAKADLV
FT                   TAMVYEFPELQGIMGSYYAAHDGERAEVCQGIRQHYWPRFAGDRLPDSLTGMVVGLADR
FT                   LDTLVGCFGAGLIPTGSQDPYALRRQATGVVTIAVEFNLKFSLTASIAAAYEGYTAGGI
FT                   QLARPLDVVQEQLVQFCRQRLEHLLEEKGYRYDVIQACLAAGSDDLAAAYHRTRDLSAF
FT                   REEEGFAALQTAFTRAFNLARQAREKYHLRPEALQEKAEAELYRALMETRHQAEPRLRA
FT                   GDYLAALKAMAALRGPIDAFFDNVLVMAPDMEVRNNRLALLQAIVNLVFQIADFSRLVP
FT                   "
FT   gene            629163..629798
FT                   /locus_tag="Moth_0605"
FT   CDS_pept        629163..629798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0605"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18935"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016842"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV4"
FT                   /protein_id="ABC18935.1"
FT                   /translation="MQLSPRQEQIIAIVKRSGPITSQQIAAELNLTRATLRPDLAILTM
FT                   AGILEARPRVGYFLSSKPSQALVAEEIKKIRVGDIKGLPRVIRAGASVYEAIVSMFLED
FT                   VGTLMVVDDEGHLEGVVSRKDLLKAAIGGGDLQKMPVSVIMTRMPNIICTTPDEPVLAA
FT                   ARKIIEHEVDALPVVRPVNGQGKKLKVLGRITKTTITNLFVELGEGRS"
FT   gene            629855..630739
FT                   /locus_tag="Moth_0606"
FT   CDS_pept        629855..630739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0606"
FT                   /product="Protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18936"
FT                   /db_xref="GOA:Q2RKV3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKV3"
FT                   /protein_id="ABC18936.1"
FT                   /translation="MGNRAGAHFCLASGLRLPSKGGVTIGVIYVISDSLGETAEYVARA
FT                   AASQFDGGGLDIRRVPYVTDLDHLEEVVNEAAQEQGIIAFTLVLPDLKKKLLELAAARG
FT                   LEAVDLLGPLMDAITRVTGGRPRLEPGLIRRTDEDYFRKMEAIDFAVKYDNGKDIRGLS
FT                   HADLVLIGVSRTSKTPVCMYLAHKRLRAANLALVPEVPLPGELLNLPPEKIIGLTIDAG
FT                   LLYQIRQERLKTLGLPGPAGYATRERIEEELAYARRVMDQLGCPVIDVTNKAVEETAGK
FT                   ILQIYYRRERNGK"
FT   gene            630729..633383
FT                   /locus_tag="Moth_0607"
FT   CDS_pept        630729..633383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0607"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18937"
FT                   /db_xref="GOA:Q2RKV2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV2"
FT                   /protein_id="ABC18937.1"
FT                   /translation="MASKKYVYLFSEGKADMRLLLGGKGANLAEMTNIGLPVPQGITIT
FT                   CEACNEYNRLGQQFPEGLEEEVAARLKDLEAINGKKLGDPENPLLVSVRSGAPVSMPGM
FT                   MDTILNLGLNDNSVKGLAAQTGDERFALDCYRRFIQMFGNVVLGIEHNDFEAVLEKHKE
FT                   RLGVKFDHELTPDALREVIAEYKDVVKSRSGRDFPQDPREQLYMAIRAVFDSWNNPRAI
FT                   VYRKINKIPDDLGTAVNVQTMAFGNMGPTSGTGVAFTRNPSTGEKGIYGEYLINAQGED
FT                   VVAGIRTPKPISSLKEEMPEVYRQFEDICQLLEKHYRDMQDIEFTIEKGKLFILQTRNG
FT                   KRTAAAAVKIAVDMVNEGLITKEEAVLRVDADQLIQLMHRRIDPSAKLEVVAKGLPASP
FT                   GAASGQVVFDADDAEKMGLDGQKVVLVRTETTPDDIHGIVQAQGVLTARGGMTSHAAVV
FT                   ARGMGKPAVTGCDAIKIDVENKRFFIGDLVVKEGDVISIDGSTGNVMLGEVPLIDPQLT
FT                   GEFETILEWADSFRRLKVRANADTPEDARRSREFGADGIGLTRTEHMFMQVDRLPVVQQ
FT                   MILAKTKEERQAALDKLLPMQQGDFYGILKAMEGLPVTIRLLDPPLHEFLPNIEELLVD
FT                   VTRLQATNGDSKELEEKQALLREVRARHEFNPMLGHRGCRLGITYPEIYAMQVRAIFQA
FT                   VAQLVKEGVKVLPEVEIPLVIHVNELQRLHAMVDEVAAAVKKETGVDFDYKVGTMIEMP
FT                   RACATADEIAREAEFFSFGTNDLTQTTFGFSRDDAEGKFLHQYVDEKILKEDPFIVLDR
FT                   DGVGKFMKMAVELGRSTNPKLEIGICGEHGGEPSSVEFCHQIGLNYVSCSPFRVPVARL
FT                   AAAQAALKEKKGK"
FT   gene            633578..634342
FT                   /locus_tag="Moth_0608"
FT   CDS_pept        633578..634342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0608"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18938"
FT                   /db_xref="GOA:Q2RKV1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV1"
FT                   /protein_id="ABC18938.1"
FT                   /translation="MISAQRRKIIIDKISSGMPLSVNELSRELGVSPMTIRRDLETLER
FT                   EGFLTRTHGGAVPVRGGSDEEPSFMEKINKFSAEKLAIARKAAELVLDGDTILLNAGTT
FT                   ITALAQLLKNHNNLTVVTNTVNIAMELAHSEGINLVLTGGNMRTKSYAMVGSLTERVLR
FT                   EIHVQKAFLGVNGISIEHGLTTPNMTEAHTNSLMVAAADRVIVLADHSKIGRVTLSRFA
FT                   PISAVNTFITDSNAPRDFIEELTRRGIEVIVA"
FT   gene            634372..635226
FT                   /locus_tag="Moth_0609"
FT   CDS_pept        634372..635226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0609"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18939"
FT                   /db_xref="GOA:Q2RKV0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKV0"
FT                   /protein_id="ABC18939.1"
FT                   /translation="MELVNPREVLQAARENGYAVGAFNIHNLETLWAVVEAAIEAKAPV
FT                   ILQATPGTVKFAGADFLVAMARAAARRAGIPIALHLDHSQDLDMIALCIEAGFSSVMFD
FT                   GSKLPWDENIRLTRQVVTMARNRGVAVEAELGRIGGREEELQVRAKDVYYTDPAEAVTF
FT                   VEATGIDSLAIAIGTAHGVYQGEPRLDFERLASIAAKVKLPLVLHGASGVPDEAITRCI
FT                   QLGISKINIATDLKLAMAAALRETLLSNPEENDLRRYLNPARNRVKEVALAKIRLFGAA
FT                   GRA"
FT   gene            635292..636374
FT                   /locus_tag="Moth_0610"
FT   CDS_pept        635292..636374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0610"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18940"
FT                   /db_xref="GOA:Q2RKU9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU9"
FT                   /protein_id="ABC18940.1"
FT                   /translation="MYVDLDDLHTLSKLDSGQALQETINYPHQFREAWELAGRWPENLS
FT                   RDEIRQIMFLGTGGGSAASVDLLASYLFDEIKIPLFLNRGYTIPASIDNRTLVVVVSHS
FT                   GKTEEILNAYHQVCTTEAQIIVLTSGGKLLSLARGNKHPYLLIPGGMMPRIAVGYIFLP
FT                   LLGLLQRLGFVGDKSAEVKETINILSELGGQYGPIVPAKDNLAKSMAYEMAGYVPVVYG
FT                   SLPLTIAVASRWKNQFAENSKLLAMYNALPALHHDEVAGWDAPQSYLRHFYFTFLQDAE
FT                   DRLETTRRIEISQELLASRAAGVRKVASVGKSRLARLFSLVYLGDFISLYLALIRGVDP
FT                   TPVEIIDNIKYLLTLESRTE"
FT   gene            636371..637306
FT                   /locus_tag="Moth_0611"
FT   CDS_pept        636371..637306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0611"
FT                   /product="Tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18941"
FT                   /db_xref="GOA:Q2RKU8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU8"
FT                   /protein_id="ABC18941.1"
FT                   /translation="MITTVTTNVAIDKTYIVDNFSLNGVFRVKQVLAQAGGKGLNVARV
FT                   IHNLGEEVIATGFIGGYTGSYIKEIMAREGMKEDFVVIEGESRICINILDPVGKTQTEL
FT                   LEPGPDVSQTDAQKLVDKVKELASSSKVVTISGSLTRGLAPGFYSLLIEVINQAGAMAI
FT                   LDTSGAAFIEGIKARPYMVKPNQQEAETLAGHPLKEVDDQKKFLMKLLESGVQVAVLSL
FT                   GGDGALVATENDFFKVIPPRVQAINTVGCGDAFVAGFAVGLARGEGVTGAARLATAAAS
FT                   ASATRWQTGQCQVELVNKLLDEVRLLELHN"
FT   gene            637402..638382
FT                   /locus_tag="Moth_0612"
FT   CDS_pept        637402..638382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0612"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18942"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU7"
FT                   /protein_id="ABC18942.1"
FT                   /translation="MLFKMTRKKMLIFTAITLIGVSVLLGGCGSKQGNTQTGTSSGTTT
FT                   QNTEKSGEKVIGVSLLTREHVFYNLIEKAIQEKAQGYKFKPIIMDASQDSNKQLAQVQD
FT                   FITQKVDAIVLAPTASAGIAPAVDLAKKAGIPVFTIDIKAEGDVKSHVATDNYAGGKLA
FT                   AKYAAEKVLNGKGKVAIITYSEVQSCVDREKGFKDALAEYPNIKVVDVENCSGSAEKAA
FT                   NLTQDILLKFPDLDLIFAVGDPFAVGAVSTIKAAGRNVKVIGFDGNPEAIQEIKNHGLW
FT                   VADVVQHPDQIGGKVIDLIADYFNGKSVPPQVLIPPTIVDASNAK"
FT   sig_peptide     637402..637530
FT                   /locus_tag="Moth_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.298 at
FT                   residue 43"
FT   gene            638460..639953
FT                   /locus_tag="Moth_0613"
FT   CDS_pept        638460..639953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0613"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18943"
FT                   /db_xref="GOA:Q2RKU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU6"
FT                   /protein_id="ABC18943.1"
FT                   /translation="MASPLLQLRGISKSFSGIKVLDNIDLDIYPGEVHALLGENGAGKS
FT                   TLIKIISGVYQRDCGTITFKQKPVEFTNTRQALDAGISVIHQELSLIQDLSVAENIFLG
FT                   REPIKSRVFIDKEKMVSETIAIARSLGIDLKPWAMVRDLNVAEQQMVEIAKAVSCNASL
FT                   VIMDEPTSSLSDRETETLFKIIKRLKKDNVAVIYISHRLKELEELADRLTILRDGKLVK
FT                   TMVGEEMKKYNWVSLMVGREIKDFSRKAQKPGEVILQVKDFTDPPKYWDINFELRQGEI
FT                   LGIAGLVGAGRTEVLQGIFGVKKPKHGSLYLNGQKVLFNSPAEAISNGIGFVPEDRRLQ
FT                   GVILAQSVKDNISLPSLYDKSNYGFINFLWENQVSEDYIKKMRIRTPSAKTIVKNLSGG
FT                   NQQKVALARWLAAHAKILFLDEPTRGIDVNAKAEIYNLMNSFTSEGGSIIMVSSELPEI
FT                   LSMSDRIVVMHEGRVAGILDRHEASEEKIMELACGKIAG"
FT   gene            639974..640969
FT                   /locus_tag="Moth_0614"
FT   CDS_pept        639974..640969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0614"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18944"
FT                   /db_xref="GOA:Q2RKU5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU5"
FT                   /protein_id="ABC18944.1"
FT                   /translation="MNGATNISNSAKLKYSHLNSIVKEYSFIFVFLALCILLSILVPTF
FT                   LLPQNLLNVLIQISINALLAIGMTFVIISGGIDLSVGSVAALAGIVVTALLKQYPSSTP
FT                   MMYVIIIFSVLAVGIVCGGISGLAIAKLNVEPFIATLAMLSIARGFAFVYTQSKPIFGL
FT                   PPAFSWIGQGYIGPIPVIVLIMIFCLVIAHIVLSKTCFGRYIYAIGSNEEVAKLCGINV
FT                   ARVKLIIYVISGVLSALGGVALASRLATGQPAAASGYELNAIAAVVLGGTSLSGGKGSI
FT                   GKTIIGIMTIGVINNGLSLLQISSYWQSITMGLIIMIAVILDKINTRKKA"
FT   gene            641029..641982
FT                   /locus_tag="Moth_0615"
FT   CDS_pept        641029..641982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0615"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18945"
FT                   /db_xref="GOA:Q2RKU4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU4"
FT                   /protein_id="ABC18945.1"
FT                   /translation="MAKVITIGEILVEIMTKYTGQEFTAPGELLGPYPSGAPAIFIDQV
FT                   ARMGVEAGIIARVGDDDFGLLNLTRLRDDGVDTSHIYKTKGYTTGTAFVTYYANGERKF
FT                   IFHFPHAAAGQLGPADVDENYIKTAEYLHVVGCSLTASASLRQAIWKAVKIAKENKVKV
FT                   SFDPNLRPELLNEQEIKNVYDDILDAADIILAGKSEMIALSGEGDLVKGIARLKKRDGT
FT                   MLVLKDGARGASLYYGEECYHVPPVKVQEVDPTGAGDCFDGAFIAALACGKGLKEALQI
FT                   ANVAGALSVTRKGPMEGAAFKEDILALYSRHNSSKV"
FT   gene            complement(642042..642515)
FT                   /locus_tag="Moth_0616"
FT   CDS_pept        complement(642042..642515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0616"
FT                   /product="Protein of unknown function DUF523"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18946"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU3"
FT                   /protein_id="ABC18946.1"
FT                   /translation="MGKILVSACLAGVRCKYSGGHNLVPVIAELVRQGKAVPVCPESLG
FT                   GLTIPRPPAEIKGGDGYDVLAGRARVMDKEGRDVTAAFIQGARAALARAREVGPEIIVL
FT                   KERSPSCGSKLIYDGNFSGATRPGPGVTTALLREYGYKVISEEEFKGEGNPSP"
FT   gene            complement(642666..642938)
FT                   /locus_tag="Moth_0617"
FT   CDS_pept        complement(642666..642938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18947"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU2"
FT                   /protein_id="ABC18947.1"
FT                   /translation="MFYPRIKDVKPLKDYTLIVAFDNGQIKKYDMRPLIAMPPFDILKD
FT                   PLLFSMARVEAGGYGISWSDELDLSEYELWEHGELIANADAPPEG"
FT   gene            complement(642950..643243)
FT                   /locus_tag="Moth_0618"
FT   CDS_pept        complement(642950..643243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18948"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKU1"
FT                   /protein_id="ABC18948.1"
FT                   /translation="MHPVKALKQGVKNGTMPIIARFYGIIIKMFFNEHLPPHFHALYGE
FT                   YNAIFNINTLEMIEGDMPLRARKLVVEWAENHQKELEIMWETKEFKQLPGLE"
FT   gene            643380..643838
FT                   /locus_tag="Moth_0619"
FT   CDS_pept        643380..643838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0619"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18949"
FT                   /db_xref="GOA:Q2RKU0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKU0"
FT                   /protein_id="ABC18949.1"
FT                   /translation="MKEVTIYTDGACSGNPGPGGWGAVLIYGDKRKELSGAEPSTTNQR
FT                   MEITAAIAALRVLKEPCRVHLYSDSAYLVNAFRQGWLARWERNGWLTVKKQPVENQDLW
FT                   RELLQVASRHQVEWLKVKGHSDNPENNRCDELARAAIAALRRQEIPSS"
FT   gene            643906..644064
FT                   /locus_tag="Moth_0620"
FT   CDS_pept        643906..644064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0620"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18950"
FT                   /db_xref="GOA:Q2RKT9"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT9"
FT                   /protein_id="ABC18950.1"
FT                   /translation="MGKWSCTACGYVYDPAKGDPEGGIAPGTAFEDLPDDWVCPNCGLG
FT                   KENFEPL"
FT   gene            644249..644854
FT                   /locus_tag="Moth_0621"
FT   CDS_pept        644249..644854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0621"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18951"
FT                   /db_xref="GOA:Q2RKT8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT8"
FT                   /protein_id="ABC18951.1"
FT                   /translation="MLIVGLNGSPKKDGNTAFLVREGLAAAAAAGAETALIHIADAMAD
FT                   QKIPYCTQCSNPCQGACSRHNRLGEAFDLLRRADGLLLGSPVYFGSVSAQLKAFWDKSR
FT                   ILRKEKALLNVVGAGVTVGGARFGGQETTMKALFDMMLVQGMILVGDGHTEADCGHQGS
FT                   CGQAPASSDEFAIRRVRLAGRRLAEVAAATMTLRRHRA"
FT   gene            644867..645856
FT                   /locus_tag="Moth_0622"
FT   CDS_pept        644867..645856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0622"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18952"
FT                   /db_xref="GOA:Q2RKT7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT7"
FT                   /protein_id="ABC18952.1"
FT                   /translation="MLLREEAEKREEILLSPLASLSSRTRGRQKPEEPCPIRTEYQRDR
FT                   DRIIHCKAFRRLKHKTQVFIAPGGDHYRTRLTHTLEVAQISRTIARALRLNEDLTEAIA
FT                   LGHDLGHTPFGHSGEEALNEVVPGGFKHNLQSLRVVEVLEGGSGLNLTWEVRDGIAHHT
FT                   GPVKPGTLEGRIICYADRIAYINHDIDDAIRAGIIVPEQLPKACLRVLGDSHRQRIDTM
FT                   VTDLIHHSWRMGQIGMSPEVQQATDTLRAFLFEKVYIGSRAKAEEGKAKRLLQQLYRYY
FT                   LENPEELPPAANPGDDLARRACDYIAGMTDSYAILQYTRIFVPRGFPT"
FT   gene            646476..648293
FT                   /locus_tag="Moth_0623"
FT   CDS_pept        646476..648293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0623"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18953"
FT                   /db_xref="GOA:Q2RKT6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT6"
FT                   /protein_id="ABC18953.1"
FT                   /translation="MTTAFNQDVIHEVKDRIDIVEIIGGYVQLKKRGRSYVGLCPFHNE
FT                   KTPSFTVSPDKQVFYCFGCGAGGDVLTFLMKREGLSFPEALAALAARAGVELVGEEETP
FT                   AARRQRELKERLYRLGAIAASFYYRILARHPAGAPARSYLQRRGIKGVTARQFELGFAP
FT                   DAGAVLVNYLQRQGFTPEEIEQAGLSLSRPPRGLVDRFRGRLMFPIKDSRSRVIGFGGR
FT                   VLGEGQPKYLNSPETILFHKGHHLFGLHLSLPGIRKEGRAILVEGYMDMIAAWQHGIDN
FT                   VVASLGTSLTPAQARELKKYAREVIIAYDADTAGQAATLRGLDILAAAGLQVRVLQLPE
FT                   GKDPDEFLAARGPEAFRELVAGSQGLMEFRIHKAVSEHDAGTAAGRKAIMTALLPYLRQ
FT                   VRDAVEQETYARLLNRYTGISETAILNDIRRPEARLDRAVKTTYIRDGRAGGTAAPHQA
FT                   ELFLLRAYLASPALATRIDAELGENWCRDQAARDLVAAVRERRRENPELTGPDLAGILT
FT                   PGREPQQEALLARLTLAEDLGPVEERAVNKAIRLLKLQQLRRQSKSLWLALARAEDTGD
FT                   QEQVRELQGKIFHLQQTINSLKLGRGELR"
FT   gene            648290..649375
FT                   /locus_tag="Moth_0624"
FT   CDS_pept        648290..649375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0624"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18954"
FT                   /db_xref="GOA:Q2RKT5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT5"
FT                   /protein_id="ABC18954.1"
FT                   /translation="MKEEQQKQMVKELIEKGKSQGSLTYSEIMDALQGIELSPEQIDDI
FT                   YEQLGHMGIEVVPEAAELEALEKEDSEAGETDLDLSIPENVAIDDPVRMYLKEIGRVPL
FT                   LTPEEEIELAKRMEAGDEEAKRRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNLGLIK
FT                   AVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQE
FT                   LGREPTPEEIAHEMDIPVERVREIQKIAQEPVSLETPIGEEEDSHLGDFIEDEDAQAPA
FT                   EAASFMLLREQLEEVLNSLTPREKRVLRLRFGLDDGRARTLEEVGQEFGVTRERIRQIE
FT                   AKALRKLRHPSRSKKLKDYLE"
FT   gene            649555..649629
FT                   /locus_tag="Moth_R0033"
FT                   /note="tRNA-Asn2"
FT   tRNA            649555..649629
FT                   /locus_tag="Moth_R0033"
FT                   /product="tRNA-Asn"
FT   gene            649634..649708
FT                   /locus_tag="Moth_R0034"
FT                   /note="tRNA-Met2"
FT   tRNA            649634..649708
FT                   /locus_tag="Moth_R0034"
FT                   /product="tRNA-Met"
FT   gene            649783..650505
FT                   /locus_tag="Moth_0625"
FT   CDS_pept        649783..650505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0625"
FT                   /product="Protein of unknown function DUF633"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18955"
FT                   /db_xref="GOA:Q2RKT4"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT4"
FT                   /protein_id="ABC18955.1"
FT                   /translation="MTTTSFNLPARLRVVAGLVPWGSSVADIGSDHALLPLYLVASGRS
FT                   PRVIVVEVAPGPYRRALAAVTGAGLTGRVEVRRGDGLEPLRPGEVDTVTMAGLGALTQQ
FT                   EILAARPEVRQRLRRLVLQPQGQAGPLRRYLAACGWRLLEEDLVYEAGHYYFIMAAIPG
FT                   VSPEYSDLEWELGPLLLQKRHPLLAGYIADKMEKLTAAVRELGRSQRAAARERREELQR
FT                   LLLQLGEVSTWLQSAARS"
FT   gene            650478..651590
FT                   /locus_tag="Moth_0626"
FT   CDS_pept        650478..651590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0626"
FT                   /product="Protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18956"
FT                   /db_xref="GOA:Q2RKT3"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT3"
FT                   /protein_id="ABC18956.1"
FT                   /translation="MAAKCGEIIAIMEALAPPELAAGWDNVGLMLGSPEAEVRRVLVCL
FT                   DVTPSVAAEAAARAVNLIISHHPLFFRPVKNLRFDEPVGELVRRLLQDNIMVYSAHTNM
FT                   DSADLGVSYHLASRLELEDIRVLVPTHREKYYKLVTFVPEDHEKVVREALTRAGAGWIG
FT                   NYSDCTFRVAGTGTFMPLAGTRPYTGEEGKLAEVKEYRLETIIPTGRLPEVLRALLKAH
FT                   PYEEVAYDVYPLANEGPAQGIGRTGVLPQAVTLEEFALRVKESLGAGRVNLVGDRERKV
FT                   KRVAVCGGAGSDVMAAARDAGAEVLVTGDLKYHEARTAQAMGLAVVDAGHFATERLIVP
FT                   ALVTYLQEQLQEREVMVLASQQEQEPWYAL"
FT   gene            651775..652137
FT                   /gene="rnpB"
FT                   /locus_tag="Moth_R0035"
FT   ncRNA           651775..652137
FT                   /gene="rnpB"
FT                   /locus_tag="Moth_R0035"
FT                   /product="RNA component of RNaseP"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            652194..652476
FT                   /pseudo
FT                   /locus_tag="Moth_0627"
FT   gene            652596..652670
FT                   /locus_tag="Moth_R0036"
FT   ncRNA           652596..652670
FT                   /locus_tag="Moth_R0036"
FT                   /note="group II catalytic intron domains V and VI as
FT                   predicted by Rfam RF00029"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            652796..653002
FT                   /locus_tag="Moth_0628"
FT   CDS_pept        652796..653002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18957"
FT                   /db_xref="GOA:Q2RKT2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT2"
FT                   /protein_id="ABC18957.1"
FT                   /translation="MLLALMEMVINGVSTRKVKAVVEELCGTEFFKSTVSELCKRLDPF
FT                   AQAPCQSRQHGHSPCQGSPLSSE"
FT   gene            653126..654145
FT                   /locus_tag="Moth_0629"
FT   CDS_pept        653126..654145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0629"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18958"
FT                   /db_xref="GOA:Q2RKT1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT1"
FT                   /protein_id="ABC18958.1"
FT                   /translation="MDNPSIVDVAKRAGVSITTVSRIINNTSYPVAAKTREKVLKAIEE
FT                   LHYSPNKIAQRLKKSTSDIVGLIVRDVCDPYFAEIARGVTDRASQVGYLCFLCNTGRNL
FT                   ENEFRYHDLLWQHRVKGIILAGGGLDQPDYKQILQKQLERHEKYGLKIIALAPQGLEMP
FT                   YVMINDYEAGKKITEYLIERGHRKIGFIGGPEKVFTSKERLKSYKDAMDAIGMKCEEYI
FT                   IHCDFSRKGGYEACNLLLSKVQDLTAICCVNDNIAIGAISAIKEHGYKIPEDISIISIG
FT                   NITEAKYTDPPLTTLSIPHYEMGQLAIDVIAEGKTDVRIILNTRIIERKSVDFSQKTR"
FT   gene            654212..654481
FT                   /locus_tag="Moth_0630"
FT   CDS_pept        654212..654481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKT0"
FT                   /protein_id="ABC18959.1"
FT                   /translation="MSGQSVKEWCAAHENVSRQLWDWLRKYKNQDGIARGKTNRWLPVE
FT                   ITEQTSIEQGHTLLVKIGPTSIEVRPGFDPALLAQVVWVLIALC"
FT   gene            654714..655658
FT                   /locus_tag="Moth_0631"
FT   CDS_pept        654714..655658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0631"
FT                   /product="Dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18960"
FT                   /db_xref="GOA:Q2RKS9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS9"
FT                   /protein_id="ABC18960.1"
FT                   /translation="MREKWSGIFPAIMVPLKEDYTINEKEFRNYIDWLLTFTDQGITGL
FT                   VTNGHTGEISGFNPEERKRITKIAAEQVAGRCLVVSGVSAEGTFEAIEQAKAAQEAGAD
FT                   GILLMPPHIWLRFGMKPESALKFVQDVASAIDIKIIIHLYPASTKAFYPIELLLEMVKI
FT                   PNVVAVKMGTRDMPMYERDVRILRQKAPEIALLTCHDENLLSTMIQGVDGALVGFAGCV
FT                   PELVTALFQAVQKEDLKEAKKINERLFGVSSAIYQIGQPSGEAHARMKEFLCQRKVFSL
FT                   PLMRPPIVPLDQKEKDKVAKAVADYGISIVNLV"
FT   gene            655898..657313
FT                   /locus_tag="Moth_0632"
FT   CDS_pept        655898..657313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0632"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18961"
FT                   /db_xref="GOA:Q2RKS8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS8"
FT                   /protein_id="ABC18961.1"
FT                   /translation="MNLGELWGNFYMDQVRNKILDSGMRGSSITNQSSQLITRIESVPF
FT                   SRWHIKPRVIMGSATFFDAFDTLSLSYAMPVLIGLWHLNPGQIGILIGIGYLGQAIGAL
FT                   LFGSIAERFGRVFSAKWATLVMSIMAIACAFAGNYNELVALRFIQGIGVGGEVPVAAAY
FT                   INEISRASGRGRFFMLYEMVYPIGLMVTAQLGTIIVPSLGWKWMFFIGGGTGIIIVLLM
FT                   NLLKESPRWLISKGRFEEAERIIEEIEASTDQRIPVNIKGTQEAVKGNWKELFSPFYRG
FT                   RTIVVWMLWFSTYFVSNGLNNWLPSLYKTVYKLPLQTSLRVASLTNLIQIVAVFACAML
FT                   IDKVGRKLWATIAFLVASLLLGILWINGAATAYSVMYLGSLAYGVIGTVTVLLYLYTPE
FT                   IYPTRMRAVGTAFATTWLRLASAIAPTIVGFILGTRGISKVFALFACVSVIGAFMAIRM
FT                   VETREKMLEEIAP"
FT   gene            657533..659110
FT                   /locus_tag="Moth_0633"
FT   CDS_pept        657533..659110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0633"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18962"
FT                   /db_xref="GOA:Q2RKS7"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2RKS7"
FT                   /protein_id="ABC18962.1"
FT                   /translation="MSNTYGLERLGIINPGTIYRNLPMARLVEIALARGEGLLASNGAL
FT                   SVNTGKYTGRSPHDRYIVDTPAVHDSISWGAVNQPVSEATFERLYSRLTAYLQGKDLFV
FT                   FDGFVGADPAYRMPIRIVNEYAWQNLFVHQLFIRPTAEELAGHEPRFTVICAPGFKAIP
FT                   EEDGTRSEAFIILNFDRRLVIIGGTSYAGEMKKSIFTVMNYLLPEQGVCPMHCSANMGP
FT                   AGDTALFFGLSGTGKTTLSADPERYLIGDDEHGWSDKGIFNFEGGCYAKCIKLSAEHEP
FT                   QIWNAIRFGSVLENVMVDPDCRIIDYDSDALTENTRAAYPVDFIPNAVIPGVGGHPQTV
FT                   VFLTADAFGVMPPIAKLTREQAMYYFLSGYTSKLAGTERGVTEPKATFSTCFGAPFLPR
FT                   SPMVYANLLGERIARHNASVYLVNTGWTGGPYGTGRRMSLPYTRAMVRAALNGELDKVE
FT                   FTPDPVFGFLVPKACPGVPAEILNPRNTWAETEKYDAMARKLASLFRENFAKFKDVPVS
FT                   IQEAGVVG"
FT   gene            complement(659258..659380)
FT                   /pseudo
FT                   /locus_tag="Moth_0634"
FT   gene            659667..660557
FT                   /locus_tag="Moth_0635"
FT   CDS_pept        659667..660557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18963"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS6"
FT                   /protein_id="ABC18963.1"
FT                   /translation="MPIPEKQLETWAHQGAISTAKSTHESVRNALFESKSLRQMDLDVY
FT                   LQGSYKNSTNIRGDSDVDIIVQLNSVFIPDTSGLSSSEREQFVMTYGDAAYSWDNFRTD
FT                   VLKALREYYGSKAITESNKSIKVAGVSGRLPSDVVVCLQYRKYRRFRGIGDEDYIEGII
FT                   FYTLVERRKVINYPKKHYVNGVNKQKRTDNFYKRTVRMFKNARTYLVDNGTVDAKLAPS
FT                   YFLECLLYNVPDRFFTTSYQETFYQVLKWLCQTNLSGFTCQNEQLPLFGSSPEQWSETR
FT                   AQKLIESLVKLWNQW"
FT   gene            660565..661188
FT                   /locus_tag="Moth_0636"
FT   CDS_pept        660565..661188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18964"
FT                   /db_xref="GOA:Q2RKS5"
FT                   /db_xref="InterPro:IPR041208"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS5"
FT                   /protein_id="ABC18964.1"
FT                   /translation="MHPYAVNSRERLYVPCYLAFISMISAYLLPYVLSLIGISAPWWLD
FT                   VPSVFGFYGIYLALFDRYLWRWPLLRKIGVVQVPVFEGHWEGYLCSSFDGYGQRHRVTV
FT                   TIYQRWTEISISLKSPTSSSRSLIASITLYPAQGPVLVYEYENRPKANAQPTMHIHYGT
FT                   ACLNLLCGGTRLLGEYYTGRDRQNYGTMELEKCMSPATLKFNSF"
FT   gene            661205..661660
FT                   /locus_tag="Moth_0637"
FT   CDS_pept        661205..661660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS4"
FT                   /protein_id="ABC18965.1"
FT                   /translation="MKLRDLIKQMQTNYYKMLVIVDNGRQPEKIIRPLQQEGWTAVDVT
FT                   DAVLKLIESIPENKVKVRIGGKLKEWFHSLPDRLILYNTTILYSPELGRLNPVGAFKYK
FT                   SREKEIIVLLEGRLAGNRIQYSHYGRPDYAEMDVSEVIHARMEDIDG"
FT   gene            661653..665264
FT                   /locus_tag="Moth_0638"
FT   CDS_pept        661653..665264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS3"
FT                   /protein_id="ABC18966.1"
FT                   /translation="MAKICELFNFERIREVVDIDAITDKKAMVENYVISPSLEEYLVHL
FT                   FQDLNSSTHKAAQIIGGYGSGKSHLLAFIISLLTEPGLVRSVQNEQVRRAVEAMKRDFV
FT                   VVHWELQPNDVSLSEYFYDQLEIQLKEKYGISINLPTSGVIDHKKTILQILEKVKEGHP
FT                   TRGLVVVIDEISDFLKQKTKEKLNQDVQFLRVLGQAAQSCDFMFIGAMQEHIFTNPKYV
FT                   DEAESFGRVAERFQVITIKREDIKRVIARRVLKKTAEQRLRLEELFREYVHYFPHLQAG
FT                   LDEYIDLFPLHPYVIQVFSELPYFEKRGVIQFTIQEVEQILDRDFPFLITYDRIYDEIA
FT                   SKHTVKNLETVSPVVNAIQTLESKVDLLEPRHQDTARKIIKALAVLRLYGKSVNNGATA
FT                   EELANTLLLLPGNRLMEAADEISLVLKNFRRVTDGQFINVTSDGYYFLDLNLTIDYDQV
FT                   IRRRAENLPEDSLDEEILSILKEQLLLEEGAARYAFRDTCEWSGRRSFREGTFVYETGK
FT                   GEVVRADGDYRIVFVSPFCAGNRYPPAENCAVISGSLPPEAIEQLKLAVAAHLLFRENY
FT                   QRSIMEKKYASLKKKFVEMFVQAWLETGQVNIGKAQKGIKALIVREFSNFDELFTEIKP
FT                   QLFEDYFNQKYPKHPKFTQRITRDNIMGEFGAAIKELLSKGNVQSVFSSTKSILNALDL
FT                   LDAQGNLSTANSEIAAAILETARAAGGKVVAVEDFINRFRQTPYGYDRWMTAFVIIVLT
FT                   YNGEIVLRAAGGTLISSSEVYDTFGSGLEAFENIKYLAIESDFNPQPVINLMLALGIDP
FT                   GITAKMRVTAKRNEALQAFRTRYLEIKEQLDFVRKKLETLALNAGNIVDVNGLRNYHQK
FT                   LADIPIDKFEQVKAPNDFKKVVYDEAAIQKIGEAYKILQDLDHFYKMYSERLEKEVEYA
FT                   REVRKVVEEYPGLFLTDGLKEFLHEAFAVLADSSRLVNRSELLSLLGKLQQARQKYVTA
FT                   YYRAHEKCVGERAGWNKLQELTASQTWKNLLLLKNVTVLNKYPLARVENEISVLATQRC
FT                   EGFKVELIEKSPLCPRCNFPKSFRGENIGQWIANLEDELEDIFREWEETILAEVKNYQD
FT                   NLDYLEAGERELILQVMKAGKLPPVVTEDLVVALNNLFRELVSVEVSPAELLEAVFAGA
FT                   RVMDYFTFERRLNAWKQKLVAGHDLDKVRIKLAGGEA"
FT   gene            665290..667848
FT                   /locus_tag="Moth_0639"
FT   CDS_pept        665290..667848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0639"
FT                   /product="DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18967"
FT                   /db_xref="GOA:Q2RKS2"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS2"
FT                   /protein_id="ABC18967.1"
FT                   /translation="MDYETGSLFEAKNDPKLEPEDDFARSCPPLSELLDTVRHVEGFPL
FT                   GRDEDILALSDPPYYTACPNPYLGEFIRRYGKPYDEATDTYQRPPLVADVTEGKNDPVY
FT                   NAHSYHTKVPHKAIMKYIEHYTEPGDIVFDGFCGSGMTGVAAQLLGRRAILCDLSPAAT
FT                   FIAYNYNTPVDVAAFEREAKRILAEVEKECGWMYETLHTDGRTNGRINYTVWSDVFICP
FT                   YCGSEYVFWEAAVDKERGKVLNEYPCPSCGAKVAKRECKRAWVAFYDQVIGQEVTQAKQ
FT                   VPVLINYTVGKKRYEKKPDQYDLDLIRRIEESAIPYWFPTDRMLEGDKTVEPIRLGITH
FT                   VHHFYTKRNLWVLAALNSKISAAKGTGVAAVLRFLISSYNHTHSTKMTRIIFKDTGKPV
FT                   LTSCQSGTLYISSLPVEKNILQGLTKMKLALISRALKALSYEQAITTSSSTGFSLISIY
FT                   NNCIDYIFTDPPFGSNLMYSELNFLWEAWLRVFTNNRPEAIINETQGKGLPEYKELMTA
FT                   CFKEMYRLLKPNRWMTVVFHNSRAAVWNAIQEAITRAGFVIAQVTVMDRKQGSFNQVTA
FT                   AGAVEKDLIINAYKPKKQMEENFLRRAGAGLERDFVADLLEHLPVVPNVGRTEKMLYSK
FT                   LLAYYVQRGFEIRLDARQFYVLLKENFKLIDGYWFTDEQVLQYEEWKRKQRLDGIKEVQ
FT                   SGQQIFFVSDERSALAWLYNFLETPRTYTDIYTAYSRALVQSDDAIPELKELLDNNFIL
FT                   ENGRYRRPQTEQEREAIEAQRERELGRAFERLLAEARSGVKRLKGVRKEALIFGFTKAY
FT                   REKRYQDILAVARKLDQDFLETNGEINDFVEIARLKTGEE"
FT   gene            667852..670770
FT                   /locus_tag="Moth_0640"
FT   CDS_pept        667852..670770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0640"
FT                   /product="Helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18968"
FT                   /db_xref="GOA:Q2RKS1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS1"
FT                   /protein_id="ABC18968.1"
FT                   /translation="MQPGILVRSTIYPEKGIGLVLGNEEFFDQVYVHVFFEKTRERLTL
FT                   PLADLSPLHDPLAKMEAGSFSTASRFQLRWLVEQILAENSGEGLLAAGGFKIIPLPHQL
FT                   LAVSFVLDQFKPRVLIADEVGLGKTIEAALIYEELKARGMVKRVLVVAPSGLCLQWREE
FT                   MKTKFGEDFIIYDRSTVHSLKQLHGEMTNVWTLADRVITSLDFIKPKKITADLDERAAR
FT                   ARRWHNEQVFAAAAAAWFDMVIFDEAHKLTKDMTGEETARYKAGHALVQAAPIVLLLTA
FT                   TPHQGDQHKFRNLLRLIDPYLFSGEGRITAEDVKKVTVRNNKRAVVDFHGNRLFKQRVA
FT                   TVCLIHRDEVADQVELDLYRAVTDYVTTFYELARQQNNFTMMFLLLIYQRMVSSSSPAI
FT                   LKSLSARLAALEELRRRAADQEPESEREEPDWDDLQELTAEEQLAELTRASAAPRAGIV
FT                   IVPAALAAEIAALKKCLALAERATAGRNDIKFTRLLEIINELRIQENNPRLKFIIFTEF
FT                   RETQAYLEERLTSLGYRTALINGAMSTTERIAQVERFRREADFLISTDAGGEGINLQFC
FT                   HILINYDLPWNPMRLEQRIGRIDRIGQEHDVKVINLQLADTVENRVREVIENKLDTIRR
FT                   EFCAGEDKLADILGVLQDEFDFEKVYIEALLKQGRKAANLDALSWQIFERAREIVEEER
FT                   LALPISNLAPEYVLASQRDLEKRAKRVQRLVEQYLQVYGASLHPYKLREGVYYFQDPRS
FT                   GRRLHNVIFQQKYALANEGAELLSFQHPYMVELLAHLEDALREDTSAKLLVRERKFSGE
FT                   KGFLFIYRLTLTNYLDPTVYYLVPCFVSFAGDTGRVNGRISRYFRDWEQLICTDLVTGE
FT                   IPYNLKEAWQLARKAVQQEAEVLFFQAKERLEKRLRDEEEKFEKYYKDREAAIEKIAVD
FT                   NIRAAKKKELEEDRKTRRQEWLRRRQLVPSLSLEQVAYVEFA"
FT   gene            670767..672305
FT                   /locus_tag="Moth_0641"
FT   CDS_pept        670767..672305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18969"
FT                   /db_xref="GOA:Q2RKS0"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKS0"
FT                   /protein_id="ABC18969.1"
FT                   /translation="MMSEKWYAKLVNKIKRSYHDVVVVVDHDRLGRLPELRAALADTFA
FT                   LHDYKGELPLRRFLREHTGQRMLIFKHPEHGHLPYDVETRSDVISWHLQEIFPKLHPAA
FT                   LEGLSEEDYQRVFEAYVQKENTFQVLGLEETKEVLAGWLGTSMVGGFVPDIVARPSQEG
FT                   EGGIKCRCQALVREIEGLLSRRPVDWRAVAPLWGELSYCYCQARSKPPEIDALDQKISG
FT                   AFTEYILTSYHELFYESYLTRPATVDKVLPFLAYQPAAKKVLICMDGMGFQEWCCLKQY
FT                   LAGRGIDSFSVTAVFTLLPTLTRVSRRALFCGRPALGDRVEEERGFLQFVREKWLEGER
FT                   RQAGVFMNIDGRWRHEYLDFDYLALACNLVDDLAHASVSVQDSKELMQKSLIMHLDGSG
FT                   FAETMQRLLEEGYRVYLVADHGSVWCRGNGHQASKWLLEEKARRALLFPNKLLAEDFAA
FT                   GKNLIVYENSSLFGDAVAVFPPGREMFGPKGETVISHGGIHIEEVIVPFIEVQA"
FT   gene            672358..673098
FT                   /locus_tag="Moth_0642"
FT   CDS_pept        672358..673098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18970"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR9"
FT                   /protein_id="ABC18970.1"
FT                   /translation="MSRNIIIGFDRPLRPHWIYESLLLARPAQRLAELYAPFEQIVREL
FT                   TGREGKRKVRTVLFRCFLRDEQNKARVRPNLVLKDLSLQYGLDFMTPIYLFYLVARTEV
FT                   LRRISDHIFRLYDYGSEIKLGFLKAKMVESFGERDVVLRSARAFIQTLEHFGVVARLDG
FT                   RLILYRKLPVSEEQAIIMLQLFAADILHSPQISLHHLPAAVFNFFDLPDLRTVAQKYNG
FT                   ELWDYQYRMVDAYLVLHSGDFPER"
FT   gene            673123..676674
FT                   /locus_tag="Moth_0643"
FT   CDS_pept        673123..676674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18971"
FT                   /db_xref="InterPro:IPR025093"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR8"
FT                   /protein_id="ABC18971.1"
FT                   /translation="MWINAHVNLPGELVTAQGEGRLVIFAGAGVSKGSPSNFPDFEGLA
FT                   DEVMSRSAQILTRGKAEPVDHFFGRLKKKGVHVHRIVREILTRPDAKPTKLHKELLSLF
FT                   RNPQEVRVVTTNFDRHFSTAASKLFGDNKIPVYWAPALPLGHRFNGIVYLHGCVDQEAE
FT                   EFILTDSDFGRAYLTEGWATSFLKSLFGKYAVLFVGYSHNDQIMEYLGRSLPPESLRFA
FT                   LVPEDIGEEEREKWKLRGIEPIFYPHTKGDIDHQALIEAVEAWASRTKMGLLEHEQRIK
FT                   EIVRNVPPIDQEEVDYILETLRDPARARIFTTYAETPEWLRWVEKRDVLKPLFKGEAPA
FT                   DDLATVFANWFVDKFALAHPEEALAVVHRQGLTFAPVLWWRIAHALTYNKKPLDPAVLG
FT                   KWVPLLLQSAPQLARQVRDVLSIMLGYCRYPDDATTALLLFRKLTEPMFILEPYIPLVA
FT                   QDDHNRKVNFEITIPGELYWLEKAWNELFKPNLNVLAGELEAILTTHLREAHRLLCSVG
FT                   SADNKWDPMSFSRIAIEPHEQDQYPRNVDVLINAARDVLEWLVANNHERANVVIEEWAA
FT                   SDVPLLKRLAVHGIRVCSYLQPDEKLGWLLGKGFLFAYGLKHEVFQLLKTAYPLASGIV
FT                   RQQILDRVEHYLEHDKDDEREIRPYEVYNLVVWLHQVAPDCALAAEKLREIRERYPDFE
FT                   PRKHPDLDRIISVGWHGPQSPLTTDELLARSPYERVEFLLTYQGEEFFGPNRRGLLELL
FT                   KDAVAKSFQWSWELVKELKARGEWTTDLWGVIISGWQNAPKDAGQWEQVLGLLESEPEL
FT                   LRRSGYEVAGLLVSGVEKGEGGLPVSLLDRAEACADRLFMETENAAVMETGDWLLRAIN
FT                   HIGGKLTEFWLHALARRRKEKGSGWVSLPEEYKNRFARILSGQSASAEMGRVLLASQLL
FT                   FLFALDRDWTRENIIPLLDWNIDSKRAEQAWHGYLFWGKWNEAFLPELLPLYVQASREL
FT                   PAEPDRIRERLYEHLASIAVQSSINPLQEGWLGKCIVAADEKERIKWANSIWHELASLP
FT                   KEATSQLWGKWMEKYWENRLFGIPIPLSPGEAGAMVNWALELEPVFPSVVEKIISGPTP
FT                   NLERGTFYYRLSQEKIAKKYPEDVARLLVYLLSGTDMPFYWCTEVKNIFEQIATAGLSE
FT                   EKLSLLREQLIRLGCLL"
FT   gene            676760..677023
FT                   /locus_tag="Moth_0644"
FT   CDS_pept        676760..677023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18972"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR7"
FT                   /protein_id="ABC18972.1"
FT                   /translation="MSKIALISCTSRKKAYKCPARELYWESPRFRLAYALAKLVANKIF
FT                   ILSAKHGLVPEDRVIEPYNETMIGKSARERREWGDMVLVDCQ"
FT   gene            complement(677127..677885)
FT                   /locus_tag="Moth_0645"
FT   CDS_pept        complement(677127..677885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0645"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18973"
FT                   /db_xref="GOA:Q2RKR6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR6"
FT                   /protein_id="ABC18973.1"
FT                   /translation="MSNKLTAYLESQMQALKLKGMLAHYQEITEKASQNNLSYTEYLSL
FT                   LFEEELKRKNEGTVKTKINKARFPFIKTLEEFDFSFQPSIREKEIISLSSLDFVEKKEN
FT                   IIFLGPPGVGKTHLSVALGIKACMAKYRVVFITAQKLLEELLLSAKDGSLLDKLLGYSR
FT                   LNLLIIDELGYMPVTKEQANLLFRLVSMRYEKGSIILTSNYNFNEWGEIFSDQVVAAAI
FT                   IDRLVHHARIFYINGTSYRLKGKLKAANDR"
FT   gene            complement(677882..678511)
FT                   /locus_tag="Moth_0646"
FT   CDS_pept        complement(677882..678511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18974"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR5"
FT                   /protein_id="ABC18974.1"
FT                   /translation="MSGAYVQSAGVNPEPRKVSNDGYISHDGNLYPVPMRYCLRRVWVE
FT                   NIYGRRLKVYDEEGALLAEFDLDLKKQTARPLHPEHETINRQYQEKKLKLRSALVEKFT
FT                   SAFGEDGQRYLEGLRDKNGANLYWHLAEILSYQEIYTPEDIIAAIKECLKIGSYHKNSV
FT                   KRLLERKEIAPLSCACDPASVNMPPGKIKRDLSCYALKESEVAAVS"
FT   gene            complement(678580..679464)
FT                   /locus_tag="Moth_0647"
FT   CDS_pept        complement(678580..679464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0647"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18975"
FT                   /db_xref="GOA:Q2RLG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG5"
FT                   /protein_id="ABC18975.1"
FT                   /translation="MLRIVGVSRSTYYYQLTHEPKPHTTTGGRPFPGHSLTVGGRKVSD
FT                   EQIKEWIMESISGDGYAYGYRKLTHMLRQDHELVVNEKKVYRLCKELDILRPQRNLRRK
FT                   HPRNLAQNRTITAPNQLWEVDVKYGYIAGEDRFFFVLSYIDVYDRQIVGYHIGLTCEAR
FT                   HAVETFRAALWKRQILQRNLPLPIIRSDNGPQFVSHLFESECERWNVLHERIPPKTPNM
FT                   NAYIESYHRLLEDECLSMGEFGTYAEAYQAVVEFVSRYNNRRLHSSLHYLSPAKFYRRH
FT                   IETGLQPRYPVRV"
FT   gene            complement(679509..679850)
FT                   /locus_tag="Moth_0648"
FT   CDS_pept        complement(679509..679850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0648"
FT                   /product="Transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18976"
FT                   /db_xref="GOA:Q2RLG6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RLG6"
FT                   /protein_id="ABC18976.1"
FT                   /translation="MERRKFTLEFKRQVVEQAIAAGNNSVVARKYDIRPNIVSRWVRQY
FT                   KAGQPMQGSSPKGNATHVTQQEHARLVAENRELDKQNTHLKQLLGEKDLEIAILRDLLK
FT                   KANPHLQIK"
FT   gene            complement(679902..680822)
FT                   /locus_tag="Moth_0649"
FT   CDS_pept        complement(679902..680822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0649"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18977"
FT                   /db_xref="GOA:Q2RKR2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR2"
FT                   /protein_id="ABC18977.1"
FT                   /translation="MYKWQRIKALHAQGVGIRQIARDVGVSRNTVRKYLKEAGPPQFKA
FT                   REYTKELDKFLEEIKVMLAKGYIGTRIYKELKDKGYQGSLASVHRYLRAIKEDDRTAKL
FT                   ATTRVETGPGKQMQYDWKVWTLPVDGKLVKIYLHEVVLSYSRMKFYTFSLSITTADVIR
FT                   VLIEAIDFFGGYAPELVIDNGKQMVITHQKDGIVRYNDEFLKFCGMYGIEPCPCANYRA
FT                   RTKGKVERPFYYVQEHLLRGLEVGNLNEFAVKLSEFQEAYNKRPHSTLGRPPAEMFAEE
FT                   KECLVKIPAVEPALLHHKEPLKPRN"
FT   gene            680950..682098
FT                   /locus_tag="Moth_0650"
FT   CDS_pept        680950..682098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR1"
FT                   /protein_id="ABC18978.1"
FT                   /translation="MVLSQLSKVSDVDHDDFIVLAGEVYHENLLPHLSHFWLPLKGKRQ
FT                   GEWISELEKLIKLEKETDKVLVLHMLFSALPRLDWTMIGQLPYQNGIYIMFEKGESYRN
FT                   MDRIVRVGTHRGQDRLKKRLRDHFVREDADSSIFRKNIGRTFLNMTLDPYLQVWEIDMH
FT                   KSGEKRDYGHLIDERLEAELEAKISQYLRSSITFVCFPVDEEEERLRLEEGIIATLNSH
FT                   PSFGPSNNWLGLNSPVPEIAGSGLWNRQGLDGQPLSANEVERIKWLVRFGNDSYRNNAG
FT                   YKARIQRAVNCVTMTGKNYNSERKTADDIRKYIDKLLQEAKRRGEDYIDLVSGDIHKQL
FT                   GMKNRMPQVCRIMYEKMQAGDKVIHTTPSGKSSTIKIRYYLK"
FT   gene            complement(682435..684243)
FT                   /locus_tag="Moth_0651"
FT   CDS_pept        complement(682435..684243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0651"
FT                   /product="Glycoside hydrolase 15-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18979"
FT                   /db_xref="GOA:Q2RKR0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR0"
FT                   /protein_id="ABC18979.1"
FT                   /translation="MRDILKHRPYYGFIGNGETAALVAPDFAITWLCVPRFDSFPLFAA
FT                   ALSPERGGSLRLDIEPAVNPVSQRYLPDSNVLETVGRGQGLQVTVLDFMPWGYHHLTRL
FT                   IILENTGVDTLKPRVRWQASPIITGAHTFKVQSRGSFQFIYGPGGAACIGMAGAPGPTS
FT                   TLTLKPGEKHRLWLVLAYGTNLTLARQHWTVGFYSSLEENLAWWRRWFKKARRPNTTSA
FT                   EVMEAYYRSLMVLKLLTYERTGAIIAAPTTSFPAVPGGNDNWDYRYCWLRDGYFTALAF
FT                   DAAGYHEEARSFYDFALSLQQPDGGWYMPLVPVEGRGGKEYIAADLAGPHGEKPIRFGN
FT                   AAMHQIQLDNAGNVLDGLWNHYLATRDREYIRSRWDAIRRAALWLENYWDRPENGIWEI
FT                   RERKDHWLYGKILCYAGLTAASHLSIEMGRLQWAGRWHRAASRVRRQLLIQGWSAERQA
FT                   YLQHYGPDAPLDISVLALEFYGLLAANHPRLLKTVAAIEQPSPVAKGEPATRGGLNMWG
FT                   GIARFEQAAIPFYLPTLWLGRYYLHAGNYERARELLQVCLDNATDLYLMAEHFDPRTGE
FT                   QWGNFPQGFSHQEIVRFLLDYAYRED"
FT   gene            complement(684568..684987)
FT                   /locus_tag="Moth_0652"
FT   CDS_pept        complement(684568..684987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0652"
FT                   /product="Protein of unknown function DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18980"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ9"
FT                   /protein_id="ABC18980.1"
FT                   /translation="MKVVLDTNVVISGLLVPEGPPGRIIDLWADGKIDVVVSPAVITEY
FT                   MEVFLRPKFAKAGTMEERQQLLEGFINLANTILVLPDIEIDIINADPSDNRFLECARTG
FT                   ETDCIISGDSHLLALKEYEEIPIITPGQFLEMIPV"
FT   gene            complement(684984..685262)
FT                   /locus_tag="Moth_0653"
FT   CDS_pept        complement(684984..685262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0653"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18981"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ8"
FT                   /protein_id="ABC18981.1"
FT                   /translation="MERIAGINEVRPKLTSFIETLKNDSPVVITINSEPKAVLLDYEKY
FT                   RLLQKTAEENKRLALKASLAKIRARAATNGFTQADVEKEIKEYREGK"
FT   gene            685509..685877
FT                   /locus_tag="Moth_0654"
FT   CDS_pept        685509..685877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ7"
FT                   /protein_id="ABC18982.1"
FT                   /translation="MGGFVPVMKGKPLFSSDQIVNISDLQRKWRSVVEPKLHKMPFLMM
FT                   FSGSEPRATILSYDRFTELWEKVAEAAELELKLELLCRILENEKGGQALVPLAEVIKKA
FT                   GITAEDLEAAPDVDLEND"
FT   gene            685855..686223
FT                   /locus_tag="Moth_0655"
FT   CDS_pept        685855..686223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18983"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ6"
FT                   /protein_id="ABC18983.1"
FT                   /translation="MSTSKMIDLVPANVKFFPAAEADFLGLDKSRQIKVIKALQKISRA
FT                   PSAFGKELENQAGRPLAGYRSVYVDNRSLRIIWKVTELQVIEVAIIAGIAEREGMLAYK
FT                   LVSRRRGELEKFIKELVK"
FT   gene            686504..688486
FT                   /locus_tag="Moth_0656"
FT   CDS_pept        686504..688486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18984"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ5"
FT                   /protein_id="ABC18984.1"
FT                   /translation="MKKRIVSLLMAAILLLLLPVTPSAATPQFTDIQNHWAKDYILSFA
FT                   NKGFVKGYPDQTFKPDRPISRAEFTCILLNCLGITPASDVNTPTFSDTTNHWTRAQIAE
FT                   AVRRGILVVSEYPGGLKPDDPIYRSEAAAMMIRALGKSPDMTPTSFKDSNQIAKSMYRG
FT                   YIKAASSEGLMHGYPDGTFRPFQGVKRGEACAMLVNLLGKIGTASPPAVQVNPSSNSAL
FT                   SALVIQGNRYKLGDTVVYLKRDSTNIPIYSLSVAGGLVFINNTFTYPLNSTDNNPDLVV
FT                   NNTRYVQCRLSVSGSDLQVTPGAVKLDSISYNGYKYNADYVKLYIGNKNGSYYLSDAEL
FT                   VDRQTIRVGGNSYDIGSTPVSIALGDNFYAINGINYDSSSISLDLAATTPVVTNGLDIS
FT                   DISAIFVDTRSLDLNTISSLFFIIDGSRYDRSEVVIDASGNFTANNKYYTPDQVTMVIN
FT                   NSFYKLTDVKSFGGKFIFYCTASNVTTWAIVNDKYQDASTIQILMGNNIYTLDKILVVQ
FT                   HNVIRIGGRQYKLGDIFGCRINGTLYDIEDIDYDNSLDLVTMDVTESTGSWTGYLPGQP
FT                   QKYLFYVDNSIYQDGATGNVTIYAGGGWRTFDSITFSDQSHFVYDNTTYNLLGAEIKIG
FT                   DTVFTVVDSAWRVSSQVMEVYLQKA"
FT   sig_peptide     686504..686578
FT                   /locus_tag="Moth_0656"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.759 at
FT                   residue 25"
FT   gene            688890..689138
FT                   /locus_tag="Moth_0657"
FT   CDS_pept        688890..689138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ4"
FT                   /protein_id="ABC18985.1"
FT                   /translation="MDTQYAVRDSLQKSDNIPQREIARHTGLSFYCAAGLAGIDGNILV
FT                   ITWQAWGDFLLSYGEIYLDRMYEFGSRKKLLGTRNNI"
FT   gene            689229..689495
FT                   /locus_tag="Moth_0658"
FT   CDS_pept        689229..689495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ3"
FT                   /protein_id="ABC18986.1"
FT                   /translation="MSLMPRNTIKPALQELAKRNAELYEKYGRPLEKEHKGKFIAISEE
FT                   GKVIIDPNDVQVAQKAIEEFGPGRFAFYKIGFKATGKWRITRP"
FT   gene            689492..689691
FT                   /pseudo
FT                   /locus_tag="Moth_0659"
FT   gene            689865..690578
FT                   /locus_tag="Moth_0660"
FT   CDS_pept        689865..690578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0660"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18987"
FT                   /db_xref="GOA:Q2RKQ2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKQ2"
FT                   /protein_id="ABC18987.1"
FT                   /translation="MRYQLSILGLYWAVLNPLLMALIWGFVFSQIFRVQGIEGVPYVVF
FT                   LFCGITFWNLFANSLLSAVNCLTGNASLLAKLYFPRVILPAASVVARVVDFSFSLMVLI
FT                   ILMLINKVSPGPKWWWVPLFVAIQLIFTLGMAYIVAALNVLYRDVNQILGILLMLWMYM
FT                   SPVLYTIEQVPVNFKKYFLFNPIGQLINMETRAILGSGQVDGYALGITIVIAIGIYVVG
FT                   RLVFRYLEPIFAEVM"
FT   gene            690562..691330
FT                   /pseudo
FT                   /locus_tag="Moth_0661"
FT   gene            691427..692914
FT                   /locus_tag="Moth_0662"
FT   CDS_pept        691427..692914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0662"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18988"
FT                   /db_xref="GOA:Q2RGB3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RGB3"
FT                   /protein_id="ABC18988.1"
FT                   /translation="MYKWQRIKALHAQGVGIRQIARDVGVSRNTVRKYLKEAGPPQFKA
FT                   REYTKELDKFLEEIKVMLAKGYIGTRIYKELKDKGYQGSLASVHRYLRAIKEDDRTAKL
FT                   ATTRVETGPGKQMQYDWKVWTLPVDGKLVKIYLHEVVLSYSRMKFYTFSLSITTADVIR
FT                   VLIEAIDFFGGYAPELVIDNGKQMVITHQKDGIVRYNDEFLKFCGLYGIEPCPCANYRA
FT                   RTKGKVERPFYYVQEHLLRGLEVGNLNEFAVKLSEFQEAYNKRPHSTLGRPPEEMFAEE
FT                   KGCLVKIPAVEPALLHHKEPRKVSNDGYISHDGNLYPVPMRYCLRRVWVENIYGRRLKV
FT                   YDEEGALLAEFDLDLKKQTARPLHPEHETINRQYQEKKLKLRSALVEKFTSAFGEDGQR
FT                   YLEGLRDKNGANLYWHLAEILSYQEIYTPEDIIAAIKECLKIGSYHKNSVKRLLERKEI
FT                   APLSCACDPASVNMPPGKIKRDLSCYALKESEVAAVS"
FT   gene            692911..693669
FT                   /locus_tag="Moth_0663"
FT   CDS_pept        692911..693669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0663"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18989"
FT                   /db_xref="GOA:Q2RKR6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKR6"
FT                   /protein_id="ABC18989.1"
FT                   /translation="MSNKLTAYLESQMQALKLKGMLAHYQEITEKASQNNLSYTEYLSL
FT                   LFEEELKRKNEGTVKTKINKARFPFIKTLEEFDFSFQPSIREKEIISLSSLDFVEKKEN
FT                   IIFLGPPGVGKTHLSVALGIKACMAKYRVVFITAQKLLEELLLSAKDGSLLDKLLGYSR
FT                   LNLLIIDELGYMPVTKEQANLLFRLVSMRYEKGSIILTSNYNFNEWGEIFSDQVVAAAI
FT                   IDRLVHHARIFYINGTSYRLKGKLKAANDR"
FT   gene            694102..696930
FT                   /locus_tag="Moth_0664"
FT   CDS_pept        694102..696930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18990"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP9"
FT                   /protein_id="ABC18990.1"
FT                   /translation="MDKMKTRILVISEYFSRGGLETHIVGQARVLSKLGVDLLLATGSS
FT                   AADCPDGVFAAALTDLRMGAQVSYDELCVTLKRLKKFISDERITLIHAHPFYSAIVGLL
FT                   AAQQSRLPFVVTIHSPLSLSSTFGQLYDFLLKSVVLPVAGRVFCVSKETELLCRSLAEC
FT                   RTELLLNAVQIQNSNPPNVAKDGPWLWAGRLDKDKSNGLLDLIEKIDQATVGELHIFGD
FT                   GPQVHLIESFLNSRPDKAEFVRLMGWRHNITTIMPAYAGIAGMGRVILEGSALNRPCLL
FT                   VGYDGVKGLLDINRFERASFWNFSGRGLPTITADALHQEFYRLSKDKGPFLLRQWVADN
FT                   RDERVIWQRYAEKIKDLAPLDNPLAQNILDALQYRGSISEPVWWDKELMRVILGLFSNE
FT                   PYGKEQAKSMTHQILVAHLHSKLEAIKYETTMLREKIDFLKSALAERDEKITSLNQAVA
FT                   ERDEKIISLNQAVIERDEKIASLQKHIQDIWASTSWRITRPLRFLKKLVSDPEPTTYFI
FT                   LKRIYWGLPGNLRIRLNGLRCLIIRFFLSKRKNNVGLMANQEGIHGLSWEEFQDKVLSK
FT                   REQHKGIFILEATHIDWNMNLFQRPQHMANALSKLGYLVIFKTANFYDNVSGFKKISDN
FT                   LWLTNNDKVDSIYGAVRSFYSTSSVYTKEIYDDRRKYGLVVYEYIDHIDPAISGDEENI
FT                   RRLNALKNYAFNGGVDFIVASAKALYREAVQAVGEDKVILIPNGVDVEHYRDQRHKYCT
FT                   IPKSLIKFKNVHKIIVGYFGALAPWLWYEEIEKLAALRPEVGFVFIGPDYYGGSSLLPK
FT                   AKNIFWMGPVDYKILPGYALHFDICFIPFRPGEIARTTSPLKLFEYFALEKPVIVTSSM
FT                   LECIQFCEVLSGSCATELSKCIDKALDLSRDEHFKKRLAELADQNSWIERAKKYEIIFE
FT                   QTKKWICHKKDI"
FT   gene            696946..698412
FT                   /locus_tag="Moth_0665"
FT   CDS_pept        696946..698412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18991"
FT                   /db_xref="GOA:Q2RKP8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP8"
FT                   /protein_id="ABC18991.1"
FT                   /translation="MLINSFNNYNKLSRSLKNSLSLCLHFLTLFSMILAAILAIIHLAQ
FT                   LSRCWLIVSVFIAMIVAFILGNPHGIITRSSTKSFLYIMLVVTLLIRMIWIIMVPSLPV
FT                   SDFAGYHFMALDMSQLDFKHDTVQEVGYPVLLGILYAVFGGHVLVGKILNVTLSLLTAL
FT                   VLFLLAREAFSEFSARNALILFSLWPAQIMMNSVLASEGPFLLMFLVVLLLLVKAKSDD
FT                   SKRRQALCFMAGLILGLSCTIRAVGFLLLFVVLAYICFIDGNKTNKWQILKLLLAGFFL
FT                   VVIPYYLFRWLTFKIPPTVSSLPFNLLYGTNIGYIGMWNPEDAALAHKLIEQYGSRASR
FT                   YILGVAFSRMISNPMGLLKLMCNKFEVMWSDDAYGAYWSTINIAPNLIEIPIIRVDLLY
FT                   ILSQLYYVFMLCLAIIGLIKIQKTIKIKMQRDKIYNVSLLFVLVIIGFVILHLFIEVQS
FT                   RYHYPVVAIIILLAGYGITENSVNFKNDSI"
FT   sig_peptide     696946..697053
FT                   /locus_tag="Moth_0665"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.473 at
FT                   residue 36"
FT   gene            698589..699734
FT                   /locus_tag="Moth_0666"
FT   CDS_pept        698589..699734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0666"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18992"
FT                   /db_xref="GOA:Q2RKP7"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP7"
FT                   /protein_id="ABC18992.1"
FT                   /translation="MQTPRLQRVLICRSNPVAPDPRVEKLAEALCKANYEVLVLAWDRT
FT                   GQLPREEERSGYRIVRFSHISPYGSGLKNIFKQLSWQFFLLRRLIQEGQGLALIHICDF
FT                   DTLLPCLLSKALGGKRIIYDIFDLYADSRRNIPTLIRKLLHVLEFKALEWVDAVILADE
FT                   SRREQIAGTRPRRLITIYNSPPDVLDTLRRNGPPPRLTELYLVYVGLLQVERGLLEMME
FT                   ILGRHPEWHLDLAGLGGGDEERILGLARSLPNVTWHGPIIYKRALKLSYAADVLIATYD
FT                   PTIPNHRYSSPNKVFEAMMLAKPVVVARNTGIDRLVEKINCGLVVPYGDVAALEAALIR
FT                   LARDPALRQQLGENGRRAYEEKYSWNLMRERLLALYRELSI"
FT   gene            699748..700189
FT                   /pseudo
FT                   /locus_tag="Moth_0667"
FT   gene            700280..701416
FT                   /locus_tag="Moth_0668"
FT   CDS_pept        700280..701416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0668"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18993"
FT                   /db_xref="GOA:Q2RKP6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP6"
FT                   /protein_id="ABC18993.1"
FT                   /translation="MTNTKGRVLYLATVYTHLAAFHLPFMQLLHGKGYEVHAAASSDQG
FT                   RKKEVEAIGVRCWEIPFSRSPYSLKNWRAFRELGRLLEYYRFDLIHVHTPVASFLGRYL
FT                   ARATGQRPVLYTAHGFHFYQGASLRNWLLYYPAERLAARWTDGLIVMNREDYDSAIKMG
FT                   FRPGENLFYVHGVGVDVDKFNSIVSSRSLRDKLGLKADDIVITCIAELIPRKNHLFLLK
FT                   AWSRLTKKICSAHLLLVGDGVLRQALECWVNGKSVSRVHFLGFRRDIPQLVQEANIVVL
FT                   VSRHEGLPRSLMEAMAAGKPVVASNVRGNRDLVDHGRTGFLVELGDVEGLAGYLELLAR
FT                   DENLRLALGRAGREKIGDYSLDKVLAEMDAVYSRYLPS"
FT   gene            701458..702804
FT                   /locus_tag="Moth_0669"
FT   CDS_pept        701458..702804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0669"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18994"
FT                   /db_xref="GOA:Q2RKP5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP5"
FT                   /protein_id="ABC18994.1"
FT                   /translation="MRWTKVVKIAGDLFLVNFSFWLAFWLRFGGSIPAVNWHAYRTISI
FT                   WITLAAFVLFYSYGLYVGGRYRWIEIFAALVWVVALTILSGLGISYMLQKYAFPRSVFL
FT                   LTAPIQLALLSIWRYAVWRFSIWLQGTLTLVVIGPTETACQRAREVTREDNRLYQVAGL
FT                   VVEGGSTTSEIEFPVLGTYHELPQALDASRPGAVLFCDGIPLEYREMMLKEIMARNLPA
FT                   FIVPDIYEIFLAQARLGQLDGIPVFRVDGFIAVPSRAWKRAFDIALSLCLSIIAIPLIL
FT                   LAALAIKIESPGGPVFYRQQRVGQGGRVFQLIKLRTMVPDAEKITGPVLATDKDPRITR
FT                   VGRILRATRIDELPQLWNVLKGEMSFIGPRPERPFFVEQFKKEVPGYDWRHQLKVGITG
FT                   LAQVQGRYSTTPADKLRYDLLYAKTISPLSDAQILLHTLKVMLMRDKAS"
FT   gene            702817..703473
FT                   /locus_tag="Moth_0670"
FT   CDS_pept        702817..703473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18995"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP4"
FT                   /protein_id="ABC18995.1"
FT                   /translation="MNDIKLLFNGIKTKLKQNGIDIAELNLEFTADAYADSWWEPNPDE
FT                   GYIYTYSGKIFLQKSWSEIDARKNIGEFRCLFIDNERALEQDNLFYIIDAHSSDLVTAV
FT                   TPLLEEGTWKIKNEYLENMNGFGILYIERLFIKPEYRDKGIGKAIFPVICSFLGRGAAA
FT                   VTVIPTPFDEKGKTKLDKNDPSYAKKIGGLKNFLSFFGFSLVDKENNVYARPLPL"
FT   gene            703930..704445
FT                   /locus_tag="Moth_0671"
FT   CDS_pept        703930..704445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP3"
FT                   /protein_id="ABC18996.1"
FT                   /translation="MVRVFIGFHGTSKASADMILLDKRFLPSNREDEWLGKGIYFFEDD
FT                   PDQAIDWCVRARKYKEWAILKTIIEAQEVLDLTRKLEWDMFLSIIKQLQGKMKQTKYKG
FT                   KRLLNGVAINFICQQFPYEVVRAVFLVPGRSYPYDITNIPPVQIQICVKEERCIKSIEQ
FT                   WRCSNGGF"
FT   gene            704665..705096
FT                   /locus_tag="Moth_0672"
FT   CDS_pept        704665..705096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0672"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18997"
FT                   /db_xref="GOA:Q2RKP2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP2"
FT                   /protein_id="ABC18997.1"
FT                   /translation="MIDKSIESHLIFRGYKVLYLSYKLNQNFKSQKNKSIPLDFKVRTE
FT                   STVDETNNEITVDLFCNIFEEGPEKDNPFHLKVNLRGWFKASSSVEKNELYRYAEINAP
FT                   AILFPFLRTVVSSVTMAANVPPVILPLVNINRLNEIQKQ"
FT   gene            705290..706303
FT                   /locus_tag="Moth_0673"
FT   CDS_pept        705290..706303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0673"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18998"
FT                   /db_xref="GOA:Q2RKP1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP1"
FT                   /protein_id="ABC18998.1"
FT                   /translation="MAKVLVTGGAGYIGSHVVKALGERGYRVLTYDSLVTGHPWAVLYG
FT                   DLVVGDLLDAAKLEAVIRDFRPDAVMHFAAHIVVPESVAQPLKYYINNVQGTLNLLACM
FT                   QKSGVNKLIFSSSAAVYGIPERIPVPEEAPLHPINPYGHSKAMVERILQDLSAAGGITY
FT                   VSLRYFNVAGADRDGRIGEGKEDATHLITLATRTAAGKRPYLSVFGTDYPTPDGTCIRD
FT                   YIHVEDLAAAHVLALEYLLDGGKSEVFNCGYGRGYSVLEVIAAAKKVTGVDFPVRYEGR
FT                   RPGDPPALVADARKIRERLGWVPAYDNLEGIIYSAWQWERKRNSVPARPATISTRR"
FT   gene            706860..707744
FT                   /locus_tag="Moth_0674"
FT   CDS_pept        706860..707744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABC18999"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKP0"
FT                   /protein_id="ABC18999.1"
FT                   /translation="MIMPDLVELIVLAAGKTNLRCLRLPERKIITLRPVGGVRDETEGE
FT                   ILRVIPNKEWEYKKHTYLSGKVIDSYIDGSVLTPVPLRLYLHGTWDSFYYFAELWEIDP
FT                   DRELPSSLPEWVIAVLKAGPREVFEMEQIIPGANPEEMEDPISLAVEYAHQGNIDKTWQ
FT                   ILHGCLTKDLRCIDAFVHLGTYTFGDGRSAWHAKRAMQRYLAGVKVGEQALPPGFNGLL
FT                   PWSWINNRPFLRALHGLGLCQWRLGQFDAARKTFWRILMFDPMDALGCRFILPDVEKGR
FT                   DYLATVADENGPC"
FT   gene            708160..711285
FT                   /locus_tag="Moth_0675"
FT   CDS_pept        708160..711285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0675"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19000"
FT                   /db_xref="GOA:Q2RKN9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN9"
FT                   /protein_id="ABC19000.1"
FT                   /translation="MATFDSITTELIAALEEEINAIKESGGAEQIRVHDGRYGGTAAGR
FT                   FLYIFLLDTELNIPSDTPAQLCIDKDSHETIILSVQGFEMTLGIQDDLGPFIPKAVLSL
FT                   SAYYLLEQLQRRLDEIRTGVLPAERDMCMRLFAFQANVSFPNVKPATSLGDLNREQMEA
FT                   VNRSLGQRVTFIWGPPGTGKTRTIGALVRELVQRGDRVLVTSHTNVAVDTALIPVIKAL
FT                   DDNEIQGGAVVRVGALAREDPELQQVTMEAVLERKSKDLRQQQQALGVERKRVQGVRDQ
FT                   LAATIRVIETVEKSEQLVATAKIALAGAEQKVQEEGNAISQARKTLGDLHSKLQQAEAA
FT                   GFIRRVFFGFNPEVIRRQIVNQETVITKLEAAYQVAQQERRAASVALSEAEHRQAKDRQ
FT                   ALESLGPLPPLPELRQQLGEVEKNLKQLDEQLAAIEARLREMAATVIRDARIVGATLSR
FT                   LVLLEELYRGTFDTVIIDEASMVPLPNLWFAGSRAQKRVVVTGDFRQLPPIATARDAEK
FT                   YPLAARWLQTDIFVKAGIVEGRARLDDPRLCALKVQYRMHEAIGEVANMLVYEHDGNPL
FT                   EHRADPKKYAHATAALPESGEPLVLCTTSGANPWCGRLDPGFSRYNIYSAIVCIRLAAR
FT                   ALASGAQNVGLVAPYRAQTRLLQHLVEQYRLPGERVETATVHRFQGNEKDVIIFDLVDS
FT                   PPFQIGKLLSGGWGSEAMRLFNVACTRAKGKLVIVAHHDYLSQKAPAGDSLATLLQYLE
FT                   QHGKIMDARMVVQDYADPAVKIALGAVMPARRQLGNPEGATHFNEGNFYPAFLEDLRDA
FT                   AGEVVIFSPFIAERRLADVITPLRRLVDRGVLVLVVTRERHESNQVTEELIRQLSTIGI
FT                   KVLRRRGLHEKLAFVDRKIAWFGSLNILSHSRSSEVMIRFSQPELVVRLMELSGTVYLL
FT                   KQEERRSVQKHRLTELADALKKRMAFPSCPLCGGTTGLRTGKHGPFFGCASFRNGGCKG
FT                   LINIPRRVLELAVQDLELTCPHCGGKVVLKSGRNGAFLGCSRYPDCRWTDSF"
FT   gene            711476..712096
FT                   /locus_tag="Moth_0676"
FT   CDS_pept        711476..712096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0676"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19001"
FT                   /db_xref="GOA:Q2RKN8"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN8"
FT                   /protein_id="ABC19001.1"
FT                   /translation="MAIYRKCKYCGRPISLREMPAGQWVAFDVGTDNVHHCGSRPTITP
FT                   PAVSAVAATLDTGTVTASPVVATSSEQIRALLKKALQEHRCVHLNYYTASRKALTDRVV
FT                   EPLALEPGDWGGTILRAYCRWRQDIRSFALSNIRRAELLEETFSPRSLPQSQPITIYRT
FT                   SISGRASIQASSKTPSTASESTGCIWWLIVVGVVLLWLLFGSR"
FT   gene            712122..712657
FT                   /pseudo
FT                   /locus_tag="Moth_0677"
FT   gene            712782..713054
FT                   /locus_tag="Moth_0678"
FT   CDS_pept        712782..713054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19002"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN7"
FT                   /protein_id="ABC19002.1"
FT                   /translation="MMALLQVKRRVEPGGRITIGEVLKMAKIKPGDWVEIIPGTNKITI
FT                   KLTKRSKSKGAVLAAAGILKDHPQLVDEMLHIREDEDDRSGVVPE"
FT   gene            713026..713502
FT                   /locus_tag="Moth_0679"
FT   CDS_pept        713026..713502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0679"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19003"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN6"
FT                   /protein_id="ABC19003.1"
FT                   /translation="MIDQGSYPNKYVVDTNIIIYTLAGVKAAVWAMKKLEDDDIEVYYS
FT                   TIVEAELFSFHELTLEQKSKIRGILDIGEIVDVDSKVALKAAELRALSKKDYNRKLKLP
FT                   DAIVAATALLLSAVLVTRNVEDFKHLRRHGLHLYNPFEHEEDNSQRFVSELEQN"
FT   gene            713637..714045
FT                   /pseudo
FT                   /locus_tag="Moth_0680"
FT   gene            complement(714122..715036)
FT                   /locus_tag="Moth_0681"
FT   CDS_pept        complement(714122..715036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19004"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN5"
FT                   /protein_id="ABC19004.1"
FT                   /translation="MPVDHDRLFKELLTTFFREFMELFFPAAHTLIDYTDTKFLTQEVI
FT                   TDITAGDKHYVDILAEVKIKGEDGCVLVHIEPQAYRQADFARRMFIYFSRLYEKHQKRV
FT                   LPIAVFAHDSKVEETNRHEVEFPFLKVLQFEFYKIQLKRLPWRQYLNSNNPVAAALLSK
FT                   MDYSPRERVQVKIEFLRLLTRMQLDPARMELITAFFDSYLVLNAEEEKSLQEKLSEELQ
FT                   PEEVQRVMELTTSWHLKGWQQGRQEGRQEILLRQLRKRLGTTSPEVEAKIKTLSAEQLD
FT                   DLAEKILDITSEAELHRILAIKH"
FT   gene            715166..715396
FT                   /pseudo
FT                   /locus_tag="Moth_0682"
FT   gene            715490..715828
FT                   /pseudo
FT                   /locus_tag="Moth_0683"
FT   gene            715863..715994
FT                   /pseudo
FT                   /locus_tag="Moth_0684"
FT   gene            complement(716184..716645)
FT                   /locus_tag="Moth_0685"
FT   CDS_pept        complement(716184..716645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0685"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19005"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN4"
FT                   /protein_id="ABC19005.1"
FT                   /translation="MGKIKEIITGHQVIALDTNCFIYMLQADPWALVLKKELFNPLEKG
FT                   EFQAVTSTLTLLELLVKPKALGLEEVCDQYITTLKSYPNLKLIDFNLEMAVLGAEIRAK
FT                   YRVRTPDAIQLASALASDATLFFTNDLSLPQAVGNMRTVFLKDVFPPRA"
FT   gene            complement(716633..716881)
FT                   /locus_tag="Moth_0686"
FT   CDS_pept        complement(716633..716881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0686"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19006"
FT                   /db_xref="GOA:Q2RKN3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN3"
FT                   /protein_id="ABC19006.1"
FT                   /translation="MLDIIKTVKLGARCQMVLPAEIRKQLGIKKGDEIIIKIRGKKAII
FT                   EPKPKSYAEHLWGLHKEVWAGTDPDKYVKEERDQWEK"
FT   gene            717360..717638
FT                   /locus_tag="Moth_0687"
FT   CDS_pept        717360..717638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0687"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19007"
FT                   /db_xref="GOA:Q2RKN2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN2"
FT                   /protein_id="ABC19007.1"
FT                   /translation="MLMSTQLVRLTSKGQMTIPQSVRETLGLKAGDYLTILVDEDEIRL
FT                   RKVQPVKPLSQEDPIWKLVGAGNSGLKDVAAKHDHYLANGEIERWKK"
FT   gene            717626..718024
FT                   /locus_tag="Moth_0688"
FT   CDS_pept        717626..718024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0688"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19008"
FT                   /db_xref="GOA:Q2RKN1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN1"
FT                   /protein_id="ABC19008.1"
FT                   /translation="MEKIMVDTSAIYALIDRSDDRHEKAKHLFKKLSEQDVDLILTNFI
FT                   LAETHALILSCIGHELAREWVKNLIWKIERVKEEDEKRAREIIIAYQDKSFSYTDATTF
FT                   AVMERLKLNIALAFDNHFTQFGWQCFDA"
FT   gene            complement(718273..720783)
FT                   /locus_tag="Moth_0689"
FT   CDS_pept        complement(718273..720783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0689"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19009"
FT                   /db_xref="GOA:Q2RKN0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKN0"
FT                   /protein_id="ABC19009.1"
FT                   /translation="MSFDISELLTLYDVVTFSFPERYEDLMREIIEKATRLFGVRRLAI
FT                   VLREGERYKCIERWGFRRDEEVLERIKNGGENSFIYLMRNGEQGLLYIEPPGRISEREK
FT                   RLYTIFARRIENIIARKQIEEKIKNSEQEKKVILDSIVELLVFQNPDNRILWANRAAAE
FT                   YAGARSEELAGRFCYEALHHRDEPCEECPVIKALDTGVPQEGIIASLEGRQFFVRGYPV
FT                   KKENGLIEGIVEVSVDVTERMQAEEAFRTIFNSVHDAIFIHTLDGKIIDVNQTMLRMYV
FT                   INSKEEAIKLSIIDDYSIPGSTAEQLPLLWQKVISGENLLFEWKARRPVDGSVFDVEVF
FT                   LKKISLSKKDVILAAVRDITERKREEELLRNLFTHSPIGMYIVSEGKFQLINPQFEILT
FT                   GYRQDKLIGMESLNLVVPEDRKMVRSNAIKMLKGEAVEPYEFRIVTGQGDIRWMEETVA
FT                   SIWHDGKRVTLGNIIDITQKKKFEQKLAYISLHDQLTALYNRAYFEEELKRLSTSRKYP
FT                   ITIIVADVNGLKLVNDTMGHDKGDELLTACARVLKKAFRSSDVVARVGGDEFVALLPRT
FT                   DGKTGKSILKRLRLFIDKYNQEHPELPLSVSFGIATADTPEQSLKEIYKKADDLMYQEK
FT                   LNLGSSARSKIVNALLTALSERDYITEGHARRMQKLCQDLGEKVGLSAQQLANLSLLAQ
FT                   VHDLGKVGIPDRILFKRGPLTEKEWEVMRQHPEKGYRIAMSSPDLAGIADLILKHHEKW
FT                   DGTGYPLGLKEEEIPIECRILSIVDAFDAMTSGRPYCRTKTIEDALKEIRRCAGTQFDP
FT                   RLAEAFIEMITSEKFTAGEKEVAT"
FT   gene            complement(720787..721917)
FT                   /locus_tag="Moth_0690"
FT   CDS_pept        complement(720787..721917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19010"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM9"
FT                   /protein_id="ABC19010.1"
FT                   /translation="MRVGVGFSSANDPSAAGQVASEQAVRQSGSPVITLVLTTDNYDQE
FT                   RVLSAVKRVIGNSRLVGACVPGVIVNARLYKRGVGICTVSGEGVEAVTHLQRNISQHSY
FT                   RKGEKAGEALLEKGGETPGTVLLFPDGFAANISGLLRGLYNVMGPAFEYIGGGSGDNLR
FT                   FYRTYQFTEEGISSDAVAAAVIRGINFQMCLSHGWRPVGEPLMVTKAKGRKVYEIDGLP
FT                   ALERYSALVGAYDKNDFSCYSMKYPLGLPCAGGEFIIRDPLKAEEDGGILFVTEIPENT
FT                   IATLMEGDTASLLAAAEEVSKKALNTPAAPKTFMVFDCVSRYLLMGEDFSREMEAIAKN
FT                   IKAEIPVIGMLSFGEISSISGTPLFYNKTIVAAAGW"
FT   gene            722267..722485
FT                   /pseudo
FT                   /locus_tag="Moth_0691"
FT   gene            722654..723466
FT                   /locus_tag="Moth_0692"
FT   CDS_pept        722654..723466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0692"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19011"
FT                   /db_xref="GOA:Q2RKM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM8"
FT                   /protein_id="ABC19011.1"
FT                   /translation="MLALPEKSVLLVEDSTLTRFSSRRVLEERGYLVDEAASGQEALVK
FT                   ARGKGEPYDLVILDIHLPGMDGLAVLENLKRLPEYRYVPVMVVTIESNVAVVKKAIDLG
FT                   AVEYLCKPYSVEELVRRVEKLIGPGARREATPAELLHKVLRNEINRASRGALNVALVLA
FT                   RSEGLGKGKIVECARQARRRLREIDTVIELSKSTLALVLPHTGKEGAQVVITKLAGLLP
FT                   GTWSYGVAVYPDNGKDGEELFAYAEASLKECWEKKTTGAPAQQQALDT"
FT   gene            complement(723477..723749)
FT                   /locus_tag="Moth_0693"
FT   CDS_pept        complement(723477..723749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19012"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM7"
FT                   /protein_id="ABC19012.1"
FT                   /translation="MDDRLFIPCPRGSASHHIAAEGKKDAHHEAEDKGSASAIFKDRLS
FT                   KRVPPGSRKRGCFTLTGIMVISGANTKRKACRRPLSDHGIEFTAE"
FT   gene            723881..724798
FT                   /locus_tag="Moth_0694"
FT   CDS_pept        723881..724798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0694"
FT                   /product="Copper amine oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19013"
FT                   /db_xref="GOA:Q2RKM6"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM6"
FT                   /protein_id="ABC19013.1"
FT                   /translation="METALIRLPDDGQREMENLLRSFYWLVVLVAFFFAWPVLEPALAA
FT                   DPVVAYEDPDTQRAMIAVRDFSTVLGGEVDWEAATSTVSIRVYGRPALYLDVKAGTLAG
FT                   VPLQPRPQIKDGVTYAPLRQVAEALGARVDWREDGIHVYTPAGEQVSIKYIHLLGRYTI
FT                   TFPEKEAGSPSLHNARLAGQYLNGLVVPPGGVVSFNNVVGPRTGARGFVPGIIFMGDQK
FT                   VPEIGGGICRTATLLHNAVLSAGLEVVERHRHGLPVTYVPPGYDATVYYGVLDYRFRNN
FT                   RPVPIKLEFTSQGSSITMAIWELG"
FT   gene            724996..725544
FT                   /locus_tag="Moth_0695"
FT   CDS_pept        724996..725544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19014"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM5"
FT                   /protein_id="ABC19014.1"
FT                   /translation="MKIITRNFKIVLKGKKEDFVDEALETRLFAFLSRIQAWGEAVTPD
FT                   ANLATVEQIDEEDTIPVSVDNELGVAREKAAAAKEAGDEEIMVHSQSISELRARATISN
FT                   NKELATLVVYYSDYCKKQPPATYDVRRIMREELREKAATVNSVSTYLQRARREGWVDLD
FT                   GKKWRITSTGLQMIEKMLR"
FT   gene            725792..726364
FT                   /locus_tag="Moth_0696"
FT   CDS_pept        725792..726364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Moth_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Moth_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABC19015"
FT                   /db_xref="GOA:Q2RKM4"
FT                   /db_xref="InterPro:IPR001827"
FT                   /db_xref="UniProtKB/TrEMBL:Q2RKM4"
FT                   /protein_id="ABC19015.1"
FT                   /translation="MGVVYPWMRESLLSHLNCLVPVYHLDGGNYTEIWFDDGRKELEKN
FT                   RTVTVLRRLARFLGINPRQNDTPWGRGGNRRATPIILFPELILVPLLLRRPRYRDQGGT
FT                   GYVVLQKIIDWEAAEMDGYHSVIFLEGNQKLYSVQGYESLSQRLIEARKAGWKLQKLEK
FT                   ALNQGLLVSRQVMTIQVDKTTGEITFR"
FT   gene            726414..728000
FT                   /locus_tag="Moth_0697"
FT   CDS_pept        726414..728000
FT