(data stored in SCRATCH3701 zone)

EMBL: CP000233

ID   CP000233; SV 1; circular; genomic DNA; STD; PRO; 1827111 BP.
XX
AC   CP000233;
XX
PR   Project:PRJNA13280;
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Lactobacillus salivarius UCC118, complete genome.
XX
KW   .
XX
OS   Lactobacillus salivarius UCC118
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
OS   Lactobacillus phage Sal2
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Lactobacillus phage Sal1
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Lactobacillus phage Sal4
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Lactobacillus phage Sal3
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-1827111
RX   DOI; 10.1073/pnas.0511060103.
RX   PUBMED; 16617113.
RA   Claesson M.J., Li Y., Leahy S., Canchaya C., van Pijkeren J.P.,
RA   Cerdeno-Tarraga A.M., Parkhill J., Flynn S., O'Sullivan G.C., Collins J.K.,
RA   Higgins D., Shanahan F., Fitzgerald G.F., van Sinderen D., O'Toole P.W.;
RT   "Multireplicon genome architecture of Lactobacillus salivarius";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(17):6718-6723(2006).
XX
RN   [2]
RP   1-1827111
RG   Alimentary Pharmabiotic Centre, University College Cork
RA   Claesson M.J., Li Y., Leahy S., Canchaya C., van Pijkeren J.P.,
RA   Cerdeno-Tarraga A.M., Parkhill J., Flynn S., O'Sullivan G.C., Collins J.K.,
RA   Higgins D.G., Shanahan F., Fitzgerald G.F., van Sinderen D., O'Toole P.W.;
RT   ;
RL   Submitted (16-DEC-2005) to the INSDC.
RL   Department of Microbiology, Alimentary Pharmabiotic Centre, University
RL   College Cork, College Road, Cork, Ireland
XX
DR   MD5; 9b1a0a4c15144a0f2d7ab84e68399740.
DR   BioSample; SAMN02604111.
DR   EnsemblGenomes-Gn; EBG00001051447.
DR   EnsemblGenomes-Gn; EBG00001051448.
DR   EnsemblGenomes-Gn; EBG00001051449.
DR   EnsemblGenomes-Gn; EBG00001051450.
DR   EnsemblGenomes-Gn; EBG00001051451.
DR   EnsemblGenomes-Gn; EBG00001051452.
DR   EnsemblGenomes-Gn; EBG00001051453.
DR   EnsemblGenomes-Gn; EBG00001051454.
DR   EnsemblGenomes-Gn; EBG00001051455.
DR   EnsemblGenomes-Gn; EBG00001051456.
DR   EnsemblGenomes-Gn; EBG00001051457.
DR   EnsemblGenomes-Gn; EBG00001051458.
DR   EnsemblGenomes-Gn; EBG00001051459.
DR   EnsemblGenomes-Gn; EBG00001051460.
DR   EnsemblGenomes-Gn; EBG00001051461.
DR   EnsemblGenomes-Gn; EBG00001051462.
DR   EnsemblGenomes-Gn; EBG00001051463.
DR   EnsemblGenomes-Gn; EBG00001051464.
DR   EnsemblGenomes-Gn; EBG00001051465.
DR   EnsemblGenomes-Gn; EBG00001051466.
DR   EnsemblGenomes-Gn; EBG00001051467.
DR   EnsemblGenomes-Gn; EBG00001051468.
DR   EnsemblGenomes-Gn; EBG00001051469.
DR   EnsemblGenomes-Gn; EBG00001051470.
DR   EnsemblGenomes-Gn; EBG00001051471.
DR   EnsemblGenomes-Gn; EBG00001051472.
DR   EnsemblGenomes-Gn; EBG00001051473.
DR   EnsemblGenomes-Gn; EBG00001051474.
DR   EnsemblGenomes-Gn; EBG00001051475.
DR   EnsemblGenomes-Gn; EBG00001051476.
DR   EnsemblGenomes-Gn; EBG00001051477.
DR   EnsemblGenomes-Gn; EBG00001051478.
DR   EnsemblGenomes-Gn; EBG00001051479.
DR   EnsemblGenomes-Gn; EBG00001051480.
DR   EnsemblGenomes-Gn; EBG00001051481.
DR   EnsemblGenomes-Gn; EBG00001051482.
DR   EnsemblGenomes-Gn; EBG00001051483.
DR   EnsemblGenomes-Gn; EBG00001051484.
DR   EnsemblGenomes-Gn; EBG00001051485.
DR   EnsemblGenomes-Gn; EBG00001051486.
DR   EnsemblGenomes-Gn; EBG00001051487.
DR   EnsemblGenomes-Gn; EBG00001051488.
DR   EnsemblGenomes-Gn; EBG00001051489.
DR   EnsemblGenomes-Gn; EBG00001051490.
DR   EnsemblGenomes-Gn; EBG00001051491.
DR   EnsemblGenomes-Gn; EBG00001051492.
DR   EnsemblGenomes-Gn; EBG00001051493.
DR   EnsemblGenomes-Gn; EBG00001051494.
DR   EnsemblGenomes-Gn; EBG00001051495.
DR   EnsemblGenomes-Gn; EBG00001051496.
DR   EnsemblGenomes-Gn; EBG00001051497.
DR   EnsemblGenomes-Gn; EBG00001051498.
DR   EnsemblGenomes-Gn; EBG00001051499.
DR   EnsemblGenomes-Gn; EBG00001051500.
DR   EnsemblGenomes-Gn; EBG00001051501.
DR   EnsemblGenomes-Gn; EBG00001051502.
DR   EnsemblGenomes-Gn; EBG00001051503.
DR   EnsemblGenomes-Gn; EBG00001051504.
DR   EnsemblGenomes-Gn; EBG00001051505.
DR   EnsemblGenomes-Gn; EBG00001051506.
DR   EnsemblGenomes-Gn; EBG00001051507.
DR   EnsemblGenomes-Gn; EBG00001051508.
DR   EnsemblGenomes-Gn; EBG00001051509.
DR   EnsemblGenomes-Gn; EBG00001051510.
DR   EnsemblGenomes-Gn; EBG00001051511.
DR   EnsemblGenomes-Gn; EBG00001051512.
DR   EnsemblGenomes-Gn; EBG00001051513.
DR   EnsemblGenomes-Gn; EBG00001051514.
DR   EnsemblGenomes-Gn; EBG00001051515.
DR   EnsemblGenomes-Gn; EBG00001051516.
DR   EnsemblGenomes-Gn; EBG00001051517.
DR   EnsemblGenomes-Gn; EBG00001051518.
DR   EnsemblGenomes-Gn; EBG00001051519.
DR   EnsemblGenomes-Gn; EBG00001051520.
DR   EnsemblGenomes-Gn; EBG00001051521.
DR   EnsemblGenomes-Gn; EBG00001051522.
DR   EnsemblGenomes-Gn; EBG00001051523.
DR   EnsemblGenomes-Gn; EBG00001051524.
DR   EnsemblGenomes-Gn; EBG00001051525.
DR   EnsemblGenomes-Gn; EBG00001051526.
DR   EnsemblGenomes-Gn; EBG00001051527.
DR   EnsemblGenomes-Gn; EBG00001051528.
DR   EnsemblGenomes-Gn; EBG00001051529.
DR   EnsemblGenomes-Gn; EBG00001051530.
DR   EnsemblGenomes-Gn; EBG00001051531.
DR   EnsemblGenomes-Gn; EBG00001051532.
DR   EnsemblGenomes-Gn; EBG00001051533.
DR   EnsemblGenomes-Gn; EBG00001051534.
DR   EnsemblGenomes-Gn; EBG00001051535.
DR   EnsemblGenomes-Gn; EBG00001051536.
DR   EnsemblGenomes-Gn; EBG00001051537.
DR   EnsemblGenomes-Gn; EBG00001051538.
DR   EnsemblGenomes-Gn; EBG00001051539.
DR   EnsemblGenomes-Gn; EBG00001051540.
DR   EnsemblGenomes-Gn; EBG00001051541.
DR   EnsemblGenomes-Gn; EBG00001051542.
DR   EnsemblGenomes-Gn; EBG00001051543.
DR   EnsemblGenomes-Gn; EBG00001051544.
DR   EnsemblGenomes-Gn; EBG00001051545.
DR   EnsemblGenomes-Gn; EBG00001051546.
DR   EnsemblGenomes-Gn; EBG00001051547.
DR   EnsemblGenomes-Gn; EBG00001051548.
DR   EnsemblGenomes-Gn; EBG00001051549.
DR   EnsemblGenomes-Gn; EBG00001051550.
DR   EnsemblGenomes-Gn; EBG00001051551.
DR   EnsemblGenomes-Gn; EBG00001051552.
DR   EnsemblGenomes-Gn; EBG00001051553.
DR   EnsemblGenomes-Gn; EBG00001051554.
DR   EnsemblGenomes-Gn; EBG00001051555.
DR   EnsemblGenomes-Gn; EBG00001051556.
DR   EnsemblGenomes-Gn; EBG00001051557.
DR   EnsemblGenomes-Gn; EBG00001051558.
DR   EnsemblGenomes-Gn; EBG00001051559.
DR   EnsemblGenomes-Gn; EBG00001051560.
DR   EnsemblGenomes-Gn; EBG00001051561.
DR   EnsemblGenomes-Gn; EBG00001051562.
DR   EnsemblGenomes-Gn; EBG00001051563.
DR   EnsemblGenomes-Gn; EBG00001051564.
DR   EnsemblGenomes-Gn; LSL_RNA001.
DR   EnsemblGenomes-Gn; LSL_RNA002.
DR   EnsemblGenomes-Gn; LSL_RNA003.
DR   EnsemblGenomes-Gn; LSL_RNA004.
DR   EnsemblGenomes-Gn; LSL_RNA007.
DR   EnsemblGenomes-Gn; LSL_RNA008.
DR   EnsemblGenomes-Gn; LSL_RNA009.
DR   EnsemblGenomes-Gn; LSL_RNA010.
DR   EnsemblGenomes-Gn; LSL_RNA011.
DR   EnsemblGenomes-Gn; LSL_RNA012.
DR   EnsemblGenomes-Gn; LSL_RNA013.
DR   EnsemblGenomes-Gn; LSL_RNA014.
DR   EnsemblGenomes-Gn; LSL_RNA015.
DR   EnsemblGenomes-Gn; LSL_RNA016.
DR   EnsemblGenomes-Gn; LSL_RNA017.
DR   EnsemblGenomes-Gn; LSL_RNA018.
DR   EnsemblGenomes-Gn; LSL_RNA019.
DR   EnsemblGenomes-Gn; LSL_RNA021.
DR   EnsemblGenomes-Gn; LSL_RNA025.
DR   EnsemblGenomes-Gn; LSL_RNA030.
DR   EnsemblGenomes-Gn; LSL_RNA032.
DR   EnsemblGenomes-Gn; LSL_RNA035.
DR   EnsemblGenomes-Gn; LSL_RNA036.
DR   EnsemblGenomes-Gn; LSL_RNA037.
DR   EnsemblGenomes-Gn; LSL_RNA038.
DR   EnsemblGenomes-Gn; LSL_RNA039.
DR   EnsemblGenomes-Gn; LSL_RNA040.
DR   EnsemblGenomes-Gn; LSL_RNA041.
DR   EnsemblGenomes-Gn; LSL_RNA042.
DR   EnsemblGenomes-Gn; LSL_RNA044.
DR   EnsemblGenomes-Gn; LSL_RNA045.
DR   EnsemblGenomes-Gn; LSL_RNA046.
DR   EnsemblGenomes-Gn; LSL_RNA047.
DR   EnsemblGenomes-Gn; LSL_RNA048.
DR   EnsemblGenomes-Gn; LSL_RNA049.
DR   EnsemblGenomes-Gn; LSL_RNA050.
DR   EnsemblGenomes-Gn; LSL_RNA051.
DR   EnsemblGenomes-Gn; LSL_RNA052.
DR   EnsemblGenomes-Gn; LSL_RNA053.
DR   EnsemblGenomes-Gn; LSL_RNA054.
DR   EnsemblGenomes-Gn; LSL_RNA055.
DR   EnsemblGenomes-Gn; LSL_RNA056.
DR   EnsemblGenomes-Gn; LSL_RNA057.
DR   EnsemblGenomes-Gn; LSL_RNA058.
DR   EnsemblGenomes-Gn; LSL_RNA059.
DR   EnsemblGenomes-Gn; LSL_RNA060.
DR   EnsemblGenomes-Gn; LSL_RNA061.
DR   EnsemblGenomes-Gn; LSL_RNA062.
DR   EnsemblGenomes-Gn; LSL_RNA063.
DR   EnsemblGenomes-Gn; LSL_RNA064.
DR   EnsemblGenomes-Gn; LSL_RNA065.
DR   EnsemblGenomes-Gn; LSL_RNA066.
DR   EnsemblGenomes-Gn; LSL_RNA067.
DR   EnsemblGenomes-Gn; LSL_RNA068.
DR   EnsemblGenomes-Gn; LSL_RNA069.
DR   EnsemblGenomes-Gn; LSL_RNA070.
DR   EnsemblGenomes-Gn; LSL_RNA071.
DR   EnsemblGenomes-Gn; LSL_RNA072.
DR   EnsemblGenomes-Gn; LSL_RNA073.
DR   EnsemblGenomes-Gn; LSL_RNA074.
DR   EnsemblGenomes-Gn; LSL_RNA075.
DR   EnsemblGenomes-Gn; LSL_RNA076.
DR   EnsemblGenomes-Gn; LSL_RNA077.
DR   EnsemblGenomes-Gn; LSL_RNA078.
DR   EnsemblGenomes-Gn; LSL_RNA079.
DR   EnsemblGenomes-Gn; LSL_RNA080.
DR   EnsemblGenomes-Gn; LSL_RNA081.
DR   EnsemblGenomes-Gn; LSL_RNA082.
DR   EnsemblGenomes-Gn; LSL_RNA083.
DR   EnsemblGenomes-Gn; LSL_RNA084.
DR   EnsemblGenomes-Gn; LSL_RNA085.
DR   EnsemblGenomes-Gn; LSL_RNA086.
DR   EnsemblGenomes-Gn; LSL_RNA087.
DR   EnsemblGenomes-Gn; LSL_RNA088.
DR   EnsemblGenomes-Gn; LSL_RNA089.
DR   EnsemblGenomes-Gn; LSL_RNA090.
DR   EnsemblGenomes-Gn; LSL_RNA091.
DR   EnsemblGenomes-Gn; LSL_RNA092.
DR   EnsemblGenomes-Gn; LSL_RNA095.
DR   EnsemblGenomes-Gn; LSL_RNA097.
DR   EnsemblGenomes-Gn; LSL_RNA099.
DR   EnsemblGenomes-Gn; LSL_RNA100.
DR   EnsemblGenomes-Gn; LSL_RNA103.
DR   EnsemblGenomes-Gn; LSL_RNA108.
DR   EnsemblGenomes-Gn; LSL_RNA119.
DR   EnsemblGenomes-Gn; LSL_RNA120.
DR   EnsemblGenomes-Gn; LSL_RNA121.
DR   EnsemblGenomes-Gn; LSL_RNA122.
DR   EnsemblGenomes-Gn; LSL_RNA123.
DR   EnsemblGenomes-Gn; LSL_RNA124.
DR   EnsemblGenomes-Gn; LSL_RNA125.
DR   EnsemblGenomes-Gn; LSL_RNA126.
DR   EnsemblGenomes-Gn; LSL_RNA127.
DR   EnsemblGenomes-Gn; LSL_RNA128.
DR   EnsemblGenomes-Gn; LSL_RNA129.
DR   EnsemblGenomes-Gn; LSL_RNA130.
DR   EnsemblGenomes-Gn; LSL_RNA131.
DR   EnsemblGenomes-Gn; LSL_RNA132.
DR   EnsemblGenomes-Gn; LSL_RNA133.
DR   EnsemblGenomes-Tr; EBT00001654258.
DR   EnsemblGenomes-Tr; EBT00001654259.
DR   EnsemblGenomes-Tr; EBT00001654260.
DR   EnsemblGenomes-Tr; EBT00001654261.
DR   EnsemblGenomes-Tr; EBT00001654262.
DR   EnsemblGenomes-Tr; EBT00001654263.
DR   EnsemblGenomes-Tr; EBT00001654264.
DR   EnsemblGenomes-Tr; EBT00001654265.
DR   EnsemblGenomes-Tr; EBT00001654266.
DR   EnsemblGenomes-Tr; EBT00001654267.
DR   EnsemblGenomes-Tr; EBT00001654268.
DR   EnsemblGenomes-Tr; EBT00001654269.
DR   EnsemblGenomes-Tr; EBT00001654270.
DR   EnsemblGenomes-Tr; EBT00001654271.
DR   EnsemblGenomes-Tr; EBT00001654272.
DR   EnsemblGenomes-Tr; EBT00001654273.
DR   EnsemblGenomes-Tr; EBT00001654274.
DR   EnsemblGenomes-Tr; EBT00001654275.
DR   EnsemblGenomes-Tr; EBT00001654276.
DR   EnsemblGenomes-Tr; EBT00001654277.
DR   EnsemblGenomes-Tr; EBT00001654278.
DR   EnsemblGenomes-Tr; EBT00001654279.
DR   EnsemblGenomes-Tr; EBT00001654280.
DR   EnsemblGenomes-Tr; EBT00001654281.
DR   EnsemblGenomes-Tr; EBT00001654282.
DR   EnsemblGenomes-Tr; EBT00001654283.
DR   EnsemblGenomes-Tr; EBT00001654284.
DR   EnsemblGenomes-Tr; EBT00001654285.
DR   EnsemblGenomes-Tr; EBT00001654286.
DR   EnsemblGenomes-Tr; EBT00001654287.
DR   EnsemblGenomes-Tr; EBT00001654288.
DR   EnsemblGenomes-Tr; EBT00001654289.
DR   EnsemblGenomes-Tr; EBT00001654290.
DR   EnsemblGenomes-Tr; EBT00001654291.
DR   EnsemblGenomes-Tr; EBT00001654292.
DR   EnsemblGenomes-Tr; EBT00001654293.
DR   EnsemblGenomes-Tr; EBT00001654294.
DR   EnsemblGenomes-Tr; EBT00001654295.
DR   EnsemblGenomes-Tr; EBT00001654296.
DR   EnsemblGenomes-Tr; EBT00001654297.
DR   EnsemblGenomes-Tr; EBT00001654298.
DR   EnsemblGenomes-Tr; EBT00001654299.
DR   EnsemblGenomes-Tr; EBT00001654300.
DR   EnsemblGenomes-Tr; EBT00001654301.
DR   EnsemblGenomes-Tr; EBT00001654302.
DR   EnsemblGenomes-Tr; EBT00001654303.
DR   EnsemblGenomes-Tr; EBT00001654304.
DR   EnsemblGenomes-Tr; EBT00001654305.
DR   EnsemblGenomes-Tr; EBT00001654306.
DR   EnsemblGenomes-Tr; EBT00001654307.
DR   EnsemblGenomes-Tr; EBT00001654308.
DR   EnsemblGenomes-Tr; EBT00001654309.
DR   EnsemblGenomes-Tr; EBT00001654310.
DR   EnsemblGenomes-Tr; EBT00001654311.
DR   EnsemblGenomes-Tr; EBT00001654312.
DR   EnsemblGenomes-Tr; EBT00001654313.
DR   EnsemblGenomes-Tr; EBT00001654314.
DR   EnsemblGenomes-Tr; EBT00001654315.
DR   EnsemblGenomes-Tr; EBT00001654316.
DR   EnsemblGenomes-Tr; EBT00001654317.
DR   EnsemblGenomes-Tr; EBT00001654318.
DR   EnsemblGenomes-Tr; EBT00001654319.
DR   EnsemblGenomes-Tr; EBT00001654320.
DR   EnsemblGenomes-Tr; EBT00001654321.
DR   EnsemblGenomes-Tr; EBT00001654322.
DR   EnsemblGenomes-Tr; EBT00001654323.
DR   EnsemblGenomes-Tr; EBT00001654324.
DR   EnsemblGenomes-Tr; EBT00001654325.
DR   EnsemblGenomes-Tr; EBT00001654326.
DR   EnsemblGenomes-Tr; EBT00001654327.
DR   EnsemblGenomes-Tr; EBT00001654328.
DR   EnsemblGenomes-Tr; EBT00001654329.
DR   EnsemblGenomes-Tr; EBT00001654330.
DR   EnsemblGenomes-Tr; EBT00001654331.
DR   EnsemblGenomes-Tr; EBT00001654332.
DR   EnsemblGenomes-Tr; EBT00001654333.
DR   EnsemblGenomes-Tr; EBT00001654334.
DR   EnsemblGenomes-Tr; EBT00001654335.
DR   EnsemblGenomes-Tr; EBT00001654336.
DR   EnsemblGenomes-Tr; EBT00001654337.
DR   EnsemblGenomes-Tr; EBT00001654338.
DR   EnsemblGenomes-Tr; EBT00001654339.
DR   EnsemblGenomes-Tr; EBT00001654340.
DR   EnsemblGenomes-Tr; EBT00001654341.
DR   EnsemblGenomes-Tr; EBT00001654342.
DR   EnsemblGenomes-Tr; EBT00001654343.
DR   EnsemblGenomes-Tr; EBT00001654344.
DR   EnsemblGenomes-Tr; EBT00001654345.
DR   EnsemblGenomes-Tr; EBT00001654346.
DR   EnsemblGenomes-Tr; EBT00001654347.
DR   EnsemblGenomes-Tr; EBT00001654348.
DR   EnsemblGenomes-Tr; EBT00001654349.
DR   EnsemblGenomes-Tr; EBT00001654350.
DR   EnsemblGenomes-Tr; EBT00001654351.
DR   EnsemblGenomes-Tr; EBT00001654352.
DR   EnsemblGenomes-Tr; EBT00001654353.
DR   EnsemblGenomes-Tr; EBT00001654354.
DR   EnsemblGenomes-Tr; EBT00001654355.
DR   EnsemblGenomes-Tr; EBT00001654356.
DR   EnsemblGenomes-Tr; EBT00001654357.
DR   EnsemblGenomes-Tr; EBT00001654358.
DR   EnsemblGenomes-Tr; EBT00001654359.
DR   EnsemblGenomes-Tr; EBT00001654360.
DR   EnsemblGenomes-Tr; EBT00001654361.
DR   EnsemblGenomes-Tr; EBT00001654362.
DR   EnsemblGenomes-Tr; EBT00001654363.
DR   EnsemblGenomes-Tr; EBT00001654364.
DR   EnsemblGenomes-Tr; EBT00001654365.
DR   EnsemblGenomes-Tr; EBT00001654366.
DR   EnsemblGenomes-Tr; EBT00001654367.
DR   EnsemblGenomes-Tr; EBT00001654368.
DR   EnsemblGenomes-Tr; EBT00001654369.
DR   EnsemblGenomes-Tr; EBT00001654370.
DR   EnsemblGenomes-Tr; EBT00001654371.
DR   EnsemblGenomes-Tr; EBT00001654372.
DR   EnsemblGenomes-Tr; EBT00001654373.
DR   EnsemblGenomes-Tr; EBT00001654374.
DR   EnsemblGenomes-Tr; EBT00001654375.
DR   EnsemblGenomes-Tr; LSL_RNA001-1.
DR   EnsemblGenomes-Tr; LSL_RNA002-1.
DR   EnsemblGenomes-Tr; LSL_RNA003-1.
DR   EnsemblGenomes-Tr; LSL_RNA004-1.
DR   EnsemblGenomes-Tr; LSL_RNA007-1.
DR   EnsemblGenomes-Tr; LSL_RNA008-1.
DR   EnsemblGenomes-Tr; LSL_RNA009-1.
DR   EnsemblGenomes-Tr; LSL_RNA010-1.
DR   EnsemblGenomes-Tr; LSL_RNA011-1.
DR   EnsemblGenomes-Tr; LSL_RNA012-1.
DR   EnsemblGenomes-Tr; LSL_RNA013-1.
DR   EnsemblGenomes-Tr; LSL_RNA014-1.
DR   EnsemblGenomes-Tr; LSL_RNA015-1.
DR   EnsemblGenomes-Tr; LSL_RNA016-1.
DR   EnsemblGenomes-Tr; LSL_RNA017-1.
DR   EnsemblGenomes-Tr; LSL_RNA018-1.
DR   EnsemblGenomes-Tr; LSL_RNA019-1.
DR   EnsemblGenomes-Tr; LSL_RNA021-1.
DR   EnsemblGenomes-Tr; LSL_RNA025-1.
DR   EnsemblGenomes-Tr; LSL_RNA030-1.
DR   EnsemblGenomes-Tr; LSL_RNA032-1.
DR   EnsemblGenomes-Tr; LSL_RNA035-1.
DR   EnsemblGenomes-Tr; LSL_RNA036-1.
DR   EnsemblGenomes-Tr; LSL_RNA037-1.
DR   EnsemblGenomes-Tr; LSL_RNA038-1.
DR   EnsemblGenomes-Tr; LSL_RNA039-1.
DR   EnsemblGenomes-Tr; LSL_RNA040-1.
DR   EnsemblGenomes-Tr; LSL_RNA041-1.
DR   EnsemblGenomes-Tr; LSL_RNA042-1.
DR   EnsemblGenomes-Tr; LSL_RNA044-1.
DR   EnsemblGenomes-Tr; LSL_RNA045-1.
DR   EnsemblGenomes-Tr; LSL_RNA046-1.
DR   EnsemblGenomes-Tr; LSL_RNA047-1.
DR   EnsemblGenomes-Tr; LSL_RNA048-1.
DR   EnsemblGenomes-Tr; LSL_RNA049-1.
DR   EnsemblGenomes-Tr; LSL_RNA050-1.
DR   EnsemblGenomes-Tr; LSL_RNA051-1.
DR   EnsemblGenomes-Tr; LSL_RNA052-1.
DR   EnsemblGenomes-Tr; LSL_RNA053-1.
DR   EnsemblGenomes-Tr; LSL_RNA054-1.
DR   EnsemblGenomes-Tr; LSL_RNA055-1.
DR   EnsemblGenomes-Tr; LSL_RNA056-1.
DR   EnsemblGenomes-Tr; LSL_RNA057-1.
DR   EnsemblGenomes-Tr; LSL_RNA058-1.
DR   EnsemblGenomes-Tr; LSL_RNA059-1.
DR   EnsemblGenomes-Tr; LSL_RNA060-1.
DR   EnsemblGenomes-Tr; LSL_RNA061-1.
DR   EnsemblGenomes-Tr; LSL_RNA062-1.
DR   EnsemblGenomes-Tr; LSL_RNA063-1.
DR   EnsemblGenomes-Tr; LSL_RNA064-1.
DR   EnsemblGenomes-Tr; LSL_RNA065-1.
DR   EnsemblGenomes-Tr; LSL_RNA066-1.
DR   EnsemblGenomes-Tr; LSL_RNA067-1.
DR   EnsemblGenomes-Tr; LSL_RNA068-1.
DR   EnsemblGenomes-Tr; LSL_RNA069-1.
DR   EnsemblGenomes-Tr; LSL_RNA070-1.
DR   EnsemblGenomes-Tr; LSL_RNA071-1.
DR   EnsemblGenomes-Tr; LSL_RNA072-1.
DR   EnsemblGenomes-Tr; LSL_RNA073-1.
DR   EnsemblGenomes-Tr; LSL_RNA074-1.
DR   EnsemblGenomes-Tr; LSL_RNA075-1.
DR   EnsemblGenomes-Tr; LSL_RNA076-1.
DR   EnsemblGenomes-Tr; LSL_RNA077-1.
DR   EnsemblGenomes-Tr; LSL_RNA078-1.
DR   EnsemblGenomes-Tr; LSL_RNA079-1.
DR   EnsemblGenomes-Tr; LSL_RNA080-1.
DR   EnsemblGenomes-Tr; LSL_RNA081-1.
DR   EnsemblGenomes-Tr; LSL_RNA082-1.
DR   EnsemblGenomes-Tr; LSL_RNA083-1.
DR   EnsemblGenomes-Tr; LSL_RNA084-1.
DR   EnsemblGenomes-Tr; LSL_RNA085-1.
DR   EnsemblGenomes-Tr; LSL_RNA086-1.
DR   EnsemblGenomes-Tr; LSL_RNA087-1.
DR   EnsemblGenomes-Tr; LSL_RNA088-1.
DR   EnsemblGenomes-Tr; LSL_RNA089-1.
DR   EnsemblGenomes-Tr; LSL_RNA090-1.
DR   EnsemblGenomes-Tr; LSL_RNA091-1.
DR   EnsemblGenomes-Tr; LSL_RNA092-1.
DR   EnsemblGenomes-Tr; LSL_RNA095-1.
DR   EnsemblGenomes-Tr; LSL_RNA097-1.
DR   EnsemblGenomes-Tr; LSL_RNA099-1.
DR   EnsemblGenomes-Tr; LSL_RNA100-1.
DR   EnsemblGenomes-Tr; LSL_RNA103-1.
DR   EnsemblGenomes-Tr; LSL_RNA108-1.
DR   EnsemblGenomes-Tr; LSL_RNA119-1.
DR   EnsemblGenomes-Tr; LSL_RNA120-1.
DR   EnsemblGenomes-Tr; LSL_RNA121-1.
DR   EnsemblGenomes-Tr; LSL_RNA122-1.
DR   EnsemblGenomes-Tr; LSL_RNA123-1.
DR   EnsemblGenomes-Tr; LSL_RNA124-1.
DR   EnsemblGenomes-Tr; LSL_RNA125-1.
DR   EnsemblGenomes-Tr; LSL_RNA126-1.
DR   EnsemblGenomes-Tr; LSL_RNA127-1.
DR   EnsemblGenomes-Tr; LSL_RNA128-1.
DR   EnsemblGenomes-Tr; LSL_RNA129-1.
DR   EnsemblGenomes-Tr; LSL_RNA130-1.
DR   EnsemblGenomes-Tr; LSL_RNA131-1.
DR   EnsemblGenomes-Tr; LSL_RNA132-1.
DR   EnsemblGenomes-Tr; LSL_RNA133-1.
DR   EuropePMC; PMC1436024; 16617113.
DR   EuropePMC; PMC1472345; 16672450.
DR   EuropePMC; PMC1489637; 16751526.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2565949; 18689509.
DR   EuropePMC; PMC2797019; 19968877.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC4916391; 27329757.
DR   EuropePMC; PMC4920774; 27407290.
DR   EuropePMC; PMC5122687; 27881545.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000233.
DR   SILVA-SSU; CP000233.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..289940,329543..777764,825670..1228180,
FT                   1237087..1734885,1744903..1827111)
FT                   /organism="Lactobacillus salivarius UCC118"
FT                   /focus
FT                   /strain="UCC118"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:362948"
FT   source          289941..329542
FT                   /organism="Lactobacillus phage Sal2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:364251"
FT   source          777765..825669
FT                   /organism="Lactobacillus phage Sal1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:364252"
FT   source          1228181..1237086
FT                   /organism="Lactobacillus phage Sal4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:364253"
FT   source          1734886..1744902
FT                   /organism="Lactobacillus phage Sal3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:364254"
FT   misc_feature    1..1827111
FT                   /note="Source DNA is available from Eva McArdle at
FT                   Alimentary Pharmabiotic Centre (e.mcardle@ucc.ie)"
FT   gene            1..1365
FT                   /gene="dnaA"
FT                   /locus_tag="LSL_0001"
FT   CDS_pept        1..1365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LSL_0001"
FT                   /product="Chromosomal replication initiation protein"
FT                   /note="COG0593 [L] ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98824"
FT                   /db_xref="GOA:Q1WVP5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP5"
FT                   /protein_id="ABD98824.1"
FT                   /translation="MLNLDLDSLWQYIIESFSKSLNPASYKAWFGPAEPVQYIDQTLIV
FT                   NVPTPLHRDYWTQKLNGQISDLIQEVSGEKITVLAKLPSDPNPLANSESVTTPKKVSVA
FT                   ENNNSSSFLKETQLNDRYTFDTFVVGKGNQLAHAAALAVAEEPGVFYNPLFFYGGVGLG
FT                   KTHLMHAIGHQMLENRPDAKVKYVTSESFANDFISSIQTKRQEEFRREYRSVDLLLVDD
FT                   IQFFADKVGTQEEFFHTFNALYDDKKQIVLSSDRLPNEIPKLQQRLVSRFKWGLSVDIT
FT                   PPDFETRIAILRNKAEAEHVSIPDDTLSYIAGQIDSNIRELEGALMRVEAFSSMTRTPI
FT                   STSLAAEALKNLKVSGKSSKLTIPIIQDKVAKYYHVTIADLKGKKRVKSIVIPRQIAMY
FT                   LSRELTDASLPKIGNEFGGKDHTTVIHAHEKIAEALHTDTTLQKEVNELRAELQD"
FT   gene            1532..2671
FT                   /gene="dnaN"
FT                   /locus_tag="LSL_0002"
FT   CDS_pept        1532..2671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LSL_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592 [L] DNA polymerase sliding clamp subunit
FT                   (PCNA homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98825"
FT                   /db_xref="GOA:Q1WVP4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP4"
FT                   /protein_id="ABD98825.1"
FT                   /translation="MKFSIQRASFIKYLNDVQRAISSKTTIDILTGLKMDLSKDALTLT
FT                   GSNSDISIETIISIADDNAALQIEQEGAVVLPARFFSEIVKKLPEQTMTIEINERFQAT
FT                   ITSGSAEFTINGLNAEEYPHLPEIDSKDQLTVPGDILKQVISQTVIAVSNQESRPILTG
FT                   IHLVIKNGELLAVATDSHRLSQRIIKLSGADDAVYDVIIPGKSLSELSKMISDSDENIE
FT                   IQISENQALFILGNTSFYTRLLEGKYPDTERLIPKVSEITVDFNAVELLQSIERASLLS
FT                   HEGRNNVVKLAINPSAQSVILSGNTPEVGNVEEELHFKNLEGSELEISFNPDYMKDALR
FT                   SFGQSEITIAFTQPLRPFTIVPTEDKDNFVQLITPVRTF"
FT   gene            3088..3309
FT                   /locus_tag="LSL_0003"
FT   CDS_pept        3088..3309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0003"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98826"
FT                   /db_xref="GOA:Q1WVP3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP3"
FT                   /protein_id="ABD98826.1"
FT                   /translation="MAQKVKLKTDYITLGQLLKIVDIISSGGQAKWFLQENDVLINGEL
FT                   DNRRGRKLYPNDLVEIPEYGKFMMEADK"
FT   gene            3309..4448
FT                   /gene="recF"
FT                   /locus_tag="LSL_0004"
FT   CDS_pept        3309..4448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LSL_0004"
FT                   /product="DNA replication and repair protein"
FT                   /note="COG1195 [L] Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98827"
FT                   /db_xref="GOA:Q1WVP2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVP2"
FT                   /protein_id="ABD98827.1"
FT                   /translation="MYLEKLELKHFRNYEDVNVAFSPQVNVLIGKNAQGKTNLLESIYV
FT                   LAMARSHRTSNDREMVTFKKDAALIRGEVHQRLGNTKLELLISRKGKKAKVNHLEKARL
FT                   SQYIGQLNVILFAPEDLALVKGAPSVRRRFIDMEFGQIDALYLHTLTEYRAVLRQRNKY
FT                   LKELQTKKATDKVYLEILSEQLSESGSQIIFKRLEFLQELEKYADKLHNQITQGKEHLQ
FT                   FQYESTLKEYQGKSVLELKQSLIEQYKTMMDKEIFQGTTLLGPHRDDVRFMLNDKNVQV
FT                   YGSQGQQRTAALSVKLAEIDLMKEKTHEYPILLLDDVLSELDGARQTHLLKTIQNKVQT
FT                   FLTTPGLSDVAQQLINKPKIFRIDNGKITEENSFTIEEE"
FT   gene            4451..6409
FT                   /gene="gyrB"
FT                   /locus_tag="LSL_0005"
FT   CDS_pept        4451..6409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LSL_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG0187 [L] Type IIA topoisomerase (DNA gyrase/topo
FT                   II, topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98828"
FT                   /db_xref="GOA:Q1WVP1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP1"
FT                   /protein_id="ABD98828.1"
FT                   /translation="MTEEERKEKLQEEKAKEYDASQIQVLEGLEAVRKRPGMYIGSTSS
FT                   QGLHHLVWEIIDNGIDEALAGFADEINVTVEEDNSITVKDNGRGIPVDIQKKTGRPALE
FT                   TVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVKVMREDDENVYGMDFKLGK
FT                   VATSMTVVGKCPRHEHGTIVHFKPDPDIFTETTTYDINVLTKRIRELAFLNKGLKITID
FT                   DKRQEEPTHEEFHYAGGIKHYIEFLNKGKEVIFPEPIYVEGEQNGITVEVALQYTNDFH
FT                   SNLLSFTNNIHTYEGGTHESGFKTALTRVINDYGRKSGLIKENDANLSGEDVREGLTAV
FT                   VSIKHPNPQFEGQTKTKLGNSDARKVTDKLFSETFNKFMLENPTVAKQIVEKGLLAAKA
FT                   RIAAKRAREVTRKKNGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLT
FT                   QAILPIRGKILNVEKATIDRILANEEIRSLFTALGTGFGEEFDVSKANYHKLIIMTDAD
FT                   VDGAHIRTLLLTLIYRFMKPMLDAGYVYIAQPPLYQVRQGKMIKYIDSDEELNDVLGSL
FT                   PPSPKPVIQRYKGLGEMDAEQLWETTMNPENRRLLRVELSDAEEANEVFEMLMGDHVGP
FT                   RRQFIEDNATFVNNLDV"
FT   gene            6446..8998
FT                   /gene="gyrA"
FT                   /locus_tag="LSL_0006"
FT   CDS_pept        6446..8998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LSL_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG0188 [L] Type IIA topoisomerase (DNA gyrase/topo
FT                   II, topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98829"
FT                   /db_xref="GOA:Q1WVP0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP0"
FT                   /protein_id="ABD98829.1"
FT                   /translation="MVDLPNRIKDVDLSKVMRTSFLDYAMSVIVARALPDVRDGLKPVH
FT                   RRILYGMNELGVTPDKPYKKSARIVGDVMGKFHPHGDSAIYESMVRMAQDFSYRYMLVD
FT                   GHGNFGSVDGDGAAAMRYTEARMSKITLEMLRDINKDTIDFQPNYDGTEREPVVLPARF
FT                   PNLLVNGATGIAVGMTTNIPPHNLGEVISGIHMLMKNPDVTTADLMEAIPGPDFPTGAI
FT                   VMGKSGIRKAYETGKGTVTLRAKVEIDEQANGKQQIVVHELPYMVNKARLIERIAELAR
FT                   EKKIEGITDVKDESDREGMRVTIDVRRDVSASVVLNNLYKLTLMQTTFGFNMLAIVNGT
FT                   PKILSLKQILQYYLKHQEEVIRRRTEFELKKAKARAHILEGLRIALDHIDAIINIIRGS
FT                   QSPDVAKDRLMNEYQLSDKQAQAILDMRLVRLTGLERDKVENEYSKTMAAIADYEDILA
FT                   KPERIDKIIYEELLEIQEKFGDERRTELMVGEVLSIEDEDLIEEENVVVTLTHNGYIKR
FT                   LPTSDFKAQNRGGRGVQGMGVHDDDFIEHLLTTSTHDELLFFTNVGKVYRMKAYEIPEY
FT                   GRTAKGIPVINLLDISADEKIQTVINIPADKVQTDKEMYLFFITRQGTVKRTSVSEFGN
FT                   IRKNGLKAITLRDGDELINVLATDDSKNIIIGTHQGYAVSFDEKDIRSMGRSAAGVRGI
FT                   RLRDNDYVIGSAILEPESKVFVISENGYGKQTAASEYPIKGRGGKGIKTTNITEKNGPL
FT                   AGLTTVNGDEDIMVITDKGVMIRFKISDVSETGRATLGVRLINLGADSIVSTMTKVEPE
FT                   DENENSEETTQEVSTEISDDTKDSDVARLLDAAQKDGE"
FT   gene            9217..9507
FT                   /gene="rpsF"
FT                   /locus_tag="LSL_0007"
FT   CDS_pept        9217..9507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LSL_0007"
FT                   /product="SSU ribosomal protein S6P"
FT                   /note="COG0360 [J] Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98830"
FT                   /db_xref="GOA:Q1WVN9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN9"
FT                   /protein_id="ABD98830.1"
FT                   /translation="MTNYEITYIISPAIDEAAKTALVERFDNILKNDGAEIVDSKDWSK
FT                   RRFAYEIGGFSEGIYHIVNIKAENADAINEFDRLAKINDGILRHMIVKRED"
FT   gene            9548..10099
FT                   /gene="ssb"
FT                   /locus_tag="LSL_0008"
FT   CDS_pept        9548..10099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LSL_0008"
FT                   /product="Single-strand DNA binding protein"
FT                   /note="COG0629 [L] Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98831"
FT                   /db_xref="GOA:Q1WVN8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN8"
FT                   /protein_id="ABD98831.1"
FT                   /translation="MINRAILVGRLTRDPDLRYTASGAAVATFTVAVNRQFTNQQGERE
FT                   ADFINCVMWRKPAENFANFTHKGSLVGIDGRIQTRSYENQQGTRVYVTEVVAENFSLLE
FT                   SRAEADRYREQHGMTQNNYGNNAPSQNQASQFDSNPFGDSQSNNSFGGNTPANNGADNS
FT                   ADPFADNGQSIDISDDDLPF"
FT   gene            10121..10357
FT                   /gene="rpsR"
FT                   /locus_tag="LSL_0009"
FT   CDS_pept        10121..10357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LSL_0009"
FT                   /product="SSU ribosomal protein S18P"
FT                   /note="COG0238 [J] Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98832"
FT                   /db_xref="GOA:Q1WVN7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVN7"
FT                   /protein_id="ABD98832.1"
FT                   /translation="MAQQRRGGRRRRKVDYIAANHIEYIDYKDTDLLRRFISERGKILP
FT                   RRVTGTSAKNQRKLTVAIKRARIMGLLPFVAED"
FT   gene            complement(10418..11281)
FT                   /gene="mmsB"
FT                   /locus_tag="LSL_0010"
FT   CDS_pept        complement(10418..11281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="LSL_0010"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="COG2084 [I] 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98833"
FT                   /db_xref="GOA:Q1WVR4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR4"
FT                   /protein_id="ABD98833.1"
FT                   /translation="MKIGFIGTGVMGNAISVNLLKAGYEMVVYNRTKSKTDNLVSLGAS
FT                   WADSPKEVARQSDIIFTMVGFPPDVEDVYFNSETGIFAGAKPQSILVDMTTSRPSLAQK
FT                   IYQEGQKRNLFVLDAPVSGGDIGAKNGTLTVMVGGDKEAFDKLTDILEVISQSYHLFGP
FT                   AGSGQHAKMADQIMIAGTMTGLTEMLVYAKKAGLDLDSILTTVGAGSAANWSLSNYGPR
FT                   ILASDYTPGFFAKHFLKDLRIALDSAKNMGISLPATEKAEELYQTMVDEFKLGNDGTQG
FT                   LIKIYD"
FT   gene            11427..12440
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0011"
FT   CDS_pept        11427..12440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0011"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="COG0463 [M] Glycosyltransferases involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98834"
FT                   /db_xref="GOA:Q1WVR3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR3"
FT                   /protein_id="ABD98834.1"
FT                   /translation="MEKLLSIVVPCYNSQDYIDRCVESLLPGNDRVEILLIDDGSTDRT
FT                   AEIIDKYERTYPKQIKAVHQENGGHGQAVNTGMYLAKGKYVKVVDSDDWLDLSSYQKVL
FT                   NFLESLEESNKEIDMLICNYIYDKVELGHKKVIKYRWLPKNKCFTWNKVHLLYGEYFLM
FT                   HAVIYRTSLVTKEAKLRLPKYKFYVDNLYVFEPLPYVKKMYYLDVDLYHYFIGREDQSV
FT                   NEKVMLKRIDQQLYVNKRMIKFYAENIDVNSDVGKYMKRYLEIITTISSILLIRGNTKE
FT                   YLDLKDNLWNYLKEYDDVYRILRRRLFGIGVNLPGKFGRKLATDVYKVAQRLYGFN"
FT   gene            12645..13451
FT                   /pseudo
FT                   /locus_tag="LSL_0011b"
FT   misc_feature    12645..13451
FT                   /pseudo
FT                   /locus_tag="LSL_0011b"
FT                   /note="Similar to peptidoglycan-specific endopeptidase, M23
FT                   family; nonfunctional due to truncation"
FT   gene            13691..15613
FT                   /gene="asnB"
FT                   /locus_tag="LSL_0012"
FT   CDS_pept        13691..15613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="LSL_0012"
FT                   /product="Asparagine synthetase"
FT                   /EC_number="6.3.5.4"
FT                   /note="COG0367 [E] Asparagine synthase
FT                   (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98835"
FT                   /db_xref="GOA:Q1WVR2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR2"
FT                   /protein_id="ABD98835.1"
FT                   /translation="MCGFVGYVNQTDVQDEVIEKMANRIRHRGPDDEAFFRDNNVSMGF
FT                   RRLSIIDLAHGKQPMYNQDQTKVLTFNGEIYNYKEIRKELKELGYNFRTEVDSEVLIHG
FT                   YDAWGPELLQKTRGMYAFAIYNQKENEVFLARDHFGIKPLYYYDDGETFLWASEIKAFL
FT                   DHPNFKKEFNKELLPIHLSFEFIPSKETMFKHVYKVMPGQYVIHKNGKTEVHQYYKFNY
FT                   DKIDNSQTVESDASQIRKLVRESVDAHMVADVEVGSFLSSGVDSSYVFNEATKIKKQHI
FT                   QSFTLGYDRSKYSEIDWAHDFAEGIGQKNTPIKIDADDYFGILPTIMYYMDEPLSNPSA
FT                   MQLYFLSKGTREHVKVALSGEGADEFFGGYNTYLEAGPFERYQKWVPGFVRKGLAKAVE
FT                   NLPRFHGQRFLVRGAQPLSERYYRVNYVYNYHEREKILKDKSLNVDTGAYTKHIFDEVK
FT                   DKDEMTQMQYFDINTWLPFDILQKADRMSMANSLEVRTPLVDREVAKFAATMPIKTRIQ
FT                   GDTTKISLRKAAQAELPEKVANKEKLGFPSPVAQWMKEPKYKKMIEDAFTSDVAKKFFD
FT                   TDALLEIFKEHLNGKSSMQKIFTIYTFILWYQVYFPEDCEHDIRDQIRFNNVKAHANEQ
FT                   NFAEA"
FT   gene            15714..16287
FT                   /pseudo
FT                   /locus_tag="LSL_0014b"
FT   misc_feature    15714..16287
FT                   /pseudo
FT                   /locus_tag="LSL_0014b"
FT                   /note="Similar to hypothetical membrane spanning protein;
FT                   nonfunctional due to frameshift"
FT   gene            16466..16843
FT                   /gene="mscL"
FT                   /locus_tag="LSL_0013"
FT   CDS_pept        16466..16843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="LSL_0013"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /note="COG1970 [M] Large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98836"
FT                   /db_xref="GOA:Q1WVR1"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVR1"
FT                   /protein_id="ABD98836.1"
FT                   /translation="MLKEFKEFISRGNVMDLAVGVIIGGAFTAIVNSLVKYIINPFLGL
FT                   FVGAIDFSDLVFKIGNATFRVGSFLNAVINFLIIAFVVFLMVKGINKVLRQDKKEEAPA
FT                   PKDPQLEVLEEIRDSLKKLDK"
FT   gene            complement(16903..18789)
FT                   /locus_tag="LSL_0014"
FT   CDS_pept        complement(16903..18789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0014"
FT                   /product="Pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /note="COG0028 [EH] Thiamine pyrophosphate-requiring
FT                   enzymes [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98837"
FT                   /db_xref="GOA:Q1WVR0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR0"
FT                   /protein_id="ABD98837.1"
FT                   /translation="MPNKISGADAMLKVLHEWGVTHIYGHPGGSLDSTMNALHNQQDKI
FT                   KFIQVRHEEAGALAASASAKLTGKIGVVLGSAGPGAIHLLNGLHDAKADHVPIFAIIAQ
FT                   VPTTKMNIDFFQAYNEGPWFDNVACWNRTAMTAESIPKLVDEGIRQAYKHRGVATLILP
FT                   KDLGWKMIPDTFVSNAANHVEPIYPEPNPQSITDALELIKAAKAPMVYFGIGAKHAAKE
FT                   LKEISAKFKLPLVSSVLAKGIIEDTYPTYMGSTGRVAPKTGVELGFNTDLILWIGNDVP
FT                   FSIFLFNPKAKVIQIDIDSEKLGKRHQVTVPILADSKKTLQALLKQGEELPETPFYKAA
FT                   LANKENWLAWLNRFKHSEDIPLRPEPVFEVLNQEASDQAIFTLDVGNVNINFARLMNLH
FT                   DQQKWTTSGQFATMGYGVPAAIAAKILYPDRDVYSLNGDGGFAMLMEEIITQVKYNLNI
FT                   INIIFNNKTLGYIEAEQIDDTQQPVFGVDLPDTDWATIAKGMGAVGYTVYTLDDFKDAI
FT                   AAGKESSKPIVIDVKFTREMPFTTEHMYLDPSYQDPQKVASFIEKYQATTLRPFSYFLK
FT                   RELGESRDDFNSAMQNVFDVITTPSTLSENYDQKKKEQDQIIPDAVSGASEY"
FT   gene            19313..19639
FT                   /locus_tag="LSL_0015"
FT   CDS_pept        19313..19639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0015"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98838"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ9"
FT                   /protein_id="ABD98838.1"
FT                   /translation="MEFKVSEEAGRKLIEEMRLEKGDRIKIFTKIYGGIPTVFPSYYLG
FT                   IMLDNDETAGVEEVIDGVSFYLMPTDMWLIDDYDLHVVLVDGEVEYKFTKPGEVDAVSG
FT                   ASKK"
FT   gene            19783..21315
FT                   /gene="murE"
FT                   /locus_tag="LSL_0016"
FT   CDS_pept        19783..21315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="LSL_0016"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /note="COG0769 [M] UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98839"
FT                   /db_xref="GOA:Q1WVQ8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVQ8"
FT                   /protein_id="ABD98839.1"
FT                   /translation="MALEITPALSLLDEHHLLKEVVNEQKLTFENVTYDSRKVSDNTLF
FT                   FCKGNFKPSYLTSALEKGATAYVSEQKYAEGMDATGIIVTNVQKAMALLGAAFYGFPQN
FT                   ELFIIAYTGTKGKTTSAYFAEHILAKATDKKVALFSTIDRVLGNEPDQRFKSDLTTPES
FT                   LDLFHDMRAAVNNGMTHLVMEVSSQAYKKNRVYGLTFDVGVFLNISPDHIGRNEHPTFD
FT                   DYLHCKEQLLVNSKRCVINGETAYLRDVYYTAKATTEPEDIYVFARKGAQISDNIPVDI
FT                   EYQNDFEDLHKSVIEVKGLSDKAQTLHVDGKYELSVPGDYNEGNATSAIIATLLAGAKG
FT                   EDARKTLDRVHIPGRMEIIKTKNNGTIYVDYAHNYASLKALFAFLKQQTHAGRVIAVLG
FT                   SPGDKGISRRPGFGKAVSEEVDHVILTTDDPGFEDPMKIAQEIDSYINHDNVKVEFELD
FT                   REIAIEKAIKMSTNNDIVVLAGKGEDPYQKIKGVDVPYPSDVNVAKKIVEEL"
FT   gene            21315..22565
FT                   /locus_tag="LSL_0017"
FT   CDS_pept        21315..22565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0017"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3919 [R] Predicted ATP-grasp enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98840"
FT                   /db_xref="GOA:Q1WVQ7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ7"
FT                   /protein_id="ABD98840.1"
FT                   /translation="MSAPAFTPILLGSDFNVYGMARSFYEIYHKPVKAFAEIELAPTRF
FT                   TKIVDLELIDGFSEDPVWINEMRKIKKRYADHEEPVILIGCGDGYAELIAKHKDELSDV
FT                   FICPYVDYDLLKHLNNKERFYEMCDKYDLPYPKTKIITKADHDSGDKIEQPFQYPVALK
FT                   PANSVEWLDVHFEGRKKAFRIKDREEFDYVLKQAYANGYKSDFILQDFIPGDDSHMRVL
FT                   NAYVDKDHKVKMMCMGHPLLEDPAPSAIGNYVAILPDFNQDIYDRIKNFLEAINYTGYA
FT                   NFDMKYDTRDNTYKLFEINLRQGRSSFFVTLDGYNLADWVVKDYVKDSLKDQETVYGNK
FT                   DEEQHALWLGVPAKVFKKYAKDNEDKQKALELIKAGRYGTTFEYSKDMNIRRWLLIKWM
FT                   NHNYVKNFNRYFKENKG"
FT   gene            22575..23288
FT                   /gene="racX"
FT                   /locus_tag="LSL_0018"
FT   CDS_pept        22575..23288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racX"
FT                   /locus_tag="LSL_0018"
FT                   /product="Aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="COG1794 [M] Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98841"
FT                   /db_xref="GOA:Q1WVQ6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ6"
FT                   /protein_id="ABD98841.1"
FT                   /translation="MKNFFTIIGGMGTMATESYIHQLNLRTPANNDQEYLNYILVNHAT
FT                   VPDRTAYILDNSKPNPKIPLLEDFKQQASLKPDFFTLPCNTAHYFYDELQAAVDVPVLH
FT                   MPRLAVEQIKQDYPNAKRVGIVATNGTLHDGVYDKEILDAGYELVKPTAEIQAKTMELI
FT                   YDDIKEKDYVDGKLFYELVEDMVKDEKCDAVILGCTELSLAQEREPITDLPIIDSQSVL
FT                   VDKTLELALKTQKNK"
FT   gene            complement(23323..24546)
FT                   /locus_tag="LSL_0019"
FT   CDS_pept        complement(23323..24546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0019"
FT                   /product="Multidrug resistance efflux pump"
FT                   /note="COG0477 [GEPR] Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98842"
FT                   /db_xref="GOA:Q1WVU3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVU3"
FT                   /protein_id="ABD98842.1"
FT                   /translation="MDEAQREKSPWKRNLYILWVCTFIAGIAFSELMPFMSLYVSQLGH
FT                   FSKAQVSFYSGLVYAATFLVTAIVSPLWGMLADIKGRKIMLIRASFGMAFAMFLMGLVT
FT                   NVWELIALRALQGLFSGFISNAQALIASQTPRKHSGKALGTLVTGSTSGMLMGPIIGGV
FT                   LAQFFSIRDTFFITASLLALAGILSATLVKEYFVPIKREKNSEEHRGLLSQFQNPRLII
FT                   VLLISTMMVQLGNISIAPIISLYIKELMHNQGPIALVAGIIAALPGISNIISAPRLGAY
FT                   GDAHGSNKVLMAGYLFAVIMYFPQGFVSSIWLLGILRFFIGISDGALFPTIQTLLTKNS
FT                   PASATSAVFSWNQSFQALGNMFGSLLGGSLAGLFDYNVVFISTATLLLLNFLILWFTEP
FT                   SLRLKFNR"
FT   gene            24679..25245
FT                   /locus_tag="LSL_0020"
FT   CDS_pept        24679..25245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0020"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98843"
FT                   /db_xref="GOA:Q1WVU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVU2"
FT                   /protein_id="ABD98843.1"
FT                   /translation="MTQKRNLSTEKIIEAAKEIINKEGAEKLSFSKVADVLGVHSQAMY
FT                   PYFADKEELKIAVINDFLDSLTEQVKEELQGISGKEALRIYGRKLHELLLSQPRLSRLA
FT                   FGGIDYSQKEEARNHFKDLVELLESLIEPFAKNDVDIINRARLYRAVIFGYAQNELWGL
FT                   FKLALVPAQTSFEFTLEEAIATITA"
FT   gene            25365..26231
FT                   /locus_tag="LSL_0021"
FT   CDS_pept        25365..26231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0021"
FT                   /product="Glucose uptake protein"
FT                   /note="COG4975 [G] Putative glucose uptake permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98844"
FT                   /db_xref="GOA:Q1WVU1"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVU1"
FT                   /protein_id="ABD98844.1"
FT                   /translation="MNIIIALIPAVCWGIFPLIASKTGGGPANQILGTGLGATLVGLIV
FT                   FAIMHPTITASAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLI
FT                   GMLFLGNWSGTTAKIIGLVALAIVVVGVILTAVTDDNKSESASVKDVLFLLVTTIGYWI
FT                   YSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWAGMIGGAIWG
FT                   IAAFAYIFSAQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRELGFTLAGLVLLVVG
FT                   SVITGFI"
FT   gene            26461..27807
FT                   /locus_tag="LSL_0022"
FT   CDS_pept        26461..27807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0022"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98845"
FT                   /db_xref="GOA:Q1WVU0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVU0"
FT                   /protein_id="ABD98845.1"
FT                   /translation="MSGEEANSMLQSVMKHHHMQMPWHNFTPDNSNTPAKRATLKEKAT
FT                   LVGRVGIMLLSYGTGAWRVRDSMNAIARELNISCSADVGLVSIEYTCVDEEGHGYTQAL
FT                   SLASTGVNTDKLSEMEQFVMDFNKGGSDLSSEQIHEILDEIERKPGHYTAIIAGLAAAS
FT                   ACCAFVFLLGGGLVEMLCSFVGAGFGNYIRRKMIERRITLLACVSVSVAVACIFYLIAF
FT                   KSLVAIMHVSLQHEAGYIGAMLFVIPGFPFITSGLDIAKLDMRSGLERMMYAIMIITVA
FT                   TLVGWVVAMAVHLKPVNFIPLDLGVIPMMLLRIPASFVGVFGFSIMFNSTIEMATWAGI
FT                   IGAIANTLRLELVDLTNIPAGAAAFTAALVAGLLASLIKGYPRISLTVPSIVIMVPGLY
FT                   MYRAVYNIGVASINVGATWLTEAALIVMFLPLGLITARILTDKKWRYKD"
FT   gene            27822..28382
FT                   /locus_tag="LSL_0023"
FT   CDS_pept        27822..28382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98846"
FT                   /db_xref="GOA:Q1WVT9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT9"
FT                   /protein_id="ABD98846.1"
FT                   /translation="MVLKVEKISTKSQDFKQIKRVYEEVFPKVERIPLWLLKMRANEGK
FT                   AEFCSLYDENEWVGFFYTILTKKLAYIFFLAVDPDRQGDGYGSQALEVIKERYQDYTMG
FT                   LSSERPSPEAPNNEQRIRRQSFYERNGFTKAGFYSIEKGGVRYDFLSPQGKVKPNLYVD
FT                   LMAEFFKQRQAYYLPLRVEKDDE"
FT   gene            28581..29495
FT                   /locus_tag="LSL_0024"
FT   CDS_pept        28581..29495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0024"
FT                   /product="Transporter, drug/metabolite exporter family"
FT                   /note="COG0697 [GER] Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98847"
FT                   /db_xref="GOA:Q1WVT8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT8"
FT                   /protein_id="ABD98847.1"
FT                   /translation="MSMKTKGILLAAGGASLWGGSGAAAQQLFMTHAVTTEWLVAVRLL
FT                   GAGLLLLIWGLIKSSKQINEIIHDRKNMAMVLAFAIFGVMNSQLSYFFAIKYSNAPTAT
FT                   VLQYLQPVLIVLWMAFGQKIRPRRVDGISIVVALMGTFLLVTGGRLDTLTLTPIALAWG
FT                   LWSAVAATLYTLLPSGLLKKYDAMVVCGLAMFVSGIIMLPWFLTMEQPHLSLFNIVLVI
FT                   YIVVFGTMFAYTLFLQSIRYIAPSVTGILSAFEPLIATILAVTLLGTKLSTAAIIGSLL
FT                   IILTTVIQAVPFNVIWRRFRRVK"
FT   gene            complement(29664..31466)
FT                   /locus_tag="LSL_0025"
FT   CDS_pept        complement(29664..31466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0025"
FT                   /product="Oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG1164 [E] Oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98848"
FT                   /db_xref="GOA:Q1WVT7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT7"
FT                   /protein_id="ABD98848.1"
FT                   /translation="MALPKRSEVSVNETWDLTAIYPDKKAWKADMVAVRELVTQFQNNY
FT                   RSKLTEAKIIIAALHDLETIYQKLSWIEHYAFLPQTTDMTNPEYNQMLVENDNLQATIT
FT                   ADLSFFKTEVLTNPVSLLDQVAEIEPQFAPVVRHWKVEKPHQLSPEVEKTLATLSPTLN
FT                   SSERIYTTARAADWDMEDFEVDGKTYPMSFVLYENTYQYHPNPEVRHKAHQIFSDTLRK
FT                   HKNTVAANYYTQVSKEKKLADLRGYDSVFDYLLSDQEVSRETFDRQIDVIIDELGPVMQ
FT                   KYVKLLQKERGLDKMLYSDLQIDLDPEFAPKADLESATGYISEAVSVLGEDYKNAILKA
FT                   FPERWVDFPANAGKESGGFETTPYGLHPYILMSWTGILPDVYTLIHELGHAGNFIKINE
FT                   NNSILTSEPSLYLIESPSTFNELLLTHSLEQKSDDPRMKRFAYTTMLTNTYFHNFITHL
FT                   LEAAFQREVYTLVENGQTFDGDKLTQIKMDVQKRFWGDAVDIDENAGLTWMRQSHYYMG
FT                   LYSYTYSAGLTIATQAYLKVLEEGQPAVDRWLEYISLGDQKAPMDAAKVAGVDVTTAEP
FT                   LHNTIKFLNDTVDKVIALTEELNR"
FT   gene            31822..32739
FT                   /gene="cysK"
FT                   /locus_tag="LSL_0026"
FT   CDS_pept        31822..32739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="LSL_0026"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG0031 [E] Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98849"
FT                   /db_xref="GOA:Q1WVT6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT6"
FT                   /protein_id="ABD98849.1"
FT                   /translation="MIVKSVYELIGQTPLIELDVPVAKGSRILAKLESFNPGGSVKDRL
FT                   GISLIEAALKRGDIDKDTTIIEPTAGNTGIGLALATQKYHLKTILVVPEHFSAEKQTLM
FT                   RALGAEIINTPRAEGMQGALRKSRELANQIANSYIPNQFENSDNPDAYTRGLGQEIIDD
FT                   LQANNLKLDAFVAGAGTGGTFAGTAETLQAEYPELTSVVVQPEGSILDNQPEHPHRTEG
FT                   IGVEKVPPFFKKLKVDEVQTISDDEAFNYVKQMAQDQGLFIGSSSGAALAASMHMAEKL
FT                   PANSTIVTIFPDSSERYLSENIYD"
FT   gene            32755..33897
FT                   /gene="metC"
FT                   /locus_tag="LSL_0027"
FT   CDS_pept        32755..33897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="LSL_0027"
FT                   /product="Cystathionine beta-lyase / Cystathionine
FT                   gamma-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /EC_number="4.4.1.1"
FT                   /note="COG0626 [E] Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98850"
FT                   /db_xref="GOA:Q1WVT5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT5"
FT                   /protein_id="ABD98850.1"
FT                   /translation="MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYS
FT                   RTGNPTRAALEALIADLEGGVAGFAFASGSAAIHATFSMYSAHDHFIVGSDVYGGTFRL
FT                   INKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYFETPTNPLLQIADIAAITKIAKKH
FT                   KLKTIVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVTSDEKIAEKLAFL
FT                   QNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDFP
FT                   GHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGS
FT                   IPREIRLENGIKDELIRLSVGIEDEEDLINDLKQALDKIG"
FT   gene            34052..35143
FT                   /gene="gldA"
FT                   /locus_tag="LSL_0028"
FT   CDS_pept        34052..35143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="LSL_0028"
FT                   /product="Glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="COG0371 [C] Glycerol dehydrogenase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98851"
FT                   /db_xref="GOA:Q1WVT4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT4"
FT                   /protein_id="ABD98851.1"
FT                   /translation="MTTNYMSNYSYGPDCFKEIPEVLDKYKVHKVVFIGGEKALKSSQE
FT                   DVKNVLESNGFYVTGSFVYGKNATQSNIDKLVEKSEVQDADIIFGFGGGRALDTVKMVA
FT                   KALDKTIFTFPTICSNCSAGTAIAVLYKDDGSFDKYGYPDVPAHVFINTSVIAKAPKEY
FT                   FWAGVGDGISKAPEVEHAVAAAVERGVELPHTAVLGAAIAASSKDAFYKYGEQGIKDVE
FT                   NGTVSKAIEEVALDIVVSTGYASNLVNQDDFYYNSCHAHAFYNATTAIKKEKEPLHGQV
FT                   VSFGVMVLHAYFNELEELKKVAAFNKKLGLPVTLEEIGLKVSDAEKITELAMQTNEYKQ
FT                   TPFDKEKYIEAIKLADKMGSENA"
FT   gene            35246..35680
FT                   /locus_tag="LSL_0029"
FT   CDS_pept        35246..35680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0029"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG0229 [O] Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98852"
FT                   /db_xref="GOA:Q1WVT3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVT3"
FT                   /protein_id="ABD98852.1"
FT                   /translation="MKETKEELRQRIGEEAYQVTQNAATERAFTGKYDEFFEDGIYVDV
FT                   VSGEPLFSSKDKYNSGCGWPAFTQPINNRMVTNHEDNSFGMHRVEVRSRQAQSHLGHVF
FT                   NDGPQDRGGLRYCINSAALQFIPVAELDEKGYGEYKKLFD"
FT   gene            35796..36092
FT                   /locus_tag="LSL_0030"
FT   CDS_pept        35796..36092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0030"
FT                   /product="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98853"
FT                   /db_xref="GOA:Q1WVT2"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT2"
FT                   /protein_id="ABD98853.1"
FT                   /translation="MTKTVTTTIRLDEELKKELTHDLDIMGLNINAYFTMAAKQLVLKK
FT                   KIPFEISTSSNDISNETTRKAMILAEAKELGLIPDDSPRFSNVDDMMEFLDGE"
FT   gene            36082..36398
FT                   /pseudo
FT                   /locus_tag="LSL_0030b"
FT   misc_feature    36082..36398
FT                   /pseudo
FT                   /locus_tag="LSL_0030b"
FT                   /note="Similar to hypothetical protein; nonfunctional due
FT                   to frameshift and interrupting stop codon"
FT   gene            complement(36486..37876)
FT                   /pseudo
FT                   /locus_tag="LSL_0030c"
FT   misc_feature    complement(36486..37876)
FT                   /pseudo
FT                   /locus_tag="LSL_0030c"
FT                   /note="Similar to conserved hypothetical protein;
FT                   nonfunctional due to frameshift"
FT   gene            38074..38523
FT                   /locus_tag="LSL_0031"
FT   CDS_pept        38074..38523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0031"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98854"
FT                   /db_xref="GOA:Q1WVT1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT1"
FT                   /protein_id="ABD98854.1"
FT                   /translation="MSITKDEVQTLTSRLDLLIAKGAREYKDWNQKHGLTDYRSVILYE
FT                   LLLHTRLTQKQIVERTNLPKQSINKGILQLRDEGYLTLEQDEKDNRVKYCFLTEEGEEY
FT                   ARVKIQPLLDIEEKIIMKMGKKKIEQLNELLEEWNLNFKKYKDEE"
FT   gene            38535..40268
FT                   /locus_tag="LSL_0032"
FT   CDS_pept        38535..40268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0032"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /note="COG1132 [V] ABC-type multidrug transport system,
FT                   ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98855"
FT                   /db_xref="GOA:Q1WVT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVT0"
FT                   /protein_id="ABD98855.1"
FT                   /translation="MQILMAHFKNYKKEVLSAIISIFIVAFVAVWQPRLLQYVLTAIVQ
FT                   DNQAEVRNYGIQLIILALVGIIAGIVNVYSAARVAQGVTSDLREEVYTKIQNFSFGNIE
FT                   KFSTGSLVVRLINDMNQVTNMIMTIFMQVFRVPLILVGAFILGIITVPRLWWLEVLMVV
FT                   LIMGITAIIFKKMGSLFDKVQNLMDKINTQAKENLQGVRVVKSFNQEGQEINKFNQTSD
FT                   TLNNVNLKIGYLFSTVIPSFELIAYVIIAAAIYLIGGSILEHPSDIAVISSYVTYIMQL
FT                   LYAIMIGSFVMSIFARGGVSLKRIKEVLETQPDVVFKDDAPAEELDGDVEFDNVTFAYP
FT                   DADKPILKNISFKVKSGEMVGIVGATGSGKSSLAQLLPRLYDPTEGTVRIGGHDLRDVN
FT                   EKSLRDTVSYVLQRAILFSGTIASNLRQGKADATNYELERASQIAQAQEFISRYKDTFD
FT                   HEVEERSSNFSGGQKQRLSIARGVVGKPKILILDDSTSALDAKSEKLVQEALEKELKNT
FT                   TTFIIAEKIVSVMNADKIIVLDNGRLVAQGTHQELLKNSPIYQEIYATQKAREKAGDII
FT                   E"
FT   gene            40261..42042
FT                   /locus_tag="LSL_0033"
FT   CDS_pept        40261..42042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0033"
FT                   /product="Multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /note="COG1132 [V] ABC-type multidrug transport system,
FT                   ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98856"
FT                   /db_xref="GOA:Q1WVS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS9"
FT                   /protein_id="ABD98856.1"
FT                   /translation="MSDTRKSLRYFIKYLRPYWKGITLVVLFTIIFTWAQVEAPHYSGL
FT                   ALTALTKYVEQYFNPATRATASMDDFYQALKLMLIFFILNAIIMLFTWVITSRFNAHST
FT                   NNMRENLFSKLQKMTIKYFDTHQDGKILSLFNSDLDNIFNAMNNAVFEVISQTALFIGT
FT                   IWMMFRIDVRLALVTVASTPFVVVLSWIIMRKARKYLDAQQDEISNLNGYINEQINGQK
FT                   VIITNGLQEESVEGFKVYNKKVRDAMFKGQFYSGILFPMMQGLSVLNLSIVIAMGSLWV
FT                   VDGTYSRAVGLGLIVTFVQYSQTYFQPLTQLTSIYSMIQLALTGGRRLATIEEQAEENQ
FT                   VPTGQELKSLEKGVKLEDVHFGYNENKEILHGINISVNKGESVALVGPTGSGKTTVMNL
FT                   LNRFYDVTGGKVTFDDVDVRDLTLESLRNNVGIVLQDSILFSGTVADNIKYGKPNASQK
FT                   EIEEAAKQANIHDFIMTLPQGYNTEINDENSVFSTGQKQLISIARTILTNPPFLILDEA
FT                   TSNVDTVTEEKIQKAMDAVIAGRTSFVIAHRLKTIINSDKIVVLKDGKVLEEGNHEELL
FT                   KEKGFYYNLYTNQMAFE"
FT   gene            42151..42966
FT                   /locus_tag="LSL_0034"
FT   CDS_pept        42151..42966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0034"
FT                   /product="Hydrolase, HAD superfamily"
FT                   /note="COG0561 [R] Predicted hydrolases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98857"
FT                   /db_xref="GOA:Q1WVS8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS8"
FT                   /protein_id="ABD98857.1"
FT                   /translation="MDIKLIAIDIDGTLVNSKKELTAGVKAAIEKAKAQGIKVVICTGR
FT                   PLPGALKLLAELGLDNDDNQYVVSFGGAVVQSTSGKVIYHQGLTYEDFVDLEAIARKMN
FT                   LHFQVISPDRIYTCNKDIGYYTLYEANLVSMGISYRTPDELRDVPLIKGMFIDEPEILD
FT                   PAIADRTYFGQLEDRLEFTKTAAFYYEAYTKGVSKGNAVAKLCEELGLTAENVMAIGDE
FT                   ENDISMIEFAGIGVAMENAVPAVKEAANEITVDNDHDGVAKVIEKFALK"
FT   gene            43139..43849
FT                   /locus_tag="LSL_0035"
FT   CDS_pept        43139..43849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0035"
FT                   /product="Two-component response regulator"
FT                   /note="COG0745 [TK] Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98858"
FT                   /db_xref="GOA:Q1WVS7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS7"
FT                   /protein_id="ABD98858.1"
FT                   /translation="MKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVKEVE
FT                   PDLILLDLMLPKIDGLEVAREVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFS
FT                   NRELVARVKANLRRQSAVAAKSSAEDDKNSEITVGDLTIHPEAYTVSKNGQRIELTHRE
FT                   FELLHYLAQHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSRPTWLVT
FT                   RRGVGYYLRNPEVE"
FT   gene            43878..45743
FT                   /locus_tag="LSL_0036"
FT   CDS_pept        43878..45743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0036"
FT                   /product="Two-component sensor kinase yycG"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG0642 [T] Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98859"
FT                   /db_xref="GOA:Q1WVS6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS6"
FT                   /protein_id="ABD98859.1"
FT                   /translation="MNKKVRFFHSIHFKIALVFALLLLITFQIVGAIFVRQLKNDNLKS
FT                   FKQRVELSTYVENSLIVALSRTDTEGANTKIKNILDDINNANIQEVQVIDAKGTIRGDS
FT                   DVNSRSLIGQKTTNSAVKGVLYTGRTYTETTYNRNDNKQYYISITPLLNVSSNNNAVVG
FT                   AIYTRADMASVYDSVNNVVVIFASASLIAIVIGMVLAIIVSSSITKPIEEMKRQTARIA
FT                   RGDYSGHVHQYGNDELGQLAQAVNNLSIRVEETQELSESERRRLDSVLSHMSDGVIATD
FT                   RRGGITIVNDMAMNYLDISEGEVLGKSILDILDIRNQYTLRDLLEKQDEVVLDMSGEKD
FT                   LILNAYFSVIQRESGFISGIVCVLHDVTEQQKIDRERKQFVSNVSHELRTPLTSMRSYI
FT                   EALNDGAWRDEKVAPEFLKVTQDETDRMIRMINDLLSLSRMDSGTVKLDLELVNINGLV
FT                   NYILDRFDMMLKKDKIDTRDIKTKNYTIKRDFTKRDLWVELDTDKFIQVVDNIMNNAIK
FT                   YSPDGGVITCRLLETHNNVILSISDQGLGIPKKDLGHVFDRFFRVDKARSRAQGGTGLG
FT                   LAISKEVIELHHGRIWVDSVEGKGSTFYISLPYEEYSEEDLWDEN"
FT   gene            45733..47070
FT                   /locus_tag="LSL_0037"
FT   CDS_pept        45733..47070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0037"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98860"
FT                   /db_xref="GOA:Q1WVS5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS5"
FT                   /protein_id="ABD98860.1"
FT                   /translation="MKIRTWMLHLGLILTVVISIAFTWLIWFNPTTFFQNVGRTPVDTS
FT                   SGVTNASNKRLDDVYTPTSLMYNETTTKKYQYFNHRSDITNQAKKIMNRVEITSLKTVA
FT                   KQNVPKYLATVNQSHSLILNYPDVLPIKYVCILFDKAPKKIAENKENVDQIIIPTGNSG
FT                   NTIYFLNSKKQNIYKVSVKNLNVKSLMALTKDKHTQSVATALENIGDGYRWTYPQGVKL
FT                   NEYSYLINKESAGNMVAKLLGANTSATITTKQQDGKTVYSDDANQRMTVDNKHGEVEYI
FT                   NYDSNDKNKPKVSFSKTLEINLAKLNSLGVTLDDVRYSNYESKTGEVIYRNYIAGFPIV
FT                   SEYNYGTYSLQNVTSNGQRFMFSLYGLQVPLPNTNKQKTLPSTSDILNRLSSIGYSSNR
FT                   VRAIKIAYSWQRNDSSSQVVDLVPTYLIKVDGRWIDYEQLFQNFGK"
FT   gene            47082..47882
FT                   /locus_tag="LSL_0038"
FT   CDS_pept        47082..47882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0038"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98861"
FT                   /db_xref="GOA:Q1WVS4"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="InterPro:IPR042274"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS4"
FT                   /protein_id="ABD98861.1"
FT                   /translation="MNFRRIEWIFFLAFIVLDIFLIFTYFQQNWSVVSIKNSNQGANET
FT                   IMKSIRNDQIEINPILSNRASEGYYLASPNSDDLKNKADTDLRYVTWTYNDHKLTGDFT
FT                   TLIKINDSDNPQKTLNSVVDDASLIIHGKDYAYSKELSSKNTIVYTQMVHGKPIYTPEG
FT                   QLRFTVKGSYVVGYTQRHLAKIHQLREVKKTISQRRAVILLYQYNKIPANSTVKWVKLG
FT                   YTKLLTANNNTILIPTWNVKIKSDSSGIVQYRRLNAFTGAIMDD"
FT   gene            47954..48291
FT                   /pseudo
FT                   /locus_tag="LSL_0040"
FT   misc_feature    47954..48291
FT                   /pseudo
FT                   /locus_tag="LSL_0040"
FT                   /note="Similar to conserved hypothetical protein;
FT                   nonfunctional due to frameshift"
FT   gene            48364..49167
FT                   /gene="phnP"
FT                   /locus_tag="LSL_0041"
FT   CDS_pept        48364..49167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="LSL_0041"
FT                   /product="Zn-dependent hydrolase, beta-lactamase
FT                   superfamily"
FT                   /note="COG1235 [R] Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98862"
FT                   /db_xref="GOA:Q1WVS3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS3"
FT                   /protein_id="ABD98862.1"
FT                   /translation="MEDQGMKISVLASGSTGNATYIETPKSKVLVDAGLSGKKIEELMN
FT                   SIGRTLKDVDSLLVTHEHSDHIKGVGVLARRYGMNIYANQGTWDAMSAKIGKVPLEQKH
FT                   IFDMGKALSIGDVDIESFGVSHDAAEPQFYELHHGKSSFAIVTDTGYVPDSVAGVINNA
FT                   EAYLFECNHDTEMLRMGPYSWSLKQRIMSDTGHLSNDDGAAALMDVLGNNTKKIFLGHL
FT                   SQENNVKALAHVTVEDIMKEHDLAVGHDFEICDTDPKQATPLIQL"
FT   gene            49266..50573
FT                   /gene="degP"
FT                   /locus_tag="LSL_0042"
FT   CDS_pept        49266..50573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="LSL_0042"
FT                   /product="Endopeptidase"
FT                   /EC_number="3.4.21.-"
FT                   /note="COG0265 [O] Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98863"
FT                   /db_xref="GOA:Q1WVS2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS2"
FT                   /protein_id="ABD98863.1"
FT                   /translation="MGERGPIEGEFTELNSSNNNQNNNNNNNNKIIKKVALVSLVAGLL
FT                   GGGIAVGGYNWYENRNVTSNNSLGTTKTSNIKVDVSSQTTKAFKSVKNAVVSVEAYSSS
FT                   SASDSLEAIFGNSSKGETTSTSEGSGVIYKKSGNTAFIVTNNHVVSGSNKIEIILASGK
FT                   KVSATEVGHDAVSDLAVLKINAKDVTQVASFGDSDNIQVGETALAIGSPLGSQYATSLT
FT                   EGIISAKKRTIDVTDSSGNATGQATVIQTDAAINPGNSGGPLINLAGQVIGINSMKLSS
FT                   TGTSSYGSDSTSVEGMGFAIPSNEVVKIINQLVKNGKVSRPALGVAVVDLSNISSSDQS
FT                   STLKLPSSVTEGVVIASVESDSPLKNTDIKKYDVITKVNGKKISDVATLKEELYKHKIG
FT                   DTVSIEYYHEGSKKTTNVKLTLEANDSNTTSASNEN"
FT   gene            50970..51449
FT                   /locus_tag="LSL_0043"
FT   CDS_pept        50970..51449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0043"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98864"
FT                   /db_xref="GOA:Q1WVS1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVS1"
FT                   /protein_id="ABD98864.1"
FT                   /translation="MNIKIIGVGKLKEKYLKQGIAEYAKRLGTFCKFQIVEVPDEKAPE
FT                   KLSPAEMEGVKEKEGERILAKIKDKEYVYALAIEGKERSSEEFAKELEDLGTYGTSDIT
FT                   FVIGGSLGLSPEVLKRANTKISFGRFTLPHQLMRMVLAEQIYRGFMINAGRPYHK"
FT   gene            51615..52262
FT                   /locus_tag="LSL_0044"
FT   CDS_pept        51615..52262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0044"
FT                   /product="Oxidoreductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="COG0702 [MG] Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98865"
FT                   /db_xref="GOA:Q1WVS0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVS0"
FT                   /protein_id="ABD98865.1"
FT                   /translation="MAKKILILGAAGEIARMLTDRLLAESDAELVLYGRNVSQRLALEE
FT                   NSRIKLVDGTFGESEKLEAALAGVDVVYLNSMSSPADTASVVQALEKAGVKRLLGATIA
FT                   GVEDEVPYELATWTKNSLPASYIKGEYDSAKIVRDSNLDYTLLRLTWLFNDESDREYEL
FT                   VPSGVEFADAEVSRQAITQAILDILNGEESEYVRKSFGLGKPNTHYGKPSFY"
FT   gene            52274..52666
FT                   /locus_tag="LSL_0045"
FT   CDS_pept        52274..52666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0045"
FT                   /product="Hypothetical protein"
FT                   /note="COG1522 [K] Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98866"
FT                   /db_xref="GOA:Q1WVR9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR9"
FT                   /protein_id="ABD98866.1"
FT                   /translation="MLENWLELQKFRKQVNTELERSLSQMVPAVTVNEFYVLHFLEQNA
FT                   GHDLRVSDLSQKLDLSLSATSRMLVRFEQTCNVITRNQGQEDKRSVRINLTAEGENVLS
FT                   EAKQRIDAVLSKYEEKLVNFGGIKND"
FT   gene            52659..53507
FT                   /locus_tag="LSL_0046"
FT   CDS_pept        52659..53507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0046"
FT                   /product="Short chain dehydrogenase"
FT                   /note="COG1028 [IQR] Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98867"
FT                   /db_xref="GOA:Q1WVR8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR8"
FT                   /protein_id="ABD98867.1"
FT                   /translation="MTKEVVIVTGASKGIGFETVLAALNNDMIVVGTSRTPEKLAAKVQ
FT                   EKLPAKVDNFTAMKMDFNEESIKQVVSEVIAKFGRIDVLVNNAGYAILGAFEDMDMAEV
FT                   RTNFDVNVFGLMSMTQAVLPQMRKQKSGRIINLSSISGSVTGPSQSIYSASKAAVTLMS
FT                   EALAQEVAPYNIKVTALCPWGVRTDFLDESSLKKPATQGGDYKVVDQTLAGLARLNHNQ
FT                   NGDPALVAQAIMKVVDMPNPPARLYLGAGALMAVQSKIEEIVQVANENLELSQSIDNPA
FT                   N"
FT   gene            53643..54395
FT                   /locus_tag="LSL_0047"
FT   CDS_pept        53643..54395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0047"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98868"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR7"
FT                   /protein_id="ABD98868.1"
FT                   /translation="MWKIEREVELKWQQATIKDDLIFTWLFFENKKLTLRLLQIILPEL
FT                   NIKKVGDTQRENNQKKNKIYRGVRFDVLAEDEKGRTYDIEMQVANNDDLGKRISYYQGK
FT                   LSAKSLNEGEKFFEKRDTYVIFICDFDYFGLNLPMYHTTTRLEEDINKVVDTGEYNVIL
FT                   NSRATDFSTVSTEVKAFLKYVRDNKVADDFTKSLDKEVVKIKSSTEVRESFMTWEEKLA
FT                   EVEYHKGKSTMQSIFKYAIIKDVKEQSV"
FT   gene            complement(54734..56122)
FT                   /gene="glpT"
FT                   /locus_tag="LSL_0048"
FT   CDS_pept        complement(54734..56122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="LSL_0048"
FT                   /product="Glycerol-3-phosphate transporter"
FT                   /note="COG2271 [G] Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98869"
FT                   /db_xref="GOA:Q1WVR6"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR6"
FT                   /protein_id="ABD98869.1"
FT                   /translation="MFKKLLAPPGKKPRLSDAEVARKYPRYRTQVIISIFVGYMGYYFV
FT                   RNTTSILSGILKMSATEIGIITCASYIAYGVSKFVSGLISDESNSKIFLPLGLLLSGII
FT                   NIFIGVIPSVITSVWLFTIFYLINGWLQGMGWPPGARTLVYWFGNKERITYGTIWNLSH
FT                   NFGGAIAPLLAGAGLALAGNDPLAQARAAYWFPGVVVCIMAVIIYFIQEDTPESVGLPP
FT                   IEEYRSKEYRESDNAKLEEDAAAVEMSMGEIVKKYILPNTKLMWSSLYAALVYILRYGI
FT                   VSWTPKFLATSIQDGGKGITAAAGMGGFSFFELGGIAGMLIAGWVSAKLFKNSKPLTNV
FT                   ACLILTLVLLVAYWFIPAGPEYMIWDFAILIGLGASIYGPVMMVGLYAMELVPKAAAGA
FT                   AAGLSGTFSYVGGATVATLVIGIIVDNLGWGVAFIVFGISGIAAIICTLLSRDKSLEYW
FT                   DEEK"
FT   gene            56327..56845
FT                   /locus_tag="LSL_0049"
FT   CDS_pept        56327..56845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0049"
FT                   /product="Transposase ISLasa1a, IS1223 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98870"
FT                   /db_xref="GOA:Q1WVR5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVR5"
FT                   /protein_id="ABD98870.1"
FT                   /translation="MTKYTQKFKLDLIQEYLDTGCSQRCLENKYSLPKDTLKKWWTVYN
FT                   LKGPEGLKLRHFKRKFNVDFKLRVINYYLNNDVSMSKVAASHNLLCSQISIWLKLFMEG
FT                   GSEALKPKKKGRPSKMSKMTKKDARKILKKESDEIAALKSELRQVKMERDILKKSLTLF
FT                   GPSKTRRKQ"
FT   gene            56848..57709
FT                   /pseudo
FT                   /locus_tag="LSL_0049b"
FT   misc_feature    56848..57709
FT                   /pseudo
FT                   /locus_tag="LSL_0049b"
FT                   /note="Similar to transposase ISLasa2a, IS1223 family;
FT                   nonfunctional due to frameshift"
FT   gene            complement(57833..58300)
FT                   /locus_tag="LSL_0050"
FT   CDS_pept        complement(57833..58300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0050"
FT                   /product="Transposase ISLasa3a, IS200 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98871"
FT                   /db_xref="GOA:Q1WVQ5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ5"
FT                   /protein_id="ABD98871.1"
FT                   /translation="MANKLNSLAHTTWLCKYHIVFTPKYRRKIIYYQYRKDLIEIIKLL
FT                   CQYKGVKIIEGHMMPDHVHLLVSIPPKQSVSSFMGYLKGKSALMMFDRHANLKYKFGNR
FT                   YFWSEGYYVSTVGLNEQTIRKYIRDQEKHDLSIDKLTTKEYSDPFKGNKLK"
FT   gene            59136..60518
FT                   /pseudo
FT                   /locus_tag="LSL_0050b"
FT   misc_feature    59136..60518
FT                   /pseudo
FT                   /locus_tag="LSL_0050b"
FT                   /note="Similar to reverse transcriptase; nonfunctional due
FT                   to interrupting stop codon"
FT   gene            complement(60583..60777)
FT                   /locus_tag="LSL_0051"
FT   CDS_pept        complement(60583..60777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ4"
FT                   /protein_id="ABD98872.1"
FT                   /translation="MLVDSRLFDWSFFKKFFQNITSKFSYRFIIPLFQIFRKKFLSNYD
FT                   TQFDKIYARIGAINRVGDN"
FT   gene            60786..62045
FT                   /locus_tag="LSL_0052"
FT   CDS_pept        60786..62045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0052"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /note="COG0534 [V] Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98873"
FT                   /db_xref="GOA:Q1WVQ3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ3"
FT                   /protein_id="ABD98873.1"
FT                   /translation="MFSMIISMVYNIADTYFVAKTGNTDLVAGITVSSPLFMFMLAIGD
FT                   IFGLGGSALISRLFGQKRYEESKHVSSFSFYGDIIFTIILTVLLLVFEAPIMHLLGANA
FT                   QTYQYAAEFYRVLVIGSVFITLSLVPGNMIRTEGLAVKSMIATISGTVLAIILDPIFLF
FT                   GFKWGAAGVAFANVLGYALNTGLLIYFTWKDSKFLSFNPKYIKVSWHHFKEIIAIGIPS
FT                   SVTNFMQTFGMALLNNYLVIYGNDKVAAMGITQKVYGIVTLVLVGFAFGAQPLIGYNYG
FT                   AKNAKRFREVLRYDFKVEVVYAIIASLILIVLSPFVIKLFMNNPQIIADGSYMLRVCLL
FT                   TTPFIGAILVYTTVFQSAGKGWSALVMSISRQGVVYFISMVVMAKILGYHGVVMAQPVA
FT                   DILTCVIGYLIYQKDFRKFK"
FT   gene            complement(62094..63575)
FT                   /locus_tag="LSL_0053"
FT   CDS_pept        complement(62094..63575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0053"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG0488 [R] ATPase components of ABC transporters
FT                   with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98874"
FT                   /db_xref="GOA:Q1WVQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ2"
FT                   /protein_id="ABD98874.1"
FT                   /translation="MSTISIKNLSFAYNGQDLLFDNVSLSLDSQWKLGLLGRNGRGKTT
FT                   LLNIIQGKLDYSGKISANIDFEYFPQAISDKDNLTLYAIQDKFHVEQWELEKEFSQLQL
FT                   DPKVLWQPYNTLSGGEQTKVLLALAFKNKNGFVLLDEPTNHLDAHTRQQVATYLNNKKQ
FT                   GFIITSHDRNFLNQVIDHTLVIEAQNIRLQQGDYARYEEQKAIEDKSNLAQNEKLKRSI
FT                   SQLKTSAAQKKNWARSAEREKENNFHADKGFITAKAARVMKRSTTMQKRIESQIKDKEG
FT                   LLTNIETITPLSINFQTSHHQDILNVEKLTLTYPGYDSLFKPISFNLKQGQQVVLKGDN
FT                   GSGKSSLIRAILKQDDIKIIEGNISLASNLKISYLQQLEDNNTDNLKQFAEHHHLEYNE
FT                   LLNILHKLGVERNTFTNRICDLSAGQKKKVFLAKSLLEPANLYLWDEPLNYLDTFNQDQ
FT                   IIELIKTYRPTMLIIEHDSRFIDEIDAEVVELQKN"
FT   gene            63881..64300
FT                   /locus_tag="LSL_0054"
FT   CDS_pept        63881..64300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0054"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98875"
FT                   /db_xref="GOA:Q1WVQ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ1"
FT                   /protein_id="ABD98875.1"
FT                   /translation="MISEVEKYMKSKGISISDVSKASGISVSTLSNAFNKPVTTWSIRI
FT                   LNGLAAATFDDPAKVLAEIQTRPFKYIVDEEKQTIQGFHIEDPQLFWKIESAVHSSVME
FT                   GWQPTKADIMDAYRVATEYQPKIESDFKRIFGEKS"
FT   gene            64386..64970
FT                   /gene="ppiB"
FT                   /locus_tag="LSL_0055"
FT   CDS_pept        64386..64970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="LSL_0055"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COG0652 [O] Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98876"
FT                   /db_xref="GOA:Q1WVQ0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVQ0"
FT                   /protein_id="ABD98876.1"
FT                   /translation="MAYPQLDLENVKGPKATIKTNHGEIVIQLFPEQAPKTVENFVGLA
FT                   KKGYYDGVIFHRVINDFMIQGGDPTGTGMGGESIWGAPFEDEFSNELFNIRGALSMANA
FT                   GPATNGSQFFIVQNQNVPAQMAGQMEAAGYPKEIITAYENGGTPWLDHRHTVFGQVTSG
FT                   MDVVDEIAAVERDMADKPKEDVVIETVEIAE"
FT   gene            65121..65840
FT                   /locus_tag="LSL_0056"
FT   CDS_pept        65121..65840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0056"
FT                   /product="Glutamine amidotransferase, class I"
FT                   /note="COG2071 [R] Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98877"
FT                   /db_xref="GOA:Q1WVP9"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP9"
FT                   /protein_id="ABD98877.1"
FT                   /translation="MRPRIAIPADTLTEATNVINERMAPYAPKPVIEAIVKSGGVPVIF
FT                   PSVSPELVPDYLGLFDGVLFAGGADVDPTFFGEEPHQRLGATYRKRDLFEIELLKQSLK
FT                   ADKAIMGICRGLQLINVGLGGTLYQDLSENPEATIKHSQDAPGNFPSHHVNVQEDSRLY
FT                   SLVGKRPYVNSRHHQLLKKIAPTLRVSAFADDGVPEAIESKENNQILAVQWHPENMFKH
FT                   YEYSQKIFADFIERAKY"
FT   gene            complement(65893..67251)
FT                   /gene="gshA"
FT                   /locus_tag="LSL_0057"
FT   CDS_pept        complement(65893..67251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="LSL_0057"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="COG2918 [H] Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98878"
FT                   /db_xref="GOA:Q1WVP8"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP8"
FT                   /protein_id="ABD98878.1"
FT                   /translation="MFSKIGQLIFDNEAVAKTSDFTMGLEIEMQRVDDTGHLSQEPYPS
FT                   AIGDEKTNPWITNDFLETMSEVVTPAASHALDAMHYLYAINNVLRSALAPGELLWPLSM
FT                   PPKLPKDKSTIQTAKMGPVKEAYFKEFIKRHGFSKGTPCGAHINLSIDDHIIDLVLKNF
FT                   PERFKNRIEVQNYLYTVLAQGFMRYRWLITYLFGASPIAEANYFDKEDELPHPIRSIRQ
FT                   SSYGFGTRFSGCFVDVQKYVKRIEEGLKQGVLIADHDFHSPVRFKGTKDFRDLPKKGVQ
FT                   YLELRMLDLDPSSSVGVRTGTLRFIRLLSSYFIMHPALKADDVDQVLGKADEMNEDVSV
FT                   ELPTDQCKYQNKARAFIKSLERFANQIQLGPEYQEILEDLEDRVENPKTTPSAKLLSYV
FT                   ENNSLEKYALRRAKRYQEAALESIYQFKGFEDDAPMSAEDLKRELFYGNWEVQ"
FT   gene            67454..67684
FT                   /locus_tag="LSL_0058"
FT   CDS_pept        67454..67684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0058"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98879"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP7"
FT                   /protein_id="ABD98879.1"
FT                   /translation="MKIDIKAYLNSKELTIYQVSKYSGYGYTTLHKSFNKKQTSATSLN
FT                   LRDLDALAQSQNKAMWQVLKELEEHYLSDDN"
FT   gene            67810..69918
FT                   /gene="clpL"
FT                   /locus_tag="LSL_0059"
FT   CDS_pept        67810..69918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="LSL_0059"
FT                   /product="ATP-dependent clp protease ATP-binding subunit"
FT                   /note="COG0542 [O] ATPases with chaperone activity,
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98880"
FT                   /db_xref="GOA:Q1WVP6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVP6"
FT                   /protein_id="ABD98880.1"
FT                   /translation="MNNTPFDNFNNMDDIFNELMGSMNGINSERRYLINGREVTPEEFA
FT                   QYRKTGKLPNNNQMTSQGKAPNKDGILAKLGRNLTQEAREGKLDPVIGRNKEIQETAEI
FT                   LARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPASIKNKEIISIDISGLEAGTQYR
FT                   GSFEENIQNLIKEVKDRGNVILFFDEIHQILGAGGMGGDNGSKGLADILKPALSRGEIT
FT                   VIGATTQDEYRNTIMKNAALARRFNQVTVNAPSPEDTFKILQGIRNLYEKHHNVVLPDN
FT                   VLKAAVDYSIQYIPQRSLPDKAIDLIDMTAAHLAAKHPVTDVKELENQIKDEKEKQQAA
FT                   ADKEDYEAALNAKTKIEELQKKIDNHSESQKVTATVNDVAEAVERLTGIPVSKMGASDI
FT                   ERLKEIGKRLKGKVIGQDEAVNAVARAIRRNRAGFDEGNRPIGSFLFVGPTGVGKTELA
FT                   KQLALDMFGSKDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRNPYSI
FT                   ILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTIDFKNTVIIATSNAGFGNEDLMGKDE
FT                   KEDKDIMKKIAPYFRPEFLNRFNAVIEFSHLTKEDLKEIIDLMLDEVNKTLAKKGLDLV
FT                   VTDAAKNYLIEQGYDEAMGARPLRRVIEQQIRDKVTDFYLDNVDVKHLLADMKDGELVI
FT                   SERKDADK"
FT   gene            70130..70606
FT                   /locus_tag="LSL_0060"
FT   CDS_pept        70130..70606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0060"
FT                   /product="Universal stress protein family"
FT                   /note="COG0589 [T] Universal stress protein UspA and
FT                   related nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98881"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN6"
FT                   /protein_id="ABD98881.1"
FT                   /translation="MAQEYKRVLVAIDGSKGADAALRTAIEVTKRNDHTHLDVLRVLDL
FT                   NSLEYGGAGIALDGQKIYEIEQANEGYMLKLKDKIVAEYNLDADRVSVHLRFGNPKAVI
FT                   TQDFQPEYGNDLIVVGSTGKNFVQRMIVGSVASYVIRTAKCDVLMAKVRNGEDK"
FT   gene            complement(70667..70843)
FT                   /locus_tag="LSL_0061"
FT   CDS_pept        complement(70667..70843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98882"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN5"
FT                   /protein_id="ABD98882.1"
FT                   /translation="MDRIQEAKKLEREQIIKEIIQKLSHKGYHLNRIITIMLDLTEFKT
FT                   YEITKCYHEMFLK"
FT   gene            complement(70946..72403)
FT                   /gene="glnP"
FT                   /locus_tag="LSL_0062"
FT   CDS_pept        complement(70946..72403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="LSL_0062"
FT                   /product="Glutamine-binding protein / Glutamine transport
FT                   system permease protein"
FT                   /note="COG0834 [ET] ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98883"
FT                   /db_xref="GOA:Q1WVN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN4"
FT                   /protein_id="ABD98883.1"
FT                   /translation="MLKKAFIFIVSCLCTLLIFTNLNNNHVNADTKTYNIGTDVTYPPF
FT                   EFANKNNQYVGIDIDLMKAIAKEEGFKVNIQPIGFNSAVQSLQSGQIDGVIAGMAITDE
FT                   RKQKFDFSKPYYKTGFIMTVAKNSNITSLKQLRGKRVALKTGTAAANYALSLKDKYGFK
FT                   TVTFDDSDNMYNDVVNGNSVACFEDMPVMQYAIQTGTKLKIVTKPAQSGYYGFAVMKGK
FT                   NQELLHKFDDGLAKLKKNGGYDKIVNRYINQNTIAEQKKANENSNNEHTFIGLLKQNSG
FT                   VFLNGLWKTIYLTILGIIGATIFGIVIGFLGVIPNKFAQGISTTVIYIFRGLPLLVLAL
FT                   FIYNGIPSLTGTKIPAFIAGIITLTLNEGAYTAAFVKGGIEAVDKGQMEAARSLGLSFG
FT                   KAMKKIILPQGIKIMVPSFVNQFIITLKDTSILSIIGILELTQTGKIIIARNLEGFKVW
FT                   AIIGLMYLIVITVLTWISNYLQKKMNS"
FT   gene            complement(72643..73677)
FT                   /gene="ilvE"
FT                   /locus_tag="LSL_0063"
FT   CDS_pept        complement(72643..73677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="LSL_0063"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="COG0115 [EH] Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98884"
FT                   /db_xref="GOA:Q1WVN3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN3"
FT                   /protein_id="ABD98884.1"
FT                   /translation="MTAKEPLTTLDWDNLGFEYMDLPYRYRAYWKDGEWHKAGLTEDST
FT                   LAMNEGSTALHYGQQAFEGMKAYRTKDNHVQLFRPDRNAARLQDSCRRLLMPEVSTEMF
FT                   IEACKSVVRANEAYVPPYGTGGTLYLRPLIIGVGPNIGVHPAKEYIFTVFAMPVGNYFK
FT                   GGMVPTRFLVSNYDRAAHKGTGASKVGGNYAASLLPGDKAHKEGFSDCIYLDPVEHKKI
FT                   EEVGSANFFGITKDGKFVTPKSPSILPSVTKYSLLYLAKERFGMEVEEGDVYIDELDHF
FT                   AEAGACGTAAVISPIAGFQVGDKYHQFYSETEVGPVTKKLYDELTGIQFGDKPAPEGWV
FT                   VRVD"
FT   gene            74540..76056
FT                   /locus_tag="LSL_RNA001"
FT   rRNA            74540..76056
FT                   /locus_tag="LSL_RNA001"
FT                   /product="16S ribosomal RNA"
FT   gene            76070..79029
FT                   /locus_tag="LSL_RNA002"
FT   rRNA            76070..79029
FT                   /locus_tag="LSL_RNA002"
FT                   /product="23S ribosomal RNA"
FT   gene            79274..79390
FT                   /locus_tag="LSL_RNA003"
FT   rRNA            79274..79390
FT                   /locus_tag="LSL_RNA003"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(79497..80489)
FT                   /gene="scrR"
FT                   /locus_tag="LSL_0064"
FT   CDS_pept        complement(79497..80489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="LSL_0064"
FT                   /product="Sucrose operon repressor"
FT                   /note="COG1522 [K] Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98885"
FT                   /db_xref="GOA:Q1WVN2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN2"
FT                   /protein_id="ABD98885.1"
FT                   /translation="MRAKLSDVAKKAGVSPTTVSRVINNYGYISDKTRNKVHEAMKELN
FT                   YQPNSLARSLHGKKTNLVGLIFPGVSNPFFGELVEEIENKLFEDGYKVILCNAAYNKEK
FT                   ERSYLRMLLANQVDGIIAGAHNLGIDEYQEFGLPIVSFDRSLSENVPIVSSDNYKGGVI
FT                   ATQELYDAGCRHIYFVGNPVQKGNPTDHRLSGYRDTIKKLGLTLHIHPVSFSETPMLKI
FT                   MAIKQLLSEHKADGIVCTDDLTALLVIQAAQELGINIPEQLKITGFDGTKFIQQYHPEL
FT                   STVVQPTKDIAALLVKLLERRIAHPDEDLKQKSYILPIRFIKSKTISDN"
FT   gene            complement(80508..81998)
FT                   /gene="scrB"
FT                   /locus_tag="LSL_0065"
FT   CDS_pept        complement(80508..81998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrB"
FT                   /locus_tag="LSL_0065"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /note="COG1621 [G] Beta-fructosidases (levanase/invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98886"
FT                   /db_xref="GOA:Q1WVN1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN1"
FT                   /protein_id="ABD98886.1"
FT                   /translation="MEWTRESRYKKYSEWDAETLLKLQAQATASKYQMSYHIRPQSGLL
FT                   NDPNGFSYFNDEYHVFYQSYPFGAVHGLKSWVHLTSPDLVHWKNLGLAINADTKYDSHG
FT                   AYSGSARVIDDKLFLMYTGNHRSKEWVRYPYQIGAIMDKDNNITKLDKPMIEPVDHITE
FT                   HFRDPQLLKHRDEYFVILGAQDAETKTGKISLFRSKDLKNWQDLGYLDFTEEEMGYMVE
FT                   CPNLVFVDDQPVLIFCPQGLDKKVADYENIYPNMYIVGSDIRLDKAKFNTNQKALLNLD
FT                   DGFDVYATQAFNAPNGKAYAISWIGLPDISYPTDSENWANCLSQVKELSIVDGELYQRP
FT                   VPAMASLREEGTLVRSEEVFDGQQIVHSAASKHYELKLDLAAGQNGKLFLAANKDLSQG
FT                   IEINFSTADDAFLTVDRSKAGIPFAEDYGTTRTIALPANKQLSLDIFVDGSVCEIFVNN
FT                   GRHTLTLRFFAPDGNNKIAFTSDKKLQYTGTYWNMKNI"
FT   gene            82401..84335
FT                   /gene="scrA"
FT                   /locus_tag="LSL_0066"
FT   CDS_pept        82401..84335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrA"
FT                   /locus_tag="LSL_0066"
FT                   /product="PTS system, sucrose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="COG1263 [G] Phosphotransferase system IIC
FT                   components, glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98887"
FT                   /db_xref="GOA:Q1WVN0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVN0"
FT                   /protein_id="ABD98887.1"
FT                   /translation="MDHKKVAKNVVDAVGRDNLIAAAHCATRLRLVLKDDKKVNQAALD
FT                   ADPDVKGTFKTNGQYQVIIGPGDVNNVYDELIKDTGLKELSTDDLKKVAEQGQKFNPVM
FT                   AFIKLLSDIFVPIIPALVAGGLLMALNNFLTQPGLFGPKSIVSTSPVIKGLSDMIQLMS
FT                   AAPFIFMPILVAISASKRFGANRFLGAAIGMIMTSPDLGKTAKYWDIFGMHVAQTNYAY
FT                   QVIPVIAAVWVLAFLEKRFHKWLPAAVDFTFTPLLSVMITGFLTFTVIGPVLKTVSDML
FT                   TNGIVWLYDTTSFVGMGIFGLTYSAIVMTGLHQSFPAIETQLVTAFANGHGAGDFIFVV
FT                   ASMANVAQGAATFAIYFLTKDKKMKGLSSSAGVSALLGITEPALFGVNLKYKFPFFCAL
FT                   IGSGVAAAFAGLMHIIAASMGAAGFIGFLSIYPKSIPMYVVAELISFAVAFILTFIYGK
FT                   GHMKEEQVAPVVSASEAAETEAKVEEQVAAESKLNDEVVAAPISGESKKLTDVNDPVFS
FT                   TLAMGNGAAVVPTDGTIYAPVDGELTVAYETKHAYGLKSDNGAEVLIHVGIDTVNLKGQ
FT                   HFESFVKQGQKVKKGDKLGTVDLDAVKAAGYDTTVMVVVTNTMNYASVDRIDNTKVNHG
FT                   DDLVAVTAR"
FT   gene            84450..86195
FT                   /gene="amyB"
FT                   /locus_tag="LSL_0067"
FT   CDS_pept        84450..86195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyB"
FT                   /locus_tag="LSL_0067"
FT                   /product="Neopullulanase / Cyclomaltodextrinase /
FT                   Maltogenic alpha-amylase"
FT                   /EC_number="3.2.1.135"
FT                   /EC_number="3.2.1.54"
FT                   /EC_number="3.2.1.133"
FT                   /note="COG0366 [G] Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98888"
FT                   /db_xref="GOA:Q1WVM9"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM9"
FT                   /protein_id="ABD98888.1"
FT                   /translation="MNKAAILHIPASEMAYYENKDELHLQLQSAHNDLADVTVLVGEVS
FT                   GNNNDSWRYESFFMQKTFATRYHDYWEVILKLNKNEAQYVFKVTDTYGNVGLYDAQRLC
FT                   EATEENANSPHGFIIENRDMRQVTQIPDWVTKTVWYQIQIDRFANGNDNLAKLSENEDN
FT                   TTQILGGDLTGILSKLDYLQNLGINGIVLSSIFEGDGPFKLTTNDFYSIDSQFGNKDLF
FT                   KMLVSNLHRRNMKVVLKMNLAYLSDNSRQWREILEEGQHAKYVDWFNIKGFPPKYSQDP
FT                   HNKNIVRANYKFSELNPHYPTLNLKNPEVQTYLIQAIKYWVEHFEIDGLILDHADKLSR
FT                   EFVHLLNRNLKKMKSNFYLVGKSEMSNTSVVQLGDFDAMTDDVLGNLLLNFARDKKIAA
FT                   SEFKYQLSRQMLAQNTKLSRVTLRTLDDLTSSRILTRCRENKALMRSLLTFMYLLKGSP
FT                   AITYGTELGLSGHDFPSNLAGMDWNQEDQDDKMMRFIKVLNTFRLQNYKILSEGSFEWG
FT                   QISDSYDYVSFIRRKDKRRLFALFNFGYNGIKFVLPKHAKLILGQNIVDEKSEIGQYGF
FT                   VILEA"
FT   gene            86310..87698
FT                   /gene="ktrB"
FT                   /locus_tag="LSL_0068"
FT   CDS_pept        86310..87698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB"
FT                   /locus_tag="LSL_0068"
FT                   /product="Potassium uptake protein ktrB"
FT                   /note="COG0168 [P] Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98889"
FT                   /db_xref="GOA:Q1WVM8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM8"
FT                   /protein_id="ABD98889.1"
FT                   /translation="MYGRRKMRTRQGLSRIQIITLSFLLAIMIGSLILMLPIMSANGES
FT                   TDFVDALFTATTSVCITGLVTVTTATHWSSLGHIVILLLIQLGGLGTITLMSLAFFATG
FT                   KRISLQNRLLMADAFNLDNNKGIVNFVIRVIKESLMIEGLGAIAYSIYFIPHFGFLTGS
FT                   WYSIFHSVSAFCNAGIDLLADNSLIAYAGNWWLNIVTMLLIVCGGLGFTVWNELIKGFV
FT                   NQYRYYKNGRGKRLKNTLSQHTKMVLTTTFALIFGGAILYYLFERSNPNTLGSVKNSQA
FT                   MLEALFQSVTTRTAGFVTIPQANLTIPSVMLTVFLMFIGGSPTGTAGGIKTTTLAVILA
FT                   EVRATIKGEPEAICFKRQVPRQTTRKAIAITLISVAASVLAVLLMYFIQPGDMTDNVFE
FT                   VYSALGTVGISRDLTPHLTTVAKYLIIVCMYLGRVGPISILLALMRRKHHANLKYAPGN
FT                   IRVG"
FT   gene            87718..88356
FT                   /gene="ktrA"
FT                   /locus_tag="LSL_0069"
FT   CDS_pept        87718..88356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrA"
FT                   /locus_tag="LSL_0069"
FT                   /product="Potassium uptake protein"
FT                   /note="COG0569 [P] K+ transport systems, NAD-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98890"
FT                   /db_xref="GOA:Q1WVM7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM7"
FT                   /protein_id="ABD98890.1"
FT                   /translation="MDRSYAVFGLGEFGRSVSYELMEIGADVLAVDKNENKITAIADDV
FT                   TMAISIDALNEMAYEKLGLNNMDGVVVSMSGNLSASIMAIIAAKDAGVPLVIAKASDDT
FT                   QRTIFKKVGADRVVIPERDGAVRTAHNLVAKNFLDYIELSDKISIIEINVKDEWLHKPL
FT                   AELNLRSKYGLNVIAIRRNNDLQTDIGPNLTFDKGDTILVVTDKHDLGL"
FT   gene            88433..89086
FT                   /locus_tag="LSL_0070"
FT   CDS_pept        88433..89086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0070"
FT                   /product="Putative Zn-dependent protease"
FT                   /note="COG2738 [R] Predicted Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98891"
FT                   /db_xref="GOA:Q1WVM6"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM6"
FT                   /protein_id="ABD98891.1"
FT                   /translation="MKTIFRLIVRLGIIAVILVGIQKVLTTPRYLQAIMPYVNQVEELL
FT                   GKKTNYTLGSGEQKNKVQTDNVKYDNNRWPNNTATVYIDIDDSTLYNAFVSAIKQWNNT
FT                   GAFTFKIVNDKKGADIVGKLMENDDGTAGTTDTTTDEQTKRIIKATVYLNRYYLESATY
FT                   GYSEQRIINTAEHELGHAIGLDHTDEVSVMQPAGSYYTIQPRDVDVVKKLYQEN"
FT   gene            89113..90129
FT                   /locus_tag="LSL_0071"
FT   CDS_pept        89113..90129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0071"
FT                   /product="N-acetylglucosaminyltransferase"
FT                   /note="COG0463 [M] Glycosyltransferases involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98892"
FT                   /db_xref="GOA:Q1WVM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM5"
FT                   /protein_id="ABD98892.1"
FT                   /translation="MEDYLITIVIPMYNVENSIERLIISISKAFKNQESLVEVLAIDDG
FT                   STDKTVKIFEKLQKKNQALALKLIKNSHGGVSKARNTGIKYSTGQYVTFVDSDDELTLV
FT                   DVVDLKGKLAQNAEIIIFDTDRNNVIDLNKDNNRAEVLAEIAMLGKHAISTGIQDKIYL
FT                   RSFLIENKIAFNDKLRVGEDTLFVFDAVSLANKVVETNSKFYMVHGSSSVHLFNEYNVT
FT                   NELLFRKYMLEILSRLEADPTIEKIKIRFGITGIIFLIECYFAPLVRTGRLTYTEAKVK
FT                   LEDIVREGQYEGFDSNIFDKALSKRGKIFRRLINKGMFKTVIFLLNTEDRIKGIKRI"
FT   gene            complement(90207..90479)
FT                   /locus_tag="LSL_0072"
FT   CDS_pept        complement(90207..90479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0072"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM4"
FT                   /protein_id="ABD98893.1"
FT                   /translation="MNEKNLEVKINENDIVPAQVIKVNNKTITLKTEDNEIITVDRPKS
FT                   TIKDKLFLKTMIDILRSGIWIPVNKKLKQLLRYDWFDSLEEYQFL"
FT   gene            90664..92457
FT                   /locus_tag="LSL_0073"
FT   CDS_pept        90664..92457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0073"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0344 [S] Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98894"
FT                   /db_xref="GOA:Q1WVM3"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM3"
FT                   /protein_id="ABD98894.1"
FT                   /translation="MKRNIVLILCCIFLSLIGIKNIQADVNYDVKDYTVNVDVQKNGSL
FT                   IIKRHIRYDFPDEAHGVYYRQNLESNQQISQTQVWINGQEAKQNDSAGNNTYKLTRDDK
FT                   GYLFKVYHNVDNQEVNFTYQYVLNNAVINWKDTAELNFKVIGDGWETELNNIKVTIKLP
FT                   GQDVSELQAWSHGPLTGTTKVDKKSGQVTLSLAELPAKNFVESHILFPVALTPENTNVR
FT                   NEKHKAEAQKQEKQLALEANRKRKAQERKDRLWAGAMFVVICVGSFGSILYNLMPLKEK
FT                   TYRPLSVKNAPHVFELPNYEAAVAQSLFRDTDPDNKALSAYLLELSVKRIIKIEPIPNK
FT                   KKDYLLTLLDETALSNNEILKLLFNKIGDTKQVSMKQIKKYGKKKHEHMNVVNAYKAWQ
FT                   KSVRDEADKLGWVSDNAKSAMIRRAIISGILLLILIVGLIVTDNTAALWVMGVSLVLLV
FT                   VSILYFIMKGSIYTKTGAAGMTELRGFYRMMDDIGRFNLKEVGDIVLWEGLLPYAVALG
FT                   LSKKVSKALIDNFTSEELQNSNFIYYYPFIYHNGIANFSNDFNSSFTRGMGNYSSPSGG
FT                   SGGFSGGSSGGFGGGSGGGAF"
FT   gene            92594..93130
FT                   /locus_tag="LSL_0074"
FT   CDS_pept        92594..93130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0074"
FT                   /product="BioY protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98895"
FT                   /db_xref="GOA:Q1WVM2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM2"
FT                   /protein_id="ABD98895.1"
FT                   /translation="MKTKNVALIAMMTAIIIVLGFVPPIPLGFIPVPLVLQNMGIMLAG
FT                   AILGSKRGFLSVIIFLLLVAVGLPLMTGGRGGVAVFVGATAGYIYAYPFAAALMGYGLK
FT                   KFSHSNFWLELLIVWVVGVIFIDVLGAVGLTAIAHMPFIKALISNLVFIPGDTIKALVV
FT                   VLIYRRLKKMNVIER"
FT   gene            93373..94629
FT                   /gene="dacC"
FT                   /locus_tag="LSL_0075"
FT   CDS_pept        93373..94629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="LSL_0075"
FT                   /product="D-alanyl-D-alanine serine-type carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="COG1686 [M] D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98896"
FT                   /db_xref="GOA:Q1WVM1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM1"
FT                   /protein_id="ABD98896.1"
FT                   /translation="MFKKLKKLGISILTSLIIVTGVGQLSLIKADQTLPQLDLEAKSAI
FT                   AIDAKTGQIIYAKDDKQTYPVASMSKLLTAYILLQAIHKGEVTWETKVTPTATEVDISN
FT                   NTELTNVPLQEGHSYTIRQLYQAMLVGSANAATMLIGNAISGTQTKFIDKMRETAKSLG
FT                   ITDAKIYSANGLTAKYLGDEIYPNTDENAENEFSVRDMAIISQKLIKEYPEILETTKLT
FT                   KIDFNDNGEITTVNNTNELLQDDSNLEIDGLKTGTSDAAGYCFASTTNKDGHRIITVIA
FT                   GAKDNDARFDQTKNLLNYIYNNYDYLAISTNQALRQDAKVKYGKQSSVSAIIGNDLSLW
FT                   VPKNTREKALQIKLTPKSSTIEAPIKQGETVGDYQITIAGNLGFVDGSTDLKTKAIAAN
FT                   SVEGINIFIKWWQMLTDAI"
FT   gene            94842..95618
FT                   /locus_tag="LSL_0076"
FT   CDS_pept        94842..95618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0076"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /note="COG1349 [KG] Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98897"
FT                   /db_xref="GOA:Q1WVM0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVM0"
FT                   /protein_id="ABD98897.1"
FT                   /translation="MLSQEQRLEEIKEMLAKKHKLTTHELADHFGIAFDTARRDVLRLT
FT                   STGQAARIHGGLMEIKFNNVPGFVTRSHIQSPIKAKMARLAREEFNPSGLYFVGASTTL
FT                   MQMCEQLGQVNTTIMTNSIDNAVRLMLNKLPEVELLGGKIDKGNRYTYSMETLSQLDNI
FT                   TFDAAFIGTSKIQPDGVMVVDSYDAAIAKKVVERSRKVILIAQKYKFVTNNSSPYKSAN
FT                   LKDIDVLITDVPLEEKYRKYFKPDIKIKYVKEDETK"
FT   gene            95615..96419
FT                   /pseudo
FT                   /locus_tag="LSL_0076b"
FT   misc_feature    95615..96419
FT                   /pseudo
FT                   /locus_tag="LSL_0076b"
FT                   /note="Similar to hydrolase (HAD superfamily);
FT                   nonfunctional due to frameshift"
FT   gene            complement(96478..97142)
FT                   /pseudo
FT                   /locus_tag="LSL_0076c"
FT   misc_feature    complement(96478..97142)
FT                   /pseudo
FT                   /locus_tag="LSL_0076c"
FT                   /note="Similar to immunity protein PlnL; nonfunctional due
FT                   to frameshift"
FT   gene            complement(97235..97936)
FT                   /locus_tag="LSL_0077"
FT   CDS_pept        complement(97235..97936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0077"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98898"
FT                   /db_xref="GOA:Q1WVL9"
FT                   /db_xref="InterPro:IPR032083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL9"
FT                   /protein_id="ABD98898.1"
FT                   /translation="MSIILLIIALIFFFICSVIPFNKYHGIIAFFFLVIATLSGVSIVA
FT                   NDTYHYGMKVKTTTTRYQLVSASDKMNVLLYQPLGNGSEKVYLYKTSSKQKIKPMKTKD
FT                   SSAKYVITSDKPNVTITEKRYVYKDGVSKFFFGILHNNNELKHRYYTFNINRDWNVLTA
FT                   KQAKELDKLVKKNQAALKSQVKTEVKAKVAAAMQANPQMSAEQQKELIQQAQNEATQAA
FT                   MQKLIQSVKEK"
FT   gene            complement(97936..99414)
FT                   /locus_tag="LSL_0078"
FT   CDS_pept        complement(97936..99414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0078"
FT                   /product="Multidrug resistance protein B"
FT                   /note="COG0477 [GEPR] Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98899"
FT                   /db_xref="GOA:Q1WVL8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL8"
FT                   /protein_id="ABD98899.1"
FT                   /translation="MAETQATDIYGKPYNRSLLVLVLMIGSFCTILNATLLATAFPAIM
FT                   KSFDISTATVEWLTTGFMLVNGVMIPISAWMINKFNTRTMYIGAMSTFFVGTLLSFIAP
FT                   NFATLLAGRLIQGLGVGVSMPLLQTIMLSIFPPEKRGAAMGTVGIAIGVAPAIGPTLSG
FT                   WIVDNFSWRDLFGMMLPIVLGVIILSIFLMRNVIPNRDQDIDVISAITSIIGFGSMLYG
FT                   FSKAGNDGWTDPLVLAFILVGIIFVILFGWRQLKMEVPFLDISVFKYGEFSLAAILSSV
FT                   SNLAMMGIEMILPLYIQNIRGESAFHSGLILLPGAMAMAIMSPITGRLFDRYGARYMAI
FT                   TGLTMLSLGTLPFLFLTSHTSILYITVFYAVRMFGIAMVMMPVTTSGMNVLPFKQISDG
FT                   TAVNNTFRQVVSSIGTAILVSVLSTTTKDNMPAKSLLHATPLAYRDKAIDAVLSGYTAA
FT                   FLVAAIFAIVALALAFFLKKGNRAREAAMLGGKK"
FT   gene            99569..100015
FT                   /locus_tag="LSL_0079"
FT   CDS_pept        99569..100015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0079"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98900"
FT                   /db_xref="GOA:Q1WVL7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL7"
FT                   /protein_id="ABD98900.1"
FT                   /translation="MFFQNTDGKRAMDDIQIGIGDMSKSTGVSSRQLRYWEEKGYIKSI
FT                   NEGDGNKRKFTINEYYHIRLIKHFLDEGYTLNASIEKAEERRQQLLVLRRFGVEIIKDV
FT                   EVTDKDKHYGKIDLGKVCNDENKHAYGIVTEDGCSIEIEKEGEE"
FT   gene            100015..100395
FT                   /gene="gloA"
FT                   /locus_tag="LSL_0080"
FT   CDS_pept        100015..100395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="LSL_0080"
FT                   /product="Glyoxalase family protein"
FT                   /note="COG0346 [E] Lactoylglutathione lyase and related
FT                   lyases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98901"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL6"
FT                   /protein_id="ABD98901.1"
FT                   /translation="MDFSKVHHIAIIGTDFEEMKEFYVDKLGFTLLDKHVRPEKNDILF
FT                   NVGFGEMVLEIFIKEDAPVRPTYPEAKGLRHLAFRVDSVEETVKELTAKGVECEPIRND
FT                   TFNGKAMTFFYDPAGTPLEIHE"
FT   gene            complement(100444..101130)
FT                   /locus_tag="LSL_0081"
FT   CDS_pept        complement(100444..101130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0081"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG1811 [R] Uncharacterized membrane protein,
FT                   possible Na+ channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98902"
FT                   /db_xref="GOA:Q1WVL5"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL5"
FT                   /protein_id="ABD98902.1"
FT                   /translation="MIGTFFNVSTILIGSLLGNYFKKSFADKYQEILMQAMGLAATCLG
FT                   MQAVLQNLPKSKLPILFILSLAIGGVLGVKFDLATRFSNSVKKFSNSKSSEGLSTAILL
FT                   YCMGTLSILGPVEAALHHNYTYLFTNGILDGITSIILASTFGLIIMLAALVLFFWQGSF
FT                   YLIAFLLQSNVNPDFLHELSIVGGVLILASGLSILGIKKFETMNLLPSLLVSGILFFIL
FT                   HYIGTI"
FT   gene            complement(101288..102583)
FT                   /locus_tag="LSL_0082"
FT   CDS_pept        complement(101288..102583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0082"
FT                   /product="Putative sugar-binding protein"
FT                   /note="COG1653 [G] ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98903"
FT                   /db_xref="GOA:Q1WVL4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL4"
FT                   /protein_id="ABD98903.1"
FT                   /translation="MKKRYIILSVLLMILVIISEIFIYQKKQKVITIGIYSDSSWDVPN
FT                   DNEYKFIDYVVKKFEKENPNVKVKYESGINKNDYLEWLSQKIVDNKAPDVFIVPSEQFG
FT                   FLSSLGTMRNLNYFMDLSGLNTDDYYPTNLKAGMSAGKQYALPLESNPMMMCVNTDLLK
FT                   KEHITIPKSGWTLNDFYRICRQVTKDTNHDGVVDQFGYADYSWKDAAQAYNAKLFNSQG
FT                   TASYFNSDKVRQALTMMEKLYNLQKDYKVTADDFDKGKVAFLPMTLAQYRTYESYPYRV
FT                   SRYSSFSWTCIRMPGATPDINSTYVNTSMVAMSSQSTHPLLSWKLVKFLSNNGDVQQKL
FT                   FTYSQGASVLKSVMKSKDITENLQKENNADNALTEEKFVSIMAKSQKYPEFKNYNNVMQ
FT                   TADYLINNALENGNVEVQLSNIQNQIQEELAK"
FT   gene            complement(102593..103249)
FT                   /locus_tag="LSL_0083"
FT   CDS_pept        complement(102593..103249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0083"
FT                   /product="Two-component response regulator"
FT                   /note="COG2197 [TK] Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98904"
FT                   /db_xref="GOA:Q1WVL3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL3"
FT                   /protein_id="ABD98904.1"
FT                   /translation="MIKVLIADDQKLIRESLKIVLDTYQDIQVIDTVGDGKQVLESIEE
FT                   QEPDVILMDIRMPNMDGTVSTKLVKQSYPHIKIIILTTFDDDDFIFSALKYGASGYILK
FT                   GVSPTELHDAITTVYNGGSMINPNIAAKVVKLFSKMAQSDFEIDVDKEGAALITDAEWR
FT                   VIYQVGRGLSNKEISQELFLSEGTVRNHLSHILSKLNLRDRTQLAIWAVQNAPRK"
FT   gene            complement(103265..104566)
FT                   /gene="baeS"
FT                   /locus_tag="LSL_0084"
FT   CDS_pept        complement(103265..104566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeS"
FT                   /locus_tag="LSL_0084"
FT                   /product="Two component system histidine kinase"
FT                   /note="COG0642 [T] Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98905"
FT                   /db_xref="GOA:Q1WVL2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL2"
FT                   /protein_id="ABD98905.1"
FT                   /translation="MMNRLTKATYVYWLLVMINFVSVMFNVSLYLLITSYISKKNLSLY
FT                   LLQQLQVIPGNFRLLFWVVFVLFGCLVTVIYLRRTSPNKKTNKLLWLELLLIVLIFWLT
FT                   KATYGGLVFLAFADIFFSTDDFHTISNKFYWLIFIIVASVCLLVSNSNFLATLISLPSL
FT                   EIYISFLPSHVATLLSLMRLFLFIISIVIFTLALFTHVVYITNEKRNIEEELRMADHAN
FT                   VELQHYISVAEENAELRERKRISREIHDTLGHALTGISAGIDAVLVLIDMDKDSAKEQL
FT                   RNLSEVVRQGIVDVRKSLNKMRPGALEKLSLYDSIVDMISRYDNIPTLTIDLDFQWQGV
FT                   DLEKTTENVVFRIIEESITNSIRHGHAEKIWIRMTKDDKYYYIEIHDNGKGSPTIKPGF
FT                   GLTQMQERLAIIGGTVTYQGDHGFTTKIKFIIKN"
FT   gene            complement(104563..105555)
FT                   /gene="rbsB"
FT                   /locus_tag="LSL_0085"
FT   CDS_pept        complement(104563..105555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="LSL_0085"
FT                   /product="D-ribose-binding protein"
FT                   /note="COG1653 [G] ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98906"
FT                   /db_xref="GOA:Q1WVL1"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL1"
FT                   /protein_id="ABD98906.1"
FT                   /translation="MKYKLTKFIKKKDFVRLISIAIFLLGIILVVWISSFYMPFVKQPV
FT                   KIGSTYMTLNNSFYKTINEEVKKQVSQNGDILYTRDPGLSVSKQCQQIYDFIDKKVDVI
FT                   LINPVNGESKQIQHALKIAHDKGIKIVVVDSQLSNSSFVNANVVSDNFKAGVLDAKYMM
FT                   KSSPQAKILVLRHWNALSVKERYRGFVSEIKDNPNYQITENLETLGQTDVALKNVQELL
FT                   KVDPDKFDIIMAMDDQSAVGALAAMDALNLHNKIMVYGIDGSTNMKHLLLSNPNAQATV
FT                   AQSPIKLGQKSIQVCYKLVKGKKVPKDVVVPVFLLTKKNINDYDVSGWQ"
FT   gene            105826..106824
FT                   /gene="manX"
FT                   /locus_tag="LSL_0086"
FT   CDS_pept        105826..106824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manX"
FT                   /locus_tag="LSL_0086"
FT                   /product="PTS system, mannose-specific IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="COG2893 [G] Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98907"
FT                   /db_xref="GOA:Q1WVL0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVL0"
FT                   /protein_id="ABD98907.1"
FT                   /translation="MVGVILASHGGFADGIHQSAEMIFGPQENFKSCILKPDEGPEDVK
FT                   KKMQEAVASLDNQDEVLFLVDLWGGTPFNQASSLVKEHEDKWTIVAGMNLPMVIEALTQ
FT                   RFSVESAREIARAIVPTGNDGIKTFPEDAMPVKKEADTKAVKTSGKKKTIPEGTVLGDG
FT                   HIKYVLARVDTRLLHGQVATGWTHTTQPNRIIVVSDTVCHDKLRTSMIKQAAPNGVRVS
FT                   VAPIKNMAKANNDPRFGDTRAMLLFESVEDALAAVKAGVEVKEINLGSSAYKEGKVNVT
FT                   KALSFDQTDVDSIKELQSMGVKFDVRGVPADSPANIDDLIKLAEKKLAEKN"
FT   gene            106843..107652
FT                   /locus_tag="LSL_0087"
FT   CDS_pept        106843..107652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0087"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="COG3715 [G] Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98908"
FT                   /db_xref="GOA:Q1WVK9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK9"
FT                   /protein_id="ABD98908.1"
FT                   /translation="MSTIQIILVVIVAFIVGCSSVNDQIETYQPVVACSLIGLVTGQLE
FT                   LGVMLGGSLQLITMGWANVGAAMAPDAALAGVASAIILIEGNQGAQGIGPAIALAVPLA
FT                   VAGLGLTMIVRTATVFIAHIMDKRAEKTDINGIQAWHFIGMTLQGLRVAIPALLLMLIP
FT                   VSLVRQGLEAMPEWLTAGMTIGGGMVVAVGYAMVINMMSSREVWPFFFLGFALAAIKQL
FT                   TLISLGIIGVCLAILFLALEGSGGSSNGSSNGSGDSDDPLGDILEDI"
FT   gene            107671..108585
FT                   /locus_tag="LSL_0088"
FT   CDS_pept        107671..108585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0088"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /EC_number="2.7.1.69"
FT                   /note="COG3716 [G] Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98909"
FT                   /db_xref="GOA:Q1WVK8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK8"
FT                   /protein_id="ABD98909.1"
FT                   /translation="MEEKKIKLTKADRFKMFLRSYFLLSSFNYERMQNGGVAYTLIPAI
FT                   KKLYSSKADRAAALKRHLEFFNTHPFMANPIFGVTLALEEERANGANVDDAAISGVKIG
FT                   MMGPLAGAGDPLFWFTLRPIMLSLGASLAVSGNVAGPFVFFILWNIMAAAVKWYTQEFG
FT                   YRAGTAITDDLSGGLLQKVTRGASMMGMFVIGSLIQRWVSITFTPVVSTVKQQKGAYID
FT                   WEKLPAGAKGLKEAFTQYAAGRSLSETKVTTLQDNLDQLVPGLAALGLTFLCMYLLKRK
FT                   VSPIVIILGIFVLAIVFHVIGLL"
FT   gene            108607..108996
FT                   /locus_tag="LSL_0089"
FT   CDS_pept        108607..108996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0089"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98910"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK7"
FT                   /protein_id="ABD98910.1"
FT                   /translation="MVKSLNTKMDMSCKGTWYRNGPFYGNIMVGDNAFEFYNETKLQDY
FT                   IQIPWDEITYVVADVYFGGKYIPRFEIRTKSNGTFRFSARNSRQTLRAIKARIPRESLR
FT                   KAPSMGFILKHRFKNLGKIILKKKA"
FT   gene            complement(109121..110671)
FT                   /locus_tag="LSL_0090"
FT   CDS_pept        complement(109121..110671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0090"
FT                   /product="Hypothetical secreted protein"
FT                   /note="COG1388 [M] FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98911"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK6"
FT                   /protein_id="ABD98911.1"
FT                   /translation="MKKTAQKLLVGTVGAAGVLLASSTAANADSTTTHKVKQNETVWAL
FT                   SKKYGVSIQSIEKLNRINSNHLIITGQTLQIPSKDGSQTVNKNDNKSTYTIKSGDTLWR
FT                   IAQNNHISLDELLSLNNLNASDIIYPGQVIKLTSAAATSTSNTQQQVQDKAAVTTPATD
FT                   NQSSQAQATSASSSSQAVSTAQNSSAATTAASSSVTTPATSQAATTSSSSSVTQQPAAS
FT                   SSSAVQQSSSQVTTQSSSEVKDDNAQKVQYTAKAGDSLYSIAQSFGVSIDSLRSNNNLG
FT                   ATLLPGQTLTIVNPTKTPSQEESSSNSVATNNTATTSSAAQSSSQQSVANNSVAQTSSS
FT                   QQQTVTTPAASSSSAASSSSVAQTNNTQQATTTNTAATNNNATTVNTSNVTTTTNTGSA
FT                   SASAIISYAQSFIGVPYVWGGSTPSGFDCSGLVQYVYAHYGVNLPRVTTAQENAGTVIP
FT                   VSAAQPGDLYFWGAKGSSYHVAIATGGGSFIHAPEPGESVKVGSTQYFQPSFAVRVLQ"
FT   gene            111092..112183
FT                   /gene="serC"
FT                   /locus_tag="LSL_0091"
FT   CDS_pept        111092..112183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="LSL_0091"
FT                   /product="Phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="COG1932 [HE] Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98912"
FT                   /db_xref="GOA:Q1WVK5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK5"
FT                   /protein_id="ABD98912.1"
FT                   /translation="MTKVYNFSAGPAVLPKEVIKKAQDELTSFKGSQMSVMEISHRSSL
FT                   YTEMFQKAEEDLRYLMEIPDDYDILFQQGGATLQFTTVPLNLANNYRRIGYIDTGHWSQ
FT                   RAYQEAELLHKFDVDVVASSKDSNYTELVHQVELENKNYDYVHLTTNNTIEGTMYRDLP
FT                   SGLAGQTIVADMSSNILGQKYNVDDFGLIYAGAQKNIGIAGLTVVIVKRDLIGKVSNLP
FT                   SMLDYKKQADKQSALNTPPVFAIYMAGLVFEWLKEQDGVAAMQALNEEKSQLLYEYLDN
FT                   STLFSSPVKREDRSLTNIPFVTGNKQLDEKFIAEATSAGLLNLKGHRLVGGMRASLYNA
FT                   FELEGVKALVDFMKEFELKNKGE"
FT   gene            112191..113375
FT                   /gene="serA"
FT                   /locus_tag="LSL_0092"
FT   CDS_pept        112191..113375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="LSL_0092"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG0111 [HE] Phosphoglycerate dehydrogenase and
FT                   related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98913"
FT                   /db_xref="GOA:Q1WVK4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK4"
FT                   /protein_id="ABD98913.1"
FT                   /translation="MKDIKTYNVIAQEGLDELPADMYTVNKSTKPDALLIRSQDMHKTP
FT                   FGTSVLAIARAGAGVNNIPLEKATSQGTAVFNTPGSNANAVKELIITMLLLSVRPVFAS
FT                   VKWAQKLAGADVSLQTEKGKNHFAGTELYGKKIGIIGLGNIGSRVAKACMDLGMKVIGY
FT                   DPYISVEKAWQLSNDIPRAESLEELLEQSDFITIHIPYTDKNRNIIGEDEINVMKDTAV
FT                   LLNYSRWGIVDEDAVIKALDAKKLRLFITDFSSEKILNHKQIIVTPHLGGTTEEAEING
FT                   AKMAANTLRKYLETGDIVNSVNLPNVEMAFDAPLRLTLIHQNVPNMVGRITTILAKEEI
FT                   NIDNMINRSRGKIAYTMIDAADISEGKLKELKKELLEIPEVIRVRALHNPKIVK"
FT   gene            113377..113973
FT                   /locus_tag="LSL_0093"
FT   CDS_pept        113377..113973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0093"
FT                   /product="Uracil DNA glycosylase superfamily protein"
FT                   /note="COG1573 [L] Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98914"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK3"
FT                   /protein_id="ABD98914.1"
FT                   /translation="MIKTADEFQRIFEEIKLDPQNQEYTEKGIEPLYYANPKAKILIVG
FT                   QAPGQKAQDTHMVWNDLSGDRLRTWLDVSRDEFYNSDLFAIMPMDFYFPGKGKGGDLPP
FT                   RKNFAAKWHPKLRKLMPNIELTILVGSYAVKKYLNLKSSAKLTDIVKDYQTYLPEYFPL
FT                   VHPSPRNLIWLKKNPWFEKQVVKDLQKLVSEIKNK"
FT   gene            114069..114566
FT                   /locus_tag="LSL_0094"
FT   CDS_pept        114069..114566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0094"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK2"
FT                   /protein_id="ABD98915.1"
FT                   /translation="MLKNLNLTFGPEKQLQEIIENNKDRQMVLLESVTDSEKFALLDIS
FT                   NEESIFHSQLDYRIYHTINLKEWNGFFEFRYVTLDTEQQKIFNAHLGKWDDPFNRPVGL
FT                   KSTLVGHDERKDYEFLMINIWEDQEDYVEWENESDNEFREFGHGGNAKALVAQYKLVKN
FT                   KE"
FT   gene            114740..118189
FT                   /locus_tag="LSL_0095"
FT   CDS_pept        114740..118189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0095"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98916"
FT                   /db_xref="GOA:Q1WVK1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR032237"
FT                   /db_xref="InterPro:IPR032239"
FT                   /db_xref="InterPro:IPR032240"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK1"
FT                   /protein_id="ABD98916.1"
FT                   /translation="MERYHIGLDIGTSSIGWAVIGDDFKIKRKKGKNLIGVRLFKEGDT
FT                   AAERRGFRTQRRRLNRRKWRLKLLEEIFDPYMAEVDKYFFARLKESNLSPKDSNKKYLG
FT                   SLLFPDISDSNFYDKYPTIYHLRRDLMEKDKKFDLREIYLAIHHIVKYRGNFLEKVPAK
FT                   NYKNSGASIGFLLEEVNDLYGNIIGNEDVAILDNDKFEDVEKIILNDEIRNIDKQKNVG
FT                   RLLVKDKKEKNIVTAFSKAIFGYKFNLEDLLLIESDEKNKLTFNDENIDDIFNELSHSL
FT                   NDNQMDLLTKTREIYFKFKLNMIVPTGYTISESMIEKYEMHKAHLKMYKEFINTLNAKD
FT                   RKILKNAYSDYINNEKAKAANAQENFYKTVKKTIKENDSDTAKKIIGLIDEGNFMPKQR
FT                   TGENGVIPHQLHQIELDRIIENQAKYYPWLAEENPVEKNRKFAKYKLDELVTFRVPYYV
FT                   GPLIDKTESNKNEKETKFAWMVRKAKGTITPWNFENLVDRTESANRFIKRMTSKDTYII
FT                   GEDVLPASSLLYEKYKVLNELNNIKVNKKKLDVEQKQHVYLDLFTTRKNVTKDDLATSL
FT                   NCDVESITGLTDNKKFNSSLSSYIDLKAILGNIVDDYSKNEDLEKIIEYSTIFEDGNIY
FT                   KEKLSEISWLTDEQIEKLSNIHFKGWGRLSKKLLTQITNENGERIIDTLWNTSNNFIQV
FT                   ISDESIQAKLAEINGEYANKYNLEDILDEAYTSPQNKKAIRQVMKVVEDIEKAMKCEPT
FT                   SIAIEFTREKRKSKLTNTRYKKISETYEKITDELISEYELGKLQSELDSKVNNMRDRYY
FT                   LYFMQLGRDMYTGEKMNIDELHQKYDIDHILPQSFIKDDSLNNRVLTSKSVNIKEKSDK
FT                   TAADLYAAKMGDFWRKLRKQGLMTEQKYKNLLTRTDSINKYTKQSFIKRQLVETSQVVK
FT                   LAANILQDKYRNTKIIEIRARLNSDLRKKYELIKNREVNDYHHAIDGYLTTFVGQYLYK
FT                   VYPKLRSYFVYDDFKKLDSNYLKHMDKFNFIWKLEDKKAEDVYDKVNDEFVLNVPEMKE
FT                   YIRKIYNYKYMLVSKEVTTKNGAFYDQTKYNAKTINLIPIKKDKPTNIYGGYKGKVSSY
FT                   MMLVKIQKKKEVIYKFVGVPRLWTDELDRLIDTDEKKALLKK"
FT   gene            118318..118758
FT                   /locus_tag="LSL_0096"
FT   CDS_pept        118318..118758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0096"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98917"
FT                   /db_xref="InterPro:IPR032237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVK0"
FT                   /protein_id="ABD98917.1"
FT                   /translation="MQLHLSERALKILAKEKIKDAKVTDKELVDVYEEILSVVNKHFEL
FT                   YDISKFRQKLNEGLELFKELPIYNVYESNKIKQVGKFEVLNRILIGLHANAMRTDLKVL
FT                   GIKVNLGQMQVKGGIKLSPDAKLIYQSPTGIFSRAVRVKDLG"
FT   gene            complement(118704..118871)
FT                   /locus_tag="LSL_0097"
FT   CDS_pept        complement(118704..118871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0097"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ9"
FT                   /protein_id="ABD98918.1"
FT                   /translation="MKSNKAFIAEFFFLIHIYGLYIKRSHLTPFYFLFLKNNYPKSFTL
FT                   TALEKIPVGD"
FT   gene            118952..119857
FT                   /gene="cas1"
FT                   /locus_tag="LSL_0098"
FT   CDS_pept        118952..119857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="LSL_0098"
FT                   /product="CRISPR-associated protein"
FT                   /note="COG1343 [L] Uncharacterized protein predicted to be
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98919"
FT                   /db_xref="GOA:Q1WVJ8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ8"
FT                   /protein_id="ABD98919.1"
FT                   /translation="MGFRNVIITQHSKLSYSNNAMIVQNKDGINQIPLVDMDILLISTT
FT                   QAVITSALVSKLAESGIKVIFTDNKNEPVTETVNYYPNNRSLDTYLQQYEWNDHVKEIL
FT                   WTKIVRSKIINQIKVLKNYQIDCQDLKIELDKLEINDMTNREAVVARKYFEKLFGNKYS
FT                   RKDFTPMNAALNYGYSILLSAVNKEIVSAGYVTYLGIHHQSQENMFNFGSDLMESFRPV
FT                   VDYWLADKNFLEFTPDIKYGLVDLLNLEIKYNKKQMLLKNAITKYVRDVIEYLNQETVE
FT                   FDMEVEFTNEVPNNAINDNI"
FT   gene            119835..120140
FT                   /gene="cas2"
FT                   /locus_tag="LSL_0099"
FT   CDS_pept        119835..120140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2"
FT                   /locus_tag="LSL_0099"
FT                   /product="CRISPR-associated protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98920"
FT                   /db_xref="GOA:Q1WVJ7"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVJ7"
FT                   /protein_id="ABD98920.1"
FT                   /translation="MRLMIIFDLPVETSEERKEYRKFRKNLINEGFIMIQYSVYVRVCV
FT                   NKKSAEFTEKRIESFLPSKGVVQSLILTEKQYNDMHFLLGKKIKEVRNSAERTIIL"
FT   gene            120137..120808
FT                   /locus_tag="LSL_0100"
FT   CDS_pept        120137..120808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0100"
FT                   /product="CRISPR-associated protein, SAG0897 family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98921"
FT                   /db_xref="InterPro:IPR010146"
FT                   /db_xref="InterPro:IPR038600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ6"
FT                   /protein_id="ABD98921.1"
FT                   /translation="MKLYYTGHKNIEINAGKITVLGTNNVDVYKEFIDTFLNGYGSNIQ
FT                   LSDDKYNRKDISTSIDWDGDVMLTDRISKKYMNVLIKKIIEDITDDERQAILKSVNGLY
FT                   DHIREVLYKIDIPLQVDYDNDLTRLFKYCQVHTEALLWKNAYDRISSDVKLHVELDRKR
FT                   IIGLTNVAHYLTKEEFQELVNLVKATNASMFIIEFTEKIGQRFFENCDNYYIDEDYIDW
FT                   Y"
FT   repeat_region   120820..122525
FT                   /note="CRISPR"
FT   gene            122941..123261
FT                   /locus_tag="LSL_0105"
FT   CDS_pept        122941..123261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0105"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /note="COG0640 [K] Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98922"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ5"
FT                   /protein_id="ABD98922.1"
FT                   /translation="MKIQVSSDLLDGLVLALLDKQDYYGYSLTQDMQKAISISESTLYP
FT                   VLRRLKNNGLLETYDQSYQGRNRRYYRITNSGEEHLGRVKKMWSDYKVSLDSIFEKNRE
FT                   GE"
FT   gene            123264..123869
FT                   /locus_tag="LSL_0106"
FT   CDS_pept        123264..123869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0106"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0344 [S] Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98923"
FT                   /db_xref="GOA:Q1WVJ4"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ4"
FT                   /protein_id="ABD98923.1"
FT                   /translation="MNSEITKYLQELKKYLRRLDDSEIKDVEDFYTEYLEDAGVQTRAE
FT                   IEEKVGTPRQLSLRILADYSLKDDGKESGGILPKTNIKTAWLIILALLATPATLIIGVA
FT                   LLGVLVAAIGVAFAVAVTIIALAGAAIFITLTSLYVGIFLLFTKLGVGLFYLGIGIIGI
FT                   GALMVILPIIYLIIVTVVKMVANFIRYIYRRFNKKGAR"
FT   gene            123872..124837
FT                   /locus_tag="LSL_0107"
FT   CDS_pept        123872..124837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0107"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98924"
FT                   /db_xref="GOA:Q1WVJ3"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ3"
FT                   /protein_id="ABD98924.1"
FT                   /translation="MKKTIISGFIISIIGAILLAIGLGLKGNKSIVFEDLKPVIADSTK
FT                   VTQAHTYKDINKLDIDVKDVNVEFREGKNYSVRYEGAKSSSPTVKKSGNQLQIKGRLSS
FT                   HSIRFNGMSMYDDYYRNSDRNKMIITLPKDSKLDELNLKLSDSLLSQVNMTGIEADRVK
FT                   ASIHDTKLDLRDANFGNVELSAGDSDISMTNTVLSNGKLDLNDTDVRLDGGSLMQVAMN
FT                   ITEGDVDYNNLSIQGGNLRNNDGDIKMSNTQIQGGYKIDDTDGDILVSRVTVDGYRVQS
FT                   NDGDVRLFEQTTSNGNVLEKNSNSDNVLDIISNDGDITVN"
FT   gene            124856..125086
FT                   /locus_tag="LSL_0108"
FT   CDS_pept        124856..125086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0108"
FT                   /product="Stress-responsive transcriptional regulator PspC"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98925"
FT                   /db_xref="GOA:Q1WVJ2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ2"
FT                   /protein_id="ABD98925.1"
FT                   /translation="MKKLTKSNDKVLTGVLGGFAEYFGADKALVRIIGAALMMVTGFFP
FT                   GIFLYIIAAVIMPEKTDKDNDDVIEGEFHEK"
FT   gene            125426..125737
FT                   /locus_tag="LSL_0109"
FT   CDS_pept        125426..125737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0109"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98926"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVJ1"
FT                   /protein_id="ABD98926.1"
FT                   /translation="MEKVQELQRLVVELYDSFENDNRKGVEEIRQVLANVNEKYKTSSH
FT                   PLAWTGRLVLYLQVNAVKKDLYLTSEQKDIIKELARIGKRTNLNYVYLSPVDDAKQFV"
FT   gene            126139..127653
FT                   /gene="glpK"
FT                   /locus_tag="LSL_0110"
FT   CDS_pept        126139..127653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="LSL_0110"
FT                   /product="Glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COG0554 [C] Glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98927"
FT                   /db_xref="GOA:Q1WVJ0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVJ0"
FT                   /protein_id="ABD98927.1"
FT                   /translation="MSDKYIMAIDEGTTSTRAIIFDKKGNKVAEGQKEFRQYFPQPGWV
FT                   EHDANEIWNAVLSTIANSFISSGIQPKQIAGIGITNQRETTIIWDKETGLPIYNAIVWQ
FT                   SRQTSDIAQKLIDEGYSDTIHEKTGLIIDAYFSATKIRWILDHVEGAQERAEKGELLFG
FT                   TIDTWLTWKLTGGKVHVTDYSNASRTMLFNIHDLKWDKEILELLNIPEALLPEVKGNSE
FT                   IYGQTAAYHFFGSQVPISGMAGDQQSALFGQLALEDGTVKNTYGTGSFIVMNTGNKPVL
FT                   SKNNLLTTIGYSIDGKINFALEGSVFVSGSALQWLRDSMEIIESAPESERAANESTNHN
FT                   EVYVVPAFTGLGAPYWDSDARGAVFGLTRGTTKNDFIKATLQSLAYQTRDVLDTMEKDT
FT                   GIKIPVLRVDGGAAMNNYLLQFQSDLLNKSVERAGNLETTALGVAFLAGLAVGFWKDTD
FT                   ELKELFTVGRRFEPEMSDDAREYLYAGWKNAVEATRIFKHKINENL"
FT   gene            127666..129495
FT                   /gene="glpO"
FT                   /locus_tag="LSL_0111"
FT   CDS_pept        127666..129495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpO"
FT                   /locus_tag="LSL_0111"
FT                   /product="Alpha-glycerophosphate oxidase"
FT                   /EC_number="1.1.3.21"
FT                   /note="COG0240 [C] Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98928"
FT                   /db_xref="GOA:Q1WVI9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI9"
FT                   /protein_id="ABD98928.1"
FT                   /translation="MTFSIKTRKNTVDKLKNEELDLLVIGGGITGAGVALQATASGLKT
FT                   GLVEMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVQERAVVQGIAPHIPRPFPML
FT                   LPIYDDPSSTFDMFSVKIAMDLYDRLAGVTGTQYANYTISREEVLQREPNLKSDKLLGA
FT                   GVYLDYVNNDARLVIENIKEADELGGLMASHVKVVGVLHDDNGRINGVKAKDLLTDEEF
FT                   EIKAKMVINTTGPWVTKTLGLDDKNGEGEVIRPTKGVHLVVDSSRLRVPQPTYFDSGIG
FT                   DGRMIFVVPRENKTYFGTTDTDYTGDYKHPRVEQADVDYLLKAINNRYPEAEITINDIE
FT                   ASWAGLRPLLSGNGSSDYNGGGSNTGKVSDESFENLIKTAVAYSKDEASRGEVEKSISS
FT                   LKTASAEKTLSPSQVSRGSSLKVGDDGLITLSGGKITDYRKMAAGAMELIRKLFKELFN
FT                   KDVREVDSKKLQVSGGHFDPTNVDETMKFYQKIAMDKGMPAADAADLANRFGSNTSRVI
FT                   SYADDVEAAPGLTLADTLSLHYSVNEEMTLNLVDFLLRRTNYVLFHKDELMMKKDAFVD
FT                   EMARIMEWNEEEKAAAAKQLDETIAESSLAYLK"
FT   gene            129531..130238
FT                   /gene="glpF"
FT                   /locus_tag="LSL_0112"
FT   CDS_pept        129531..130238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="LSL_0112"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /note="COG0580 [G] Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98929"
FT                   /db_xref="GOA:Q1WVI8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI8"
FT                   /protein_id="ABD98929.1"
FT                   /translation="MNGFLGEFLGTMVLIVLGVGTGAGVNLKTSYARNSGWLFITIAWG
FT                   MAVTFGVYVAGSFGSQGHLNPAVTIPFAIFGFFPWDQVLPYLLGQFLGAFVGAVLVIIQ
FT                   YGAQFKNAKDANDGNVVGIFATGPAINNGLYNFLSETIATFVFILTLLNLGDFTKGLKP
FT                   LIVGLLIMVVGQALGGTTGFALNPARDWAPRFAYSVLPVPNKGDSNWGYAWVPMFGPLA
FT                   GGLIAACVQYFLM"
FT   gene            130357..131445
FT                   /locus_tag="LSL_0113"
FT   CDS_pept        130357..131445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0113"
FT                   /product="Spermidine/putrescine transport ATP-binding
FT                   protein potA"
FT                   /note="COG3842 [E] ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98930"
FT                   /db_xref="GOA:Q1WVI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVI7"
FT                   /protein_id="ABD98930.1"
FT                   /translation="MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGK
FT                   TTILNIIAGLSDATSGDVYFDGKRINDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLK
FT                   IKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGGQRQRVAIARAIVLDPKVLLLDEP
FT                   LSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVLNNGNIVQSGTPV
FT                   DIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPED
FT                   LVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPED
FT                   IHVMRFNESEEDFDARLDSYND"
FT   gene            131461..132261
FT                   /gene="potB"
FT                   /locus_tag="LSL_0114"
FT   CDS_pept        131461..132261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="LSL_0114"
FT                   /product="Spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176 [E] ABC-type spermidine/putrescine transport
FT                   system, permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98931"
FT                   /db_xref="GOA:Q1WVI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI6"
FT                   /protein_id="ABD98931.1"
FT                   /translation="MKKINPLLTIPYYLWIGLFVIAPVLLIVYYSFIDIHGNFTLSNYG
FT                   NYFGSGKYLMMTFNSFLYAFIITFFTVLVSYPMAYFLTKLKHKELWLLLVILPTWVNLL
FT                   LKAYAFIGIFGIDGSVNHFLSFFGIGPKQILFTDFSFIVVATYIQIPFMIMPIFNALEE
FT                   INPSVLRASRDLGANEWQTFFKVVMPLSMNGVKSGIQAVFIPSLSLFMLTRLIGGNRVI
FT                   TLGTAIEEHFLVTQNWGMGSTIGVVLIVIMFIVMVITGEKRGHK"
FT   gene            132262..133098
FT                   /gene="potC"
FT                   /locus_tag="LSL_0115"
FT   CDS_pept        132262..133098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="LSL_0115"
FT                   /product="Spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177 [E] ABC-type spermidine/putrescine transport
FT                   system, permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98932"
FT                   /db_xref="GOA:Q1WVI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI5"
FT                   /protein_id="ABD98932.1"
FT                   /translation="MKKINWKNVYLWVMFIFLYAPIFYLIFYAFNSGETMNRFEGFSWV
FT                   HFQELFADTRLLIILLETFILAFLSALIATMIGTFGAISIYRYQKRRTRLALLSLNNIL
FT                   IVSPDVIIGASFLILFTLLGSWIHSLSLGFASVLLSHIAFSIPIVVLMVLPKLQEMQDS
FT                   LTMAAYDLGANHWQVLTNVVLPYLTPGIIAGYFMAFTYSLDDFAVTFFVTGNGFTTLSV
FT                   EIYSRARRGVSLEINALSALVFLFSLVLVIGYYFISRDNSANHRRQGKQVRKGVLR"
FT   gene            133098..134183
FT                   /gene="potD"
FT                   /locus_tag="LSL_0116"
FT   CDS_pept        133098..134183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="LSL_0116"
FT                   /product="Spermidine/putrescine-binding protein"
FT                   /note="COG0687 [E] Spermidine/putrescine-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98933"
FT                   /db_xref="GOA:Q1WVI4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI4"
FT                   /protein_id="ABD98933.1"
FT                   /translation="MKKLLALISGIIVIIVCLSLGVMRLNRTENTQTNSSSKKVLNIYN
FT                   WGDYIDPQLIKKFEKQTGYKVNYETFDSNEAMFTKIKQGGTPYDIAVPSDYMIQKMAKE
FT                   KLLLPLDKHKIKGMDNNDPQFLDLSFDKHNKYSVPYFWGTLGIVYNDKYIKPGEITNWN
FT                   DLWNSKYRKQILFIDGAREFIGIGLNSLGYSLNSKNDSQINQAYDKLKNLTPNAKAFVA
FT                   DEIKTYMQNDEAPLAVTYSGEASEMLDNNSHLHYVIPDDGTNLWFDNIVIPKTAKNVKG
FT                   AYEFINFMLEPKNAAQNAEYIGYATPNDKAAKLLPKSITSDRQFYPTKKQMSKMEVYAD
FT                   LGQTYLEKYNDDFLELKMYRQ"
FT   gene            134991..135983
FT                   /locus_tag="LSL_0117"
FT   CDS_pept        134991..135983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0117"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="COG2984 [R] ABC-type uncharacterized transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98934"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI3"
FT                   /protein_id="ABD98934.1"
FT                   /translation="MKRLIATIIALAVFLGVAFNVEKKQEESKNKMPTVAILQTLSHPA
FT                   LDQIHQGIVDGLKEEGFVNGKTMKIDYQNAQGDQSNLKTMSDRFVQEKASVLIGIATPA
FT                   VQSLANENSKIPITMGAVSDPVGTGLVKTLEKPGGTVSGVMHKEPVAAQVKLIREFMPD
FT                   LKNIGVIYTSSDDSSTAEYKEFKKLAEKAGITVKTYTITSTNDIDQVSATMASEVQAVY
FT                   VPSDNTVASGFSTLVKNTNAKNIPIFPGVDSMIKGGGVATVSVSQYELGKLTGKMAAQE
FT                   LRGKNPATMPVETVKKGSTVINQKQADKLGLKVPASAIKQANEKGEIIK"
FT   gene            135980..136876
FT                   /locus_tag="LSL_0118"
FT   CDS_pept        135980..136876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0118"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG0390 [R] ABC-type uncharacterized transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98935"
FT                   /db_xref="GOA:Q1WVI2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI2"
FT                   /protein_id="ABD98935.1"
FT                   /translation="MSLVTSAIGQGLLWGILALGLFLTFRILNFPDMTVEGTFPFGAAV
FT                   CVSALVHGVNPIVATALSFGAGLLTGLMTGLLYTKGRIPILLAGILVMTGIYSINLRIL
FT                   GRANVGLMHQKTLFSPEFLKNLPDGFDSVCVGIIFTIVIVILLAVFLNTDIGQAFIATG
FT                   DNEKMARSLGIHTDNTKILGLMISNGLIGLAGGLISQNNGYADVNMGVGTIVIGLAAII
FT                   IGEVAYGELSLTARLVAVVVGSILYRFVLLIVLKLGFSTNDYKLLSAIILAFCLMLPLL
FT                   QKKFHVNKVLKKGVERP"
FT   gene            136873..137637
FT                   /locus_tag="LSL_0119"
FT   CDS_pept        136873..137637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0119"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1101 [R] ABC-type uncharacterized transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98936"
FT                   /db_xref="GOA:Q1WVI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI1"
FT                   /protein_id="ABD98936.1"
FT                   /translation="MSQVALELKNINTTVNIGTPEEKRILKDLNLTLEKGDFVTLLGTN
FT                   GAGKSTLLNVINGSLNTTSGQVVLNNHDLTKLSEVKRAKYIAQVFQDPKMGTAPRMTVA
FT                   ENLLLATKRGQKRGLKLRGLKKHLAEFKEETAQLPNGLSDRLNTFAGSLSGGQRQTLSF
FT                   LMATIQKPELLLLDEHTAALDPNTSHQLLELTNKVVEKENLTCIMITHQMKDALKYGNR
FT                   TVILNDGKVVLDVKGAEREKLTEEDVLKYFAN"
FT   gene            complement(137678..138307)
FT                   /locus_tag="LSL_0120"
FT   CDS_pept        complement(137678..138307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0120"
FT                   /product="Hypothetical secreted protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98937"
FT                   /db_xref="GOA:Q1WVI0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVI0"
FT                   /protein_id="ABD98937.1"
FT                   /translation="MPSRSEKFSKRKHQQNFFKFLLILVVIAVGGYKLLFNYAKNTASQ
FT                   NINSSSSSVETVVTHQASKVDWQSPSEKKPYPDVNAYPNMWVKVSTSKHRVYLMNGNKV
FT                   LYTMLCSTGSKGQETPKGTFEIQAERGDHFYNAQSGEGANYWVSFKDHGIYLFHTVPVD
FT                   ANGNYVVSEAEQLGKSSNSHGCVRLSVADAKWFYENIKTGTKVVVE"
FT   gene            complement(138486..138959)
FT                   /gene="greA"
FT                   /locus_tag="LSL_0121"
FT   CDS_pept        complement(138486..138959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="LSL_0121"
FT                   /product="Transcription elongation factor"
FT                   /note="COG0195 [K] Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98938"
FT                   /db_xref="GOA:Q1WVH9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH9"
FT                   /protein_id="ABD98938.1"
FT                   /translation="MPKIYFQKMTPNGYKQIEDEIEQLKLDRPAKIKQLQEARALGDLS
FT                   ENAEYSAAKRDLRHLESRLRYLNKQLQYAEIITPKNADSVDIGTTVTIQFDDDENDLET
FT                   YQIVGKQEVNVDDNKISFVSPIGKAIMHKKVGHTATVIAPAGSYTVKIISISI"
FT   gene            139088..139195
FT                   /locus_tag="LSL_0122"
FT   CDS_pept        139088..139195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0122"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98939"
FT                   /db_xref="GOA:Q1WVH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH8"
FT                   /protein_id="ABD98939.1"
FT                   /translation="MSEIITADILGLTALIGILLLVQSSLTKREKRRYK"
FT   gene            139402..140796
FT                   /locus_tag="LSL_0123"
FT   CDS_pept        139402..140796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0123"
FT                   /product="tRNA (5-carboxymethylaminomethyl-2-thiouridylate)
FT                   synthase"
FT                   /note="COG0218 [R] Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98940"
FT                   /db_xref="GOA:Q1WVH7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVH7"
FT                   /protein_id="ABD98940.1"
FT                   /translation="MATMVPTEFDTIAAISTPPGEGAISIVRLSGEDAVKIANKVFKGK
FT                   NLEKVPTHTINYGHIVNPKTNEELDEVMVSVMLAPRTFTREDVIEINCHGGIVPTNQIL
FT                   QLLLSNGARLAEPGEFTKRAFLHGRIDLTQAESVMDLIRAKTDRSMKVALNQLDGNLSH
FT                   LIRNLRQDILDVLAQVEVNIDYPEYDDVETLTTKMLREKAIEVKKSIQQLLTTAKQGKV
FT                   LREGLATAIVGRPNVGKSSLLNHLLHEDKAIVTDIAGTTRDVIEEYVNVRGVPLKLIDT
FT                   AGIRETEDKVERIGVERSRKAIEQADLVMLVLNASEELTDEDKELIQATSGKKRIVILN
FT                   KTDLPQKLNMDEVRELVPEDELITTSVLKKTGVDKLEEKIAELFFGGIENSQSTIMVTN
FT                   ARHIALLNQAEDSLDAVLQGLDSGMPVDLCQIDMTNAWDELGEITGDSYQDELLTQLFS
FT                   QFCLGK"
FT   gene            140820..142733
FT                   /gene="gidA"
FT                   /locus_tag="LSL_0124"
FT   CDS_pept        140820..142733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="LSL_0124"
FT                   /product="Putative tRNA
FT                   (5-carboxymethylaminomethyl-2-thiouridylate) synthase
FT                   subunit"
FT                   /note="COG0445 [D] NAD/FAD-utilizing enzyme apparently
FT                   involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98941"
FT                   /db_xref="GOA:Q1WVH6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVH6"
FT                   /protein_id="ABD98941.1"
FT                   /translation="MEFGKRYKAKDYDVIVVGAGHAGCEAALASARMGNETLLITINLE
FT                   MVAFMPCNPSIGGPAKGIVVREIDAMGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQA
FT                   DKRQYSIEMKHTIEQTPHLTLRQGIVDDLIIEDGEVKGVVTNTGACYGAKSVVLTTGTA
FT                   ARGKIIIGELMYSSGPNNTQPALELSKNLAKLGFELKRFKTGTPPRVDGNTIDYDKTEE
FT                   QPGDVEPNHFSYESKDEDYLKVKDQLSCWLTYTNEYTHKIIQDNLDRAPMFTGVIEGVG
FT                   PRYCPSIEDKIVRFSDKPRHQLFLEPEGRNTDEYYVQGLSTSLPEEVQQEMVRSIDGLE
FT                   HAEMMRPGYAIEYDVVSPYQLRPTLETKLIKGLYTAGQTNGTSGYEEAAGQGFIAGVNA
FT                   GRRAKGLEEITLKRSDAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTE
FT                   LGHEIGLISDERYAAFEEKKAQIEAEKQRLSKIRIKPNAEVNAFVEAHGDRELKDGVLA
FT                   TEFLRRPYVTYQDLLKFIPAPAEPLDRRVIEQIEIQFKYEGYIKKEYAKVEKLKRMEAK
FT                   KIPARIDYSRIEGIATEAQQKLAKIQPETLAQAGRISGVNPADLSILAVYIEQGKIARV
FT                   DD"
FT   gene            complement(143182..143853)
FT                   /gene="gpmB"
FT                   /locus_tag="LSL_0125"
FT   CDS_pept        complement(143182..143853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="LSL_0125"
FT                   /product="Phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG0406 [G] Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98942"
FT                   /db_xref="GOA:Q1WVH5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH5"
FT                   /protein_id="ABD98942.1"
FT                   /translation="MAFTIYMVRHGQTFLNKYNRLQGWCDSPLTPKGMEDAHSAGRHLA
FT                   HINFDHAYHSDTTRAMRTCRYILEENIASNDITPKEIRNFREQSFGYSEGNDSSQVWTM
FT                   LGAQHGGYRSYNELIANYSLGKTRDFLNEIDPFKDAETDEQYWARINAGFDHLRRHRQD
FT                   GENILLVSHSITIRSIVDRFAPELGAAELGPRNGSVTKLIVSKDDIKVEYYNHHLDNET
FT                   Y"
FT   gene            complement(143909..144772)
FT                   /locus_tag="LSL_0126"
FT   CDS_pept        complement(143909..144772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0126"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="COG1266 [R] Predicted metal-dependent membrane
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98943"
FT                   /db_xref="GOA:Q1WVH4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH4"
FT                   /protein_id="ABD98943.1"
FT                   /translation="MKKTLFVIKTLILAFLLLSLASIPGGFAMGFSSASNPGASTDTPV
FT                   FLTITLIGEIIVPIYLLIYYRAKNNLDALDIVMPFKKDKIAQKFGIGYLIGFLTFTIVF
FT                   AVAVFGGGFTTKIVWSSKNIVLFVLMLIGFLIQGTTEEIVCRGYVQGRITEKLGVFWAI
FT                   ALSALFFASGHLGNAGVSLEGFVGLLAFGILTALLRFYTGDLWLCGALHGAWNFAEGPF
FT                   FGTPVSGISGTELLFKSTSVPHHPWLNGGAFGIEASLTCIIILILLSALTVYLGQKYSV
FT                   NKLDLN"
FT   gene            144908..145378
FT                   /gene="fldA"
FT                   /locus_tag="LSL_0127"
FT   CDS_pept        144908..145378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="LSL_0127"
FT                   /product="Flavodoxin"
FT                   /note="COG0716 [C] Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98944"
FT                   /db_xref="GOA:Q1WVH3"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH3"
FT                   /protein_id="ABD98944.1"
FT                   /translation="MTKSLVIYFSMTNNTKKVAEMIAQELGADTYRIQAKQPYTSEDLN
FT                   WHNNNSRANREQEDNNSRPEFAGQLPDLTKYDRILIGHPTWWGIPPRIINTVIEKLDLG
FT                   EKEVATFSTSGGSTYDQAQKVMNELIGSDVKPGRVLSSKKDVENWLRDIDFK"
FT   gene            145393..145803
FT                   /locus_tag="LSL_0128"
FT   CDS_pept        145393..145803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0128"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1791 [S] Uncharacterized conserved protein,
FT                   contains double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98945"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH2"
FT                   /protein_id="ABD98945.1"
FT                   /translation="MANFEKEVKNNIFGFGGKNVDYAKYFIGESYLKSLVGEDDIDVHV
FT                   GNVSFEPGCRNNWHIHHNGYQILLVTDGKGWYQEEGKTVQLLKAGDVVVIRGGVKHWHG
FT                   ATKDSWFNHVAITKGNSEWLEPVSDEEYDKLG"
FT   gene            145815..146132
FT                   /pseudo
FT                   /locus_tag="LSL_0128b"
FT   misc_feature    145815..146132
FT                   /pseudo
FT                   /locus_tag="LSL_0128b"
FT                   /note="Similar to 4-carboxymuconolactone decarboxylase;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            146574..147698
FT                   /gene="metE"
FT                   /locus_tag="LSL_0129"
FT   CDS_pept        146574..147698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="LSL_0129"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="COG0620 [E] Methionine synthase II
FT                   (cobalamin-independent)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98946"
FT                   /db_xref="GOA:Q1WVH1"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH1"
FT                   /protein_id="ABD98946.1"
FT                   /translation="MTKDVLHYDTVGSFLRPEKLKQARQDFLENKISREKLKFVEDEAI
FT                   VDLVEKEKQLGLKVVTDGEFRRSYWHLDTFWGFGGIEHTIPEHGYFFHGEETRADSATV
FT                   SGKIHYVENHPDVQAFSYLKELIKDDDDVTARQSIPAPAQLYVELFRDERNKKITNEFY
FT                   PDHQELVADISKAYRELILDLYNHGCRDIKLDDCTWGVIVDDDFWNVFSEDGKYTRDGL
FT                   QDLYLELNNGALVDLPEDLRITTHICRGNYHSTWASKGGYEPVAAHVFAKENVDAFYLE
FT                   FDDERSGGFEPLRFVPKGKEVVLGIITSKKPELEDKEELKQRIKEATKYVDLENLALST
FT                   QCGFASTEEGNKLTEEDQEAKIKLVIETAKEVWS"
FT   gene            147764..148606
FT                   /locus_tag="LSL_0130"
FT   CDS_pept        147764..148606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0130"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="COG1464 [P] ABC-type metal ion transport system,
FT                   periplasmic component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98947"
FT                   /db_xref="GOA:Q1WVH0"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVH0"
FT                   /protein_id="ABD98947.1"
FT                   /translation="MRRKGLLGFIAVIIVIAVAAFFTFGHKKTEAKKTVTVGVVGQTNQ
FT                   DEKIWNQVKKTAKEKYGVTVKVKSFTDYNQPNKALQEGEIDLNSFQHKAFLNAWNKANK
FT                   GTLVPIGNTVIAPIRLYSYKYKNINELPKNATIAVPNDASNESRALYVLKNAGLISFKK
FT                   GTGKLATIADIEKNPKNLTIKELGAEQTARSLNDVDAAVVNNTYAIPAKLGDKQTIYTE
FT                   PLNKDSEQWINVIVANKKDKDNEAYKAVVKSYQTDAVKKLIHKTYGNSEVTAWNLKLK"
FT   gene            148628..149689
FT                   /locus_tag="LSL_0131"
FT   CDS_pept        148628..149689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0131"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1135 [P] ABC-type metal ion transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98948"
FT                   /db_xref="GOA:Q1WVG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVG9"
FT                   /protein_id="ABD98948.1"
FT                   /translation="MTDIITLENIDVTFKQGKQIVNAVKNVNLNVEKGDIFGVVGYSGA
FT                   GKSTLVRTINLLQKPTSGTVKVNGTLLFADNKQQISNKELQKQRRSIGMIFQHFNLLNE
FT                   TTVVDNVAFALRHSSLSDKEIEEKALNLLKLVGLEDKAKFYPIQLSGGEQQRVAIARAL
FT                   ANDPEILISDESTSALDPRTTNQILDLLKELNAKLGLTIVLITHEMDAVKRIANKIAIM
FT                   EHGVIIEKGKLRDVYLRPKEELSRQFVGGSLAAIETLKAFNLGNLSPDQKLFQLVFSAA
FT                   NVTKSIILELYKELGLDVSMLYGNIEVLESEPVGTMFILAKGEPDKLDKVADYLKKENV
FT                   EVTRIDERGIWND"
FT   gene            149682..150383
FT                   /locus_tag="LSL_0132"
FT   CDS_pept        149682..150383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0132"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG2011 [P] ABC-type metal ion transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98949"
FT                   /db_xref="GOA:Q1WVG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG8"
FT                   /protein_id="ABD98949.1"
FT                   /translation="MTSIIEKYLPNVANLGWTGDSGWWTSIIQTLYMTLWPAIFGGILG
FT                   LIFGIILVVTKPKGILENKLWFSICDKLVSLFRAVPFIILLAVIAPVTKLIVGTQIGTT
FT                   AAIVPLSLGVFPFYARQVQVALESVNNGKVEAAQALGATNTDIILDVYLREVRSELVRI
FT                   STVTLISLVGLTAMAGAIGAGGLGNTAISYGYNRFNNDITIVATLLVLLIVIVIQLVGD
FT                   FLANILNHQKR"
FT   gene            150425..151573
FT                   /locus_tag="LSL_0133"
FT   CDS_pept        150425..151573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0133"
FT                   /product="Succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="COG0624 [E] Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98950"
FT                   /db_xref="GOA:Q1WVG7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG7"
FT                   /protein_id="ABD98950.1"
FT                   /translation="MEEKEKIKILQDLIQINSVNGNELEVAEYLHKLFAKSNLESKVDE
FT                   FGDRRANLVLDVGQGEKVLGLTGHMDTVALGNEDKWSYPPLEAKIDGDRLYGRGAADMK
FT                   SGLAALAIAIIELSDLGKIPGHIRFIATAGEEYGTPGANRLRDLGVAKDLDALVVGEAT
FT                   NGDIIYAHSGSFNYRIVSHGKSVHSSTPELGNNALDALVDFAAIERTLFDDVPRDPYLG
FT                   ELKHSVTILNVGEQVNTIPDEGELYGNIRPTSAFNNKQIVERLKSAVDEVNDKNGAKLT
FT                   FELIHDWYPVVSNPEDDFVQTALTVSQEVFSNYVEGKQPELITMNGATDASVFVKDNTN
FT                   LPVIILGPGESNVSHQIDEYTTISSYLALVEIYKQIILRYFE"
FT   gene            complement(151625..152269)
FT                   /locus_tag="LSL_0134"
FT   CDS_pept        complement(151625..152269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0134"
FT                   /product="NAD(P)H-dependent quinone reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG0778 [C] Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98951"
FT                   /db_xref="GOA:Q1WVG6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG6"
FT                   /protein_id="ABD98951.1"
FT                   /translation="MTNFKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPS
FT                   ACNLQAWHFIVVDTPEGKDKLRSFFMKFNLPQLETSSAIVMLFGDTLAFKKYRALWENI
FT                   YEQKQISKEELDRILNTFLPLYENADKQLLTADAMVDSSLAAMQFMLAARAHGYDTNPI
FT                   AGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDVIEFQ"
FT   gene            152437..153270
FT                   /locus_tag="LSL_0135"
FT   CDS_pept        152437..153270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0135"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98952"
FT                   /db_xref="GOA:Q1WVG5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG5"
FT                   /protein_id="ABD98952.1"
FT                   /translation="MSSFVANEEEIRNFLCRPNMKKQDGIMFAYVTSAEKLTELVPKPL
FT                   KVVAPVIMGYVTHMGDPTFAAPYDEAVLYAFVSYQDKIMGAYPFVLYLSGEGAEEAMIA
FT                   GREGACMPKKLADDIKIEKSENKVQAKIIRHGTEILNLKWEAGVPNDVETVKKMFGSQV
FT                   KLGEPSEMASFFINYDIEQQDDGSNKFVNTELIATQSTGLTTDMEIGKIDMKLTSSEDD
FT                   PLAELEVLKPVGGAHYKMDYSVMHKTLKLDSLNPEEIAPYLITGHYDRTFVTKQD"
FT   gene            153287..154168
FT                   /locus_tag="LSL_0136"
FT   CDS_pept        153287..154168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0136"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="COG1250 [I] 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98953"
FT                   /db_xref="GOA:Q1WVG4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG4"
FT                   /protein_id="ABD98953.1"
FT                   /translation="MSFKKITIAGAGTLGSQIAFQAAFYGFTVSIWNPHPDRAIRRLNK
FT                   VQKMYKQEMGITDSDVKRAMKNIVEITNDMEIATKNTEYVIESVPENLEIKGIFYQKMC
FT                   QVLPKDVILASNSSTLVPSQLVKFVDRPEKFLHMHFANHIWKFNTSEIVGNEKTDKEVI
FT                   DKVVEFAKEINMLPIVLKKEQSGYIMNSLSVPYLNAALGLWAKGVADPMTIDKDWMKAT
FT                   GSPMGPFMSLDAIGLRTTYAIFNAHAEDAAAKAIADKLKQMIDEGHYGIEAGEGFYKYP
FT                   HPAYESADFLKV"
FT   gene            complement(154226..155581)
FT                   /locus_tag="LSL_0137"
FT   CDS_pept        complement(154226..155581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0137"
FT                   /product="NADH peroxidase"
FT                   /EC_number="1.11.1.1"
FT                   /note="COG0446 [R] Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98954"
FT                   /db_xref="GOA:Q1WVG3"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG3"
FT                   /protein_id="ABD98954.1"
FT                   /translation="MKVIVVGSSHGGYEAVEGLLKDYPDAEIQWYEQGDFLSFLSCGMQ
FT                   MFLEGKVDSADKVRYMTPEAIRERGVSLFEQTQVFALHSADHEIEVKDLQTGEVRTENY
FT                   DKLILSPGAVPMELDVPGKNLENVYYMRGHDWAVKLKEKVLDNNVKNVVVIGSGYIGIE
FT                   AAEVFAKAGKSVEVLDMLPRPLATYLDKELTDVIEPELTQNNVHVHGDQLVQEYLGENA
FT                   VTGVKTDKGEYSADLVVVAAGVKPNTAWLKDELAMYPNGMVKTDNFMRSSADDVFVVGD
FT                   ATLLKYNPGNTLLNVALATNARKQGRFAVKNLEAPLHPFPGVQGTSALSVFDYKFASSG
FT                   LNATNAQKLGKQVRSVVVEDDFRMDFVPKEENAYVWFKLTYDPDTKAILGGQILSKHDL
FT                   TAYINVISLAIKTKQTIYDLAYEDFFFQPGFDKPWNILNLAGLAAEKQEDED"
FT   gene            155872..157971
FT                   /locus_tag="LSL_0138"
FT   CDS_pept        155872..157971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0138"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="COG1982 [E] Arginine/lysine/ornithine
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98955"
FT                   /db_xref="GOA:Q1WVG2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027605"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG2"
FT                   /protein_id="ABD98955.1"
FT                   /translation="MANKILKIGTTSTTEEYVPLPWLSSNVYSGITAAELAAFVLPKAD
FT                   EVAYQKAQELMAKDGLQVPVILVDAGESLSKEELQNKVAQAAQQYEAENVPGFLRDLIN
FT                   FADEKPVSYTTPGHHNGQFYEKHPAGVVFKKFFGDNMLRADVSDTVAELGDTLTHGGTP
FT                   LDSEQEAAQAFNADKVYYVTNGTTSSNTICANAVLSEGDLVLFDRNNHKSLYNSALIMT
FT                   GAKPVYLPTSRNPLGLIGPVISDDLDEEKIRAEIAKVDPERAKAKRPFRMAVLQLETFD
FT                   GVFYNAKWLLDKIGKLCDYVLFDCAWGGYEQFVNIMKQLSPLQYQYTADDPGILVTQSI
FT                   HKQQAGLAQTSQILKKDAHIKGQKRYVDHKHFNNAYLKYVTTSYSYPIYASLTVNTALA
FT                   KGEAPKKWWEEAMRKGIRFRKALNQKSKLFKTLNAQEINEKSEQELMDNLSYWKMEETD
FT                   DWHGFKGIAKDEAIISPLKLTVVCPGINLATGKYEETGIPGKVIGEYLTEKRVITCKSD
FT                   LYSTLFLLTPGERDADLEALLTSFLEFEEYYLRDAPLEQVLPRLVKQNPERYQGYTIRQ
FT                   LCQEMHEYYAKNEIYKLQQDLFLKKTFQDYEMTPAEADKLFMKNEGELVDLDEIEGRVA
FT                   LEGALPYPPGVFIVAPGEKWQKIDVDYFKILMGAIDKFPGFDPEIQGVYLDKDTGVTKA
FT                   QGFVL"
FT   gene            complement(158031..158555)
FT                   /locus_tag="LSL_0139"
FT   CDS_pept        complement(158031..158555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0139"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98956"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG1"
FT                   /protein_id="ABD98956.1"
FT                   /translation="METSHIDLAILNYAANNICLDADRGEASTFIYCFDSIATQIAALL
FT                   EKLGFTTEIKEHNGYVIKSIEGTVVKLNIDFTTPKQNKITSSLPIEILTATEAKKLADD
FT                   NKVNAEAIKSIEKERNKGFETHDVRFLTLDRDKVHLNSGFLDYLLNTEVGPYADDKTVT
FT                   FKIKNRSAYDY"
FT   gene            159025..160082
FT                   /pseudo
FT                   /locus_tag="LSL_0139b"
FT   misc_feature    159025..160082
FT                   /pseudo
FT                   /locus_tag="LSL_0139b"
FT                   /note="Similar to ABC transporter, ATP-binding protein;
FT                   nonfunctional due to frameshift"
FT   gene            160075..160761
FT                   /locus_tag="LSL_0140"
FT   CDS_pept        160075..160761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0140"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG2011 [P] ABC-type metal ion transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98957"
FT                   /db_xref="GOA:Q1WVG0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVG0"
FT                   /protein_id="ABD98957.1"
FT                   /translation="MNNQGIQSYFQFKNVNWPDMWSATWETIWMTVVSIAIVAILGLLL
FT                   GLLLFETSGSDKLSVKILNVIVGVFVNIFRSIPFIILIVLLLPLTQVLVGSITGAKAGI
FT                   PALVIGASPMYARLVEIAFHEVDKGVIEAAVAMGANKWQILYKVLIPESLPALVSGITV
FT                   STIALIGYIAMAGAIGAGGLGQLAYTDGFQSYNNAITLVATVIIVLIVFVFQWLGDSTV
FT                   KKIDKR"
FT   gene            160831..161646
FT                   /locus_tag="LSL_0141"
FT   CDS_pept        160831..161646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0141"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="COG1464 [P] ABC-type metal ion transport system,
FT                   periplasmic component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98958"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF9"
FT                   /protein_id="ABD98958.1"
FT                   /translation="MKKKTVFGLITSVAAAAFLFTGVSKANADTTLTVGASPTPHAKIL
FT                   EHVKPELKKEGIDLKIKKYDDYIIPNKALANKEIDANYFQHTPFLNNWNKKNNGTLVSA
FT                   GNIHLEPIGVYSKKYKSLKDLPKGATVNVSSNVSDYGRILTIFKDAGLITLKKGTNIET
FT                   ANFNDIATNKKHLKFKHSFEAKLMPRLYKEGKDAAYVINANYAVQAGLNPSKDAIALEK
FT                   KSSPYANIIAVRKADKNKPAIKKLVKALESKDTQNWIKKEFKGGVLPAK"
FT   gene            complement(161821..162375)
FT                   /locus_tag="LSL_0142"
FT   CDS_pept        complement(161821..162375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0142"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98959"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF8"
FT                   /protein_id="ABD98959.1"
FT                   /translation="MTKNELILPSKDELLETLEKRFKKFPQRHQNLQWEEILLLIEDKP
FT                   ESINSLAYLEASGGEPDVTEINKQIVFIDFSKESPKGRRSLCYDKNARINRKKFPPTSS
FT                   VCEVCEQWQIELLTEDDYHSLQEIQPVDLKTSSWLFTPDNIRQLGGAIFGDRRYDTTFI
FT                   YHNGADSYYASRGFRAKLILK"
FT   gene            162486..162632
FT                   /locus_tag="LSL_0143"
FT   CDS_pept        162486..162632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0143"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98960"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF7"
FT                   /protein_id="ABD98960.1"
FT                   /translation="MKNIIKVTVAPAPLATSHAEIPIQIKVKTNKILKAIVAFFFKLFI
FT                   VRS"
FT   gene            162829..163623
FT                   /gene="gdh"
FT                   /locus_tag="LSL_0144"
FT   CDS_pept        162829..163623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="LSL_0144"
FT                   /product="Glucose 1-dehydrogenase"
FT                   /EC_number="1.1.1.47"
FT                   /note="COG1028 [IQR] Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98961"
FT                   /db_xref="GOA:Q1WVF6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF6"
FT                   /protein_id="ABD98961.1"
FT                   /translation="MYKDLEGKVAVVAVVTGGSKGIGTAIATRFGQEKMKVIINYRSDQ
FT                   KGAEEAAKAVRAAGGQAEIVQADIGDEAGVQKLIDKAVEKFGTLDVWVNNAGMENQHAT
FT                   TELSLKDWNRVIEVNLTGVFLGTKAALNYFTKHNKKGNIINMSSVHEQIPWPTFAHYAA
FT                   SKGGVKLFTETVAMEYAKQNIRVNSIGPGAINTPINAEKFADPEQLKTTTEMVPMGRIG
FT                   DPKEVGAVAAWLASDESSYVTGITLFVDGGMTLYPAFQGGRG"
FT   gene            163647..164489
FT                   /locus_tag="LSL_0145"
FT   CDS_pept        163647..164489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0145"
FT                   /product="Glucose uptake protein"
FT                   /note="COG4975 [G] Putative glucose uptake permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98962"
FT                   /db_xref="GOA:Q1WVF5"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF5"
FT                   /protein_id="ABD98962.1"
FT                   /translation="MNILLALLPAIAWGIIPIIVNKVPNSKPANQILGIGVGAAIVGII
FT                   IGLTRETSLTAGAFMLSLLSGMFWTLGQVGQFVSFTKIGVSKTMPISTGLQLIGNTLIG
FT                   ALIFGEWSTSDEYIFGIVALLLIIIGVALTAINKQSDTKSISKQDMMFLIFTTIGYLIY
FT                   STFPKMVDASAETLFLPQTLGILLGSIVYLVFTKQLATFKQKASYWDIIAGFAFGIGAL
FT                   SYMLSAQLNGITSAFIYSQLSVIISTLGGMILLRERKYGLELGATIVGLMLIVVGAIM"
FT   gene            complement(164531..165409)
FT                   /locus_tag="LSL_0146"
FT   CDS_pept        complement(164531..165409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0146"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98963"
FT                   /db_xref="GOA:Q1WVF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF4"
FT                   /protein_id="ABD98963.1"
FT                   /translation="MLTLELLEELVAFQKYGTLSSAAEHLMVTQPTITRGMKKIEEQLG
FT                   VQLFDRSVRNRIRLNETGILAATEAAKLLQSYQNFENKVRNHALQKNKIIVSSVLPGPL
FT                   MLLELLEAQLNCDFQFETNLITAGEVISLLDDFSTHLIFTDQEIETSDIESMYLGVEKL
FT                   SVALDNFNPLAQHSSVNFKQLANLTFLADKNIGPWRDILESNIPDATFLYQEKFEAVNK
FT                   LSQYSNFPFFFSKLSCNSEVMLDRFSTNSRTLVKIDDPNNSVEIFGTYHKSKRKLIQPI
FT                   LKKLIQNWPNN"
FT   gene            165518..166387
FT                   /locus_tag="LSL_0147"
FT   CDS_pept        165518..166387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0147"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="COG0656 [R] Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98964"
FT                   /db_xref="GOA:Q1WVF3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF3"
FT                   /protein_id="ABD98964.1"
FT                   /translation="MIEMEYVKLNDGNKMPQLGLGLFQIPNKDEAKRVVSEGLSEGYRL
FT                   IDTAAAYYNEEAVGKAIAESNVKREDIFVTSKLWINKYSYEKALLGIDESLKKLGVDYI
FT                   DLYLLHQPYGDIAGAWRALIEAKKAGKIRSIGISNFMPDRLLDLELMSGVKPAVNQIEV
FT                   SPWYQQKKAVLYNQSRNIQVEAWAPFAEGKHQIFKNEKIAAIAEKYGKSNSQVILRWLI
FT                   QRELVVIPKTVHKERMRENAEVFDFKLDEADMKEMASLDMNESQFFDHRDPIAIENIFG
FT                   ASLRELKI"
FT   gene            166411..167205
FT                   /locus_tag="LSL_0148"
FT   CDS_pept        166411..167205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0148"
FT                   /product="Short chain dehydrogenase"
FT                   /note="COG1028 [IQR] Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98965"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF2"
FT                   /protein_id="ABD98965.1"
FT                   /translation="MELGLKGKTALVTGSTKGIGKAIAIELAREGTDVIINGRKKETVD
FT                   KVVAEIKEEFPDTNPQAAPFDISIPEQQKELFKNFPKVDILINNMGIFKPMEYFDIDQE
FT                   TWQHFIDVNFYSGNALAKFYLPKMLAEDFGRIIFIASEEALMPSGEMPQYSLTKTMNLS
FT                   LAKSLSKLTKGTHVTVNTIMPGSTLTEGVEQMLVDMYKDSGLPKDEWETDFMKNHRPLS
FT                   QIQRLIRPEEVGRFTAFVSSPYSSSFSGEALRLDGGLVPTIF"
FT   gene            complement(167313..167540)
FT                   /locus_tag="LSL_0149"
FT   CDS_pept        complement(167313..167540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0149"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98966"
FT                   /db_xref="GOA:Q1WVF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF1"
FT                   /protein_id="ABD98966.1"
FT                   /translation="MDNLKKKATIAFSILLILTLICIGISAWLVISEASAVITLVMFFV
FT                   DFVVLCALLTIVFTAYFYKKRMKQMKETKN"
FT   gene            167467..167679
FT                   /locus_tag="LSL_0150"
FT   CDS_pept        167467..167679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0150"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98967"
FT                   /db_xref="GOA:Q1WVF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVF0"
FT                   /protein_id="ABD98967.1"
FT                   /translation="MPIQIRVNIRRMLKAIVAFFFKLSIIKNIILYKLDMRYIIPNLQS
FT                   GAIIGGIQLNEQKKVKIRINMIKCK"
FT   gene            167726..176884
FT                   /pseudo
FT                   /gene="mbp1"
FT                   /locus_tag="LSL_0152"
FT   misc_feature    167726..176884
FT                   /pseudo
FT                   /gene="mbp1"
FT                   /locus_tag="LSL_0152"
FT                   /note="Similar to mucus binding protein Mbp1; nonfunctional
FT                   due to interrupting stop codon"
FT   gene            177223..178320
FT                   /gene="acoA"
FT                   /locus_tag="LSL_0153"
FT   CDS_pept        177223..178320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoA"
FT                   /locus_tag="LSL_0153"
FT                   /product="Pyruvate dehydrogenase E1 component alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COG1071 [C] Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98968"
FT                   /db_xref="GOA:Q1WVE9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE9"
FT                   /protein_id="ABD98968.1"
FT                   /translation="MAGIDFDKLKNIVDDKFETVRVLDNDGNVVNKDLFPDLSDEQIVE
FT                   LFKKMVWSRVLNERSTKLNRQGRLGFFAPTAGEEASQIGSEFAMEKEDYILPAYRDVPQ
FT                   LVLHGLPLYKAFLWSRGHVDGNKYPENFNALPPQIIIGAQYVQAAGIALGLKKKGSKNV
FT                   AYTYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNGYAISVPRAKQTAAKTLAQKGVA
FT                   AGIPFVQVDGMDALAMYSVMKAAREYAAAGNGPVLIETLTYRFGPHTLSGDDPKRYRTA
FT                   EEEQEWKEKDPLIRMRTYLDKKGLWSEEKEKAWTEEVNKEIDEAMVLTEKAPKQKVSEY
FT                   LKNVFVDTPATIQEQIDKYTKKEAE"
FT   gene            178323..179300
FT                   /gene="acoB"
FT                   /locus_tag="LSL_0154"
FT   CDS_pept        178323..179300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoB"
FT                   /locus_tag="LSL_0154"
FT                   /product="Pyruvate dehydrogenase E1 component beta subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COG0022 [C] Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98969"
FT                   /db_xref="GOA:Q1WVE8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE8"
FT                   /protein_id="ABD98969.1"
FT                   /translation="MAKTTMIKAITAAMDEELKRDDKVLVFGEDVGKNGGVFRATDGLQ
FT                   EIYGEDRVFDTPLAESGIGGLAAGLAFTGFRPVPEIQFFGFVFEVMDSIAGQISRERYR
FT                   MGATRKMPVTFRAPFGGGVHTPELHSDSLEGLMAQTPGLRVVIPSGPYDAKGLLISAIR
FT                   SDDPVVFLEHMKLYRSVKEEVPDEAYIVPLDKAAVKREGSDVSIITYGYMVQESLKAAE
FT                   DLAKEGINAEVVDLRTVSPLDEETILASVKKTGRVVLVQEAQAQAGISPAVASLIAEKG
FT                   ILSLEAPIGRVSAPDTPYPFSEAESTWLPNKKDIVEKVKEVVNF"
FT   gene            179317..180597
FT                   /gene="aceF"
FT                   /locus_tag="LSL_0155"
FT   CDS_pept        179317..180597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="LSL_0155"
FT                   /product="Dihydrolipoamide acetyltransferase component of
FT                   pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="COG0508 [C] Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98970"
FT                   /db_xref="GOA:Q1WVE7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE7"
FT                   /protein_id="ABD98970.1"
FT                   /translation="MSKYQFKLPDIGEGIAEGTIGEWHVKPGDKVEVDGDLVQIENDKS
FT                   VEEIPSPVSGTVTKILVEEGETAEVGQPLIELEVAEGEGNVADDAPTAETEKEEKVEAA
FT                   PAPNTQLTPQVADHSLPVLAMPAVRRYAREQGIDLKLVPGSGRHGQVLRSDIDAFKANG
FT                   GAVAAAPEATPAVEEAAPQPAPKLPAGDAQWPETREKMSGIRKATANAMVRSVSQIPHV
FT                   HVFDEVIVDKLWAHRKKYKELAAERDVRLTFMAYMVKALAVVMKEFPIFNSSVDMDKHE
FT                   IVYKDYINVGIATDTDRGLFVPNVKHADSTSLFGIAKQITENTAKAKDGKLTAGDMSHT
FT                   GMSITNIGSVGGGHFTPVINWPEVAILGMGRITDEPVVVEGEVKIAKVLKLSLAFDHRV
FT                   IDGATAQRAMNRLKELLSDPELLLMEG"
FT   gene            180605..182011
FT                   /gene="lpd"
FT                   /locus_tag="LSL_0156"
FT   CDS_pept        180605..182011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="LSL_0156"
FT                   /product="Dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COG1249 [C] Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98971"
FT                   /db_xref="GOA:Q1WVE6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE6"
FT                   /protein_id="ABD98971.1"
FT                   /translation="MVVGDFAIDLDTVVVGAGPGGYVAAIHAAELGQKVTVIEREYIGG
FT                   VCLNVGCIPSKALIEAAHHYQHAMDSQEMGLQVTAAKLDFDKTIEWKNNVVARLTGGVA
FT                   SLFKKHKIDVIWGNAYLKDSHSLRVISDDDKAQTYTFNNLIIATGSHPIEIPNFKFEGR
FT                   VLDSTGALNLTEVPKELVVVGGGYIGSELASAYANLGSHVTILEGGDMILANYEKDLVK
FT                   VVEHHFSEQGVDIYTNAIAKNAEQTDKDVTVTFEVDGEEKKITADYVIVSVGRRPNTSN
FT                   MGLEQAGVSVDERGLIPVDAQSRSNIPNIYAIGDVTKGYALAHKASYEGKVAAEAISGK
FT                   PTVIDYHAMPAVCYTDTSIATTGLTLAEAKEKGFDAKKAQFPFAANGRAISMGETDGFI
FT                   RLVFEKETGVLLGAQMVGSNASDLISELTLAIECGSTVEDVALTIHPHPSLSEAVMDTA
FT                   DVAIGFPTNI"
FT   gene            182098..183117
FT                   /gene="lplA"
FT                   /locus_tag="LSL_0157"
FT   CDS_pept        182098..183117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="LSL_0157"
FT                   /product="Lipoate-protein ligase A"
FT                   /EC_number="6.3.2.-"
FT                   /note="COG0095 [H] Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98972"
FT                   /db_xref="GOA:Q1WVE5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE5"
FT                   /protein_id="ABD98972.1"
FT                   /translation="MQYVVMKTDDIRTNLATEQYLMNSDKIKPPFMLFYIEKPCIIVGR
FT                   NQNTMEEINQKYCEEHGITITRRLSGGGAMYQDLGNLCFSFVVPAENQKFGDFKSLVQP
FT                   VVDALHKMGVTGAETTGRNDIVVDGKKFSGNAMYTRGGKTFSHGTLMFDVDTDAVADAL
FT                   RVPKDKIESKGIKSVRSRVTNLKPYVSEEYKDFDTFQFRDELIKLIWGVDSLEEAQQYE
FT                   YQLDDEDKKGIEAIEQKLYKNWDWVYGKSPEFTVKRRKHFTSGTIDARFLVEDGKIKDI
FT                   KIYGDFFGSGDVKDVEDALRGLKYDVSTIKEALGKLDLNKYFVGIDAEDIKELISTQQ"
FT   gene            183230..183994
FT                   /locus_tag="LSL_0158"
FT   CDS_pept        183230..183994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0158"
FT                   /product="Integral membrane protein"
FT                   /note="COG0392 [S] Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98973"
FT                   /db_xref="GOA:Q1WVE4"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE4"
FT                   /protein_id="ABD98973.1"
FT                   /translation="MATRAELKNEVKDAFRGNWKKAIGLSIIPIVFTVITVFTVSIFLQ
FT                   VLLLVIRNNPATFSDVPNDVAANSTGNGGTYSTNIVSSIIGIMIYLGIQYTFLDWLRGK
FT                   SVESINNFRSMFQVFSKRYFIPVLVMYIIQWVLQFLWSLLFIIPGIIKGYSYSQTYFIY
FT                   KDIEASGAKANYKYPDYVTLSRELMNGHKWELFLLDLSFIGWHIVSILTFGLGYIWLIP
FT                   YMSATKAAFYRNLAGDKFLKQDRVYDAEFKEM"
FT   gene            184064..185197
FT                   /locus_tag="LSL_0159"
FT   CDS_pept        184064..185197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0159"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98974"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE3"
FT                   /protein_id="ABD98974.1"
FT                   /translation="MVAWQAAWYYENIDFSAMPFKMRELSQLIKITSFLSGKELRLKLT
FT                   NYYGKEELIFDEIYVALTADMKEKQRVTALYQDTIVIPQGEAIWTDSIDLDIKVGQTIY
FT                   VYMKSSQGQEYCDFKCTYETSLTNASFARSANFLPKLSDTWQSRKGWFCLEEVDVWTKA
FT                   NPKYLEITGDSLMEMGMITAPLMQYLMTVHPDEVTVLNTAISGSRLIHDAPHDQPIYET
FT                   FGESLLSRMVRNRSGFKPELTIVSIGANDLMLPLISEVAARQKITKDNFFNAVQRLNEI
FT                   LEKRNSELILLDIPPFTLSHTGRPDDKELQAQKFRKELNSKLATIPETVPTSLLLEMLP
FT                   CGVQSAYDFGDHMHINQAGGRVVATKLIPKIEQELFH"
FT   gene            complement(185249..185599)
FT                   /locus_tag="LSL_0160"
FT   CDS_pept        complement(185249..185599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0160"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98975"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE2"
FT                   /protein_id="ABD98975.1"
FT                   /translation="MYNMLNFIPDDMGEVQQKLFWLKANGYPDATEQEVIEKTILDGVQ
FT                   YMFDDALEGPYWTVIWDDTDKKLAVRGATSEIVGYIIPRENHSTFSDDFREASPLTWEN
FT                   LSKQVEKLIGSD"
FT   gene            185735..186004
FT                   /locus_tag="LSL_0161"
FT   CDS_pept        185735..186004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0161"
FT                   /product="ACT domain-containing conserved hypothetical
FT                   protein"
FT                   /note="COG1707 [R] ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98976"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVE1"
FT                   /protein_id="ABD98976.1"
FT                   /translation="MRAILTTIGADKAGIIAGVSTYLAKNQINILDVSQTIMNGYFTMM
FT                   MMVEIPDEKVDFEKITTELNELGEKLGVEIKIRNEKLYQAMHQL"
FT   gene            186021..187364
FT                   /locus_tag="LSL_0162"
FT   CDS_pept        186021..187364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0162"
FT                   /product="Converved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98977"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVE0"
FT                   /protein_id="ABD98977.1"
FT                   /translation="MDTAQILETIKMISEENLDIRTITMGISLLDCIDSDSDKACQKIY
FT                   DKITTKAKDLVKVGNQIATEYGIPVINKRVSVTPISLIAAASKDKDYVKYAKALDKAAQ
FT                   TLGIDFIGGYSALVQKGYQNGDRTLIKSLPQALAETNLVCASVNVGSTRSGINMDAVKE
FT                   MGQVVKSASELDFMTNAKMVIFCNAVEDNPFMAGGFHGVGEPDAVINVGVSGPGVVKSA
FT                   LEKVKGASMDVVAETIKQTAFKVTRMGQLVGSIAAEKLNVPFGIVDLSLAPTPAVGDSV
FT                   AQILEEIGLEQVGTHGTTAALAMLNDAVKKGGIMACSHVGGLSGAFIPVSEDAGMIDAV
FT                   NAGSLNIEKLEAMTVVCSVGLDMIAIPGDTPAETISAMIADEAAIGMINNKTTAVRVVP
FT                   VPGKDVGETVEFGGLLGHAPIMAVNKVSSADMINRGGLIPAPVHSFKN"
FT   gene            187630..188385
FT                   /locus_tag="LSL_0163"
FT   CDS_pept        187630..188385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0163"
FT                   /product="Transcription regulator of fructose operon"
FT                   /note="COG1349 [KG] Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98978"
FT                   /db_xref="GOA:Q1WVD9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD9"
FT                   /protein_id="ABD98978.1"
FT                   /translation="MLAEERHRIILELLKEHNVVKLQDICERTQCSESSGRRDLQLLEE
FT                   RGLLVRVHGGAKMKQPLQRELDVMGKSAQNTQEKESLGAKAASYIQDDDVIYLDAGTST
FT                   IAIIPYLSEDQHLTVVTNGVEHASLLADKNIRTFLLGGRLKNTTKAIIGVEAANDLKRF
FT                   RFNKAFLGINGVHEKYGLTTPDPDEAEIKRTALERSEKGYVIADKSKFGYVSFVKVADV
FT                   TDATIITSTLPASVAKQYSSQATIQEVIL"
FT   gene            188382..189296
FT                   /gene="fruK"
FT                   /locus_tag="LSL_0164"
FT   CDS_pept        188382..189296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="LSL_0164"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="COG1105 [G] Fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98979"
FT                   /db_xref="GOA:Q1WVD8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD8"
FT                   /protein_id="ABD98979.1"
FT                   /translation="MIYTVTINPSIDYIVQLDKLTLGEVNRMDYDNKLPGGKGINVSRI
FT                   LKELGHDNIAWGFLGGFTGNFVKEELEKVGLKTDFTPIAADTRINVKIKAQNETEINGQ
FT                   GPKLTEEEISAFTEKFDHLTSDDVVIFAGSLVPSLNDDFYFDLIKIIRSKGAQFVIDTT
FT                   GESLRKTLAEKPLVVKPNNHELADLFGVEFNGIDDIVKYGRKLLDMGAQNVLVSMAGDG
FT                   GLMITNEGVWRSLAPKGTVINSVGAGDSMLAGFVGTYASTKDPIEAFHYGLASGSATAF
FT                   SEDLATREKIDEIYAQITIDEYK"
FT   gene            189324..191279
FT                   /gene="fruA"
FT                   /locus_tag="LSL_0165"
FT   CDS_pept        189324..191279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="LSL_0165"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="COG1299 [G] Phosphotransferase system,
FT                   fructose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98980"
FT                   /db_xref="GOA:Q1WVD7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD7"
FT                   /protein_id="ABD98980.1"
FT                   /translation="MDIRSLLMKDIMIMDLKATTKSEVIDEMVHNYYEHGIIDDEDLYK
FT                   KDIIKREEEGSTGMGDGIAIPHAHDAAVKKPAVQFARSVAGVDYDSMDGQPAHLFFMIA
FT                   APEGGDNTHLQALAALSQVLMNPDVVTALKAADTPDKVQDIFAEAVAKKEAENKAEEEA
FT                   EKVAANSNSDRPYIVAVTACPNGIAHTYMAEENLKKKAKELGVDIKVETNGSEGIKHRL
FT                   TADEISRAVGVVIAADKKVEMNRFDGKPLVNKPVKSGIQEPEKLIQQVLDGKAAIYHAT
FT                   GDDSSSSTESDGTVWGNIYKQLMNGISHMLPFVIGGGILMAISFIVEQYMGGAKAPAFI
FT                   FLNSAGNLAFAFMVPVLAAYIAESIGDTPALMPGFVGGFMASIANASLGGSYHVNFQAN
FT                   STSPAGFLGGIAAGFIAGYLILGMKKMFAGLPRSVEGMKPMLLYPVFGLLFIALIMYFI
FT                   VNPIFSTINLWITHFLNGMGTGNLVLLTLVLAGMMSIDMGGPFNKAAYVFASGAFANDP
FT                   KSTTAAILMAAVMVGGMVPPFATAIGTAFFKNKYTEDERRAGVTNWILGFSFITEGAIP
FT                   FATADPGRVIPSCIIGSAVSGAIVGAMRIGIPAPHGGFWVSPLATNIWGYFLAVIVGSI
FT                   VAALIMSFWKKPVNEK"
FT   gene            191403..192605
FT                   /locus_tag="LSL_0166"
FT   CDS_pept        191403..192605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0166"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98981"
FT                   /db_xref="GOA:Q1WVD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD6"
FT                   /protein_id="ABD98981.1"
FT                   /translation="MPIDNKLIDDAGKKYRQLTEWFYLCCLAIFFITIYINGTTMVDQI
FT                   TYFNKLIFLRIEQAVTLLVMGKIVLLDKYPRKLTIKLLLIFMLITYICYRARAYEPLFY
FT                   TVFLIGAKDVDFRKILKLYLTFGIPIFIVSAWLALNDYILNLTLQRPGDNTVRIALGNY
FT                   SPSDAAAHIFYFMLAYALLKRFKWNIPEIISGIALLICVYTLTATKLDEILIILILLLC
FT                   AGGYKYAVKFIQRFSLKQVRWGLWIYAVINVMLPLMFNPNSRIWSIINTLSSARLFFGQ
FT                   VAYHDYAIPLFGQFVYQNGNGSIKPGEAYFFIDSSFVRALLMYGLVFFVVAMFYIISSI
FT                   ESNIKQRNYNLVIALILVLLSSAIDNHLWDMAFNIVFLGMFADVQSDNEIVGIENESNT
FT                   K"
FT   gene            192586..193263
FT                   /locus_tag="LSL_0167"
FT   CDS_pept        192586..193263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0167"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98982"
FT                   /db_xref="GOA:Q1WVD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD5"
FT                   /protein_id="ABD98982.1"
FT                   /translation="MKVTQNRNLETTSMGLLLGYFILSIFLNSLGNALTVSLNLGSALW
FT                   TAAAVNIAKITPISLSAMLFISGFIVIIVNLVILKKVNVKRILGNLIFMTPFSVLVGIF
FT                   ATELVKLGIHSLNLPVRIFLDCLGVVLIAIAISLYQRINWMLHPVDDLMQIIRFKYFKG
FT                   SSTIAQLVTFTPPIVAIIISVIVSHHIYAINVGTIFALLCQGPIVGIADKIVFPSLKHR
FT                   NLD"
FT   gene            complement(193380..194819)
FT                   /locus_tag="LSL_0168"
FT   CDS_pept        complement(193380..194819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0168"
FT                   /product="Amino acid permease"
FT                   /note="COG0531 [E] Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98983"
FT                   /db_xref="GOA:Q1WVD4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD4"
FT                   /protein_id="ABD98983.1"
FT                   /translation="MLDQKKHYMSWPVIALLDFVTIISFENIFYPFQNQGLSVVISWIF
FT                   LLFTYVIPYALIATQLGLTFDNQDGGLASWIRRGTHSDLFGYITSWMYWTQTIPYLVDV
FT                   SNSVIVSISWIILGNNTLGHHMSTFTFGMLTFVIILLFIIFENVFRDSLEVLSIIGGGA
FT                   MFLISMLFVFMTVWALTHGAHIATQPFNLHAFKPNFSLHYFSTTGLLIFAMSGAELAAP
FT                   YINKMRNPKRDFPKAMWMLALMTAFLTIFGTLSLAVFFNANHIPNDFKMNGPYYAFKLL
FT                   GEQVGMGKSLMYVFAVVQLMFMLAQLAILIDAASRVFASDTAAKYMPSWLIKKNKAGRP
FT                   VHSYTLTAGISLLLLLLSGTLPNINSIYNWLLNLNGIVSPYKTALVFVAFLAIRWQEEQ
FT                   FKSDYVYIKNRTGALIVGFWCFIFTFVCATMGFIPQDAAPGTKAFDHQLFMNFVTVGFL
FT                   VVLGFLLPWLRKLELKRAAKK"
FT   gene            complement(195072..196886)
FT                   /locus_tag="LSL_0169"
FT   CDS_pept        complement(195072..196886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0169"
FT                   /product="Lead, cadmium, zinc and mercury transporting
FT                   ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="COG0474 [P] Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98984"
FT                   /db_xref="GOA:Q1WVD3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD3"
FT                   /protein_id="ABD98984.1"
FT                   /translation="MSRLSHKQKLYIIIGIAAVAVVLQYLLHLKLYAQILVTLVGAIIA
FT                   LSMFKEMVHTLRSGKYGVDLLAILAVVATLSVGEYWASMVILIMLTGGDTLEDYASHKA
FT                   NTELKALLDNSPQIAHKIMDDGDIDDVSVNDVKVGDKIVVKPGEIVPVDSFIIKGSGLF
FT                   DESSLTGESKPVEKNLRDNVMSGSLNGDNSVTLQVSKLAKDSQYQQLVKLVKEAESTPA
FT                   HFVRMADRYAVPFTLAAILISLAAWFFSGDPHRLAEVLVVASPCPLILAAPVAMVSGMS
FT                   RASRNGIVVKNGDVLEKLATAKTGAFDKTGTITSGQLTVQDVVTTSSMKVEELLQLAAS
FT                   AEQESSHILARSLVAYTDNQNIDLAPVSSLEEKTGKGIEATINHKNVKVGKLKFVAPNS
FT                   EMKPLATTTIYVSVDDELCGYVTFTDHVRPEAKETMNTLKALGVKKLMMLTGDQEKIAQ
FT                   RVAKEVGIDEVKADLLPQDKITALQNIPKSGHPTFMVGDGVNDAPSLATVDVGIAMGAH
FT                   GSTAASESADVVILKDDLSRVSKAVTISRDTIKVARQSVLLGIAICTALMLIASTGIIP
FT                   AFIGAMFQKVVDTVSILWALKARYSHEQ"
FT   gene            complement(197018..197881)
FT                   /locus_tag="LSL_0170"
FT   CDS_pept        complement(197018..197881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0170"
FT                   /product="DegV family protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98985"
FT                   /db_xref="GOA:Q1WVD2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD2"
FT                   /protein_id="ABD98985.1"
FT                   /translation="MANIKILTDSSVQLTPEEIEKYNITIVPLSVEVDGKNYVDGEDIS
FT                   REELVQALKDGNIPKTSQPPIGRFIDAYNELGKDGSEVLAIVLSDVLSGTYETASSAAD
FT                   MVDTKVTVINSKSTDRGLAFQVLAAAKDLEAGKSIDEIKDHLKDIYHRTTIDVLIDNLD
FT                   CLVAGGRVSRLAGALTKLINLKLIIRLNEESLDVIVKGRSKKTFIKHCKTLAEEYLQNH
FT                   NPIQALSLSNVGTDDSLLQKIKDTLLENNSIQEIPYIARLTSPIIMTHTGLNAVGVITL
FT                   NEKPTH"
FT   gene            198103..199038
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0171"
FT   CDS_pept        198103..199038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0171"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="COG0463 [M] Glycosyltransferases involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98986"
FT                   /db_xref="GOA:Q1WVD1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD1"
FT                   /protein_id="ABD98986.1"
FT                   /translation="MTKKLSIIVPCYYEEETIPLFYEAVEKVKKELNGIELEYWFVNDG
FT                   SQDGTLDEMRKLNAKDKEHVHYVSFSRNFGKEAALYCGLQQATGDYITVMDADLQDPPD
FT                   MLPEMIEILENEDYDCVGTRRTNRKGEPPIRSFFARMFYKLINKISDTEIVDGARDFRV
FT                   MTRQMVDAILSMTEYNRFSKGIFSWVGFNTKYLEYKNQERVAGTTSWNFWSLLKYSIDG
FT                   IVNFSQAPLDIAVYFGMLTSFFSGIGIVWIIIRYFLEGGDPTTGWTSTICLLLFFSGIQ
FT                   LMCLGIVGKYIGKIFSEVKRRPVYIIKEKK"
FT   gene            199067..199732
FT                   /gene="guaA"
FT                   /locus_tag="LSL_0172"
FT   CDS_pept        199067..199732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="LSL_0172"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG0518 [F] GMP synthase - Glutamine
FT                   amidotransferase domain; glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98987"
FT                   /db_xref="GOA:Q1WVD0"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVD0"
FT                   /protein_id="ABD98987.1"
FT                   /translation="MKMNVLQHSIHEGIGLIGEWAENNGYEVNVYQAANNNVKLPEVID
FT                   TDMLVVLGGPMSVNDDEEWIVKERELIRGMLMAHKSYLGICFGAQQLSKTLGGDVSSCP
FT                   KEVGWGEVKRLSNIIPEVPEKLDVLHWHGEQFRLPTEATPLFSSPLVENQGFIINENAI
FT                   GLQFHLEMNEAGVREVVENDSEFIKGNKLKQSAADILKHKVPEMNKQALFAMLDYIKD"
FT   gene            complement(199775..200134)
FT                   /gene="comA"
FT                   /locus_tag="LSL_0173"
FT   CDS_pept        complement(199775..200134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="LSL_0173"
FT                   /product="ComA operon protein 2"
FT                   /note="COG2050 [Q] Uncharacterized protein, possibly
FT                   involved in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98988"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC9"
FT                   /protein_id="ABD98988.1"
FT                   /translation="MDLIEYLGIKSIISSKDKVILSLNVTDKVQQPFGVLHGGINSVLA
FT                   ETAASIGANLNLSHGHAVGVNISTNHLKSVTSGKLTVEATPLRIGKRIQVWQANTFDDK
FT                   NNLTSNSTIALTNIN"
FT   gene            200216..201037
FT                   /gene="menB"
FT                   /locus_tag="LSL_0174"
FT   CDS_pept        200216..201037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="LSL_0174"
FT                   /product="Naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="COG0447 [H] Dihydroxynaphthoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98989"
FT                   /db_xref="GOA:Q1WVC8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC8"
FT                   /protein_id="ABD98989.1"
FT                   /translation="MTSVEWEKVKDYSEIIFERAGQIAKITMNRPEKHNAFTPVTVAEM
FT                   IEAFTICRDDSTIGAIILTGAGDKAFSSGGDQTVRGNGGYVGPDKIARLNVLDLQHLIR
FT                   IIPKPVIAMVKGWSVGGGNVLQLVCDLTIAADNAMFGQTGPKVGSFDAGYGSGYLARVI
FT                   GHKRAKEVWFLNHFYTAQEAYEMNWINKVVPLDEVESVTLDWCNEILQKSPTAIRFIKA
FT                   AMNADTDGLAGLQQFAGDATMLYYTTDEGKEGRDAFNEKRKPDFQQFPKFP"
FT   gene            201037..202470
FT                   /gene="menE"
FT                   /locus_tag="LSL_0175"
FT   CDS_pept        201037..202470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="LSL_0175"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="COG0318 [IQ] Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98990"
FT                   /db_xref="GOA:Q1WVC7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC7"
FT                   /protein_id="ABD98990.1"
FT                   /translation="MENWLKKRVLLSPNKIAIQAGNTKLTFKEVSDRVAVLTARLANKS
FT                   RKGMRVALLTNNTIDGYLMILSLQQLGCEIVFLNKRLSHEELQYQLEDAAVSLLIYDES
FT                   LLHEEFVGIESLTFNQIESLEESRDFQLVSEFNDDEVTTIMYTSGTTGKPKGVQQSFKN
FT                   HFYSAISSALNLGLTDKDNWLCAVPIFHISGLSIIMRGLIYGMTVTLMDKFDAEKVTFL
FT                   LKESSVSTMSVVPTMLQQLLEIFPQEGYNSNFRCFLLGGGPIDKVTLEQCQQRNIPVIQ
FT                   SYGMTETASQVIALNFEDAENKIGSVGKTLFSVELKLAHDGEVLLKAPNITPGYLNNPE
FT                   KNQEVFENGWFKTGDIGYLDEDGFLYLKGRKGDMIISGGENIFPHEVEESYLKLTGVKD
FT                   IVVAGITDKKWGQVPVAFVILERKLSQQELISYGREHLAHYKVPVRFYQVMSYPQTASG
FT                   KVKRRELIQIKEYQKNLIK"
FT   gene            202545..203285
FT                   /locus_tag="LSL_0176"
FT   CDS_pept        202545..203285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0176"
FT                   /product="Hypothetical protein, ErfK family"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98991"
FT                   /db_xref="GOA:Q1WVC6"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC6"
FT                   /protein_id="ABD98991.1"
FT                   /translation="MKKNNLIYWIVAIILVGIAGWSAVHMHHLESKNAVKVSREMKISS
FT                   SISRHIKKITKEQKKAMRKKVDWNKPSMTKAYPDVSKYKNVKKSNRIRLVVSSAKQRVY
FT                   VMSGPYVLYTMYASLGKNYNSKTPNYQVTPVGKFKLEETRGDKFYDATRQLGGLHWTSF
FT                   KGKGMYHFQSVPVDENGKVIEKDAKHLGSTKITKKNNIKAYGSIWLTVPDAEWIQKNLP
FT                   VGTKVLIYGEDASSDNFIADNAKH"
FT   gene            203419..204789
FT                   /locus_tag="LSL_0177"
FT   CDS_pept        203419..204789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0177"
FT                   /product="Multidrug resistance protein B"
FT                   /note="COG0477 [GEPR] Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98992"
FT                   /db_xref="GOA:Q1WVC5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC5"
FT                   /protein_id="ABD98992.1"
FT                   /translation="MARNIADTINPKTRLAVSIILLLSTFISLMSQTMMITALPVIQNQ
FT                   MNQSLTTVQWLTTGYTLLIGIVTPLSSNMYDKFSNRSVFLGTIGTFVIGTLIGCLATNF
FT                   WLLLLARLVQACAGGILMSFQMTTMISIYPPEKRGTIIGMSGLVIAFGPAIGPTLAGFI
FT                   LNLLGWRYLFILILPIMVLIWIIGYFVFPNYSEPLDIKIDYLSVVLSLLGSSLALIGIT
FT                   IVQTQWMLGLAMLVVGAIILYFFVKRQLNLKQPMLNVRIIKLYSFRMMVLVGICAFMVL
FT                   LGMEQMVSIYAQNVSHVSSMTAGMILLPGAIANALTASVVGRAYDQYGAKWLVISGGIL
FT                   MLISAIPFVIISKGTPIWIMTVFYMIRMVGNALVFSPAISESFRGVAPREISHATALNN
FT                   TLRQVSGAVSVTMLIVISSIPHSFVLGMRISMWVTVVLVLLMLAVFISYIKNRNSRR"
FT   gene            204794..205207
FT                   /locus_tag="LSL_0178"
FT   CDS_pept        204794..205207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0178"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98993"
FT                   /db_xref="GOA:Q1WVC4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC4"
FT                   /protein_id="ABD98993.1"
FT                   /translation="MDNMNKSTIEYLVAKFNRKIRLSLNRELLKYGLNEANFYYLFVVI
FT                   NNPGINQVQMIKLLDREQSIVTKQISNLVKNGWLEKRKSTTDHRQTELYPTSKTLDNID
FT                   DITEITEKVSAEVTSNLSEKESATLQKLLQKVL"
FT   gene            205303..206721
FT                   /locus_tag="LSL_0179"
FT   CDS_pept        205303..206721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0179"
FT                   /product="Dipeptidase A"
FT                   /EC_number="3.4.13.-"
FT                   /note="COG4690 [E] Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98994"
FT                   /db_xref="GOA:Q1WVC3"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC3"
FT                   /protein_id="ABD98994.1"
FT                   /translation="MMEQACTSILVGKKATVDGSTMIGRNDDTFLPITPQRFVMQPAVS
FT                   GRKETWTSNKNGFTAPLPSEGYRTTFTPNADVEKNGVFGETSINEKNVAMSATESVYGN
FT                   PRALAYDPWIENGLAEDSLQDMVAPYIDSARDGVKYLGNLIKKYGSPEGNGVLFADKDE
FT                   VWYMEIVTGHHWAATRIPDDAYAIAANQVAQQKIDFNDPENYMWSYGLLEFVEEHHLNP
FT                   NKDDFNFRKIFGTDTEKDRHYNTPRVWFGQRYFTPEVEQEPTSSELPFICRANRLLSVE
FT                   DLEYVLSSHYNETKYDPLGHGSEEDKKRFRPISLNRTQNSHVLQIRNNVPEEQAGLMWM
FT                   CFGVPSFTPYVPFYANANDTDPSWSNTPLEFDMNSAYWMYRALSMLVESHHAQFIQDDL
FT                   DYLTAAREQQHRLIDENDKAAQELSGEDLTRFLTEKNYEMVADMKERTMGMINHFFVEG
FT                   LKLSKLTFNMDANL"
FT   gene            complement(206783..207865)
FT                   /locus_tag="LSL_0180"
FT   CDS_pept        complement(206783..207865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0180"
FT                   /product="Transcriptional regulator, LytR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98995"
FT                   /db_xref="GOA:Q1WVC2"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC2"
FT                   /protein_id="ABD98995.1"
FT                   /translation="MPQDNRRRRRSIENYQNDTSSHVPQRQHEHHHSPHRLSKTIFFWL
FT                   LLSLVVFAIVGGKYLEKKLNNAQKAANTIYSSSNFSKSRNVSSTLKKGKPVSILLMGTD
FT                   TGALGRDFRGRTDTLIVLVMNPKDKKMTLVSLPRDEKVAISGYEEYYPSKLNSAYFYGG
FT                   SKAAVRTVQQDLNIPIDFYVTVNMGGLESIINAIGGVDVAPTISFSYGGYSFKKGKVTH
FT                   MNGPKALAYVRMRHEDPLGDYGRQTRQRQVLMKVALKSSHVSNLLNQKFLNTISKQMQT
FT                   DLSFDDLLALGTKYRVATHGMDSDHLQGTSTMIMGESFEIPTLSEKQRITNKVRSALDL
FT                   EKAKTGSTYGTDYEINTSQY"
FT   gene            complement(207879..208244)
FT                   /locus_tag="LSL_0181"
FT   CDS_pept        complement(207879..208244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0181"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0344 [S] Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98996"
FT                   /db_xref="GOA:Q1WVC1"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC1"
FT                   /protein_id="ABD98996.1"
FT                   /translation="MDKKTKNEMETVEILIGKIMRIGVLIAASVMVIGFIMLVCQQSSG
FT                   YPGTTFPTTLSEILKGITTFKPYAYMMAGIFLLILTPVLRVLVSIYAFYKEKDVLYVWI
FT                   TTIVFIILMFGFILGHH"
FT   gene            complement(208246..209091)
FT                   /locus_tag="LSL_0182"
FT   CDS_pept        complement(208246..209091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0182"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0679 [R] Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98997"
FT                   /db_xref="GOA:Q1WVC0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVC0"
FT                   /protein_id="ABD98997.1"
FT                   /translation="MITSTLLMLAVGLFAGIMGAILGIGGGMIITPIITLALGLDIKYA
FT                   IGASIIAVIATSSGSTIAFLKDDVLNLRVAMFLEIATTIGAIVGAILTGIFHPAILYFL
FT                   FGSLLIFSSWNMYRKLRSGKEILKRAKPDKWAQKFNLNSSYFDKNLNKQIDYQVENIPG
FT                   GLSIMFGAGIASGMLGIGSGAFKVMAMDNAMKMPLKPSSATSNLMMGVTAAASASVYFF
FT                   NGSIKPGIAVPLALGILVGAAIGSRIMQHLPSRVIRMIFIPILLYLGLQMIFKAFGVTI
FT                   "
FT   gene            209213..210070
FT                   /locus_tag="LSL_0183"
FT   CDS_pept        209213..210070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0183"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98998"
FT                   /db_xref="GOA:Q1WVB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB9"
FT                   /protein_id="ABD98998.1"
FT                   /translation="MNLKQLQYFIAVVEEKQITAAAKKLNIAQPPLSYQLKQLEAELET
FT                   RLFTRTAHGIVLTDAGMMLEKYARKILDLTTVAEEKVKKTTKGELGKISLGTVSSSAAA
FT                   LPIGKLKEFRKYYPEINFEIFESNTYGILEKLFNGEIDLGLVRTPFNQRELETKIMMEE
FT                   PMVAVVNSDDYLKGKKKIGIDDLEEVPLIIYRRFENIFRQTFSQFGINPYIAVKCDDAR
FT                   TAIYWAKLEMGVALVPASCAKNYTNGRIIPINYPGWNTQLTLIWLKNSNKSPLILKLIE
FT                   LFSV"
FT   gene            210088..210753
FT                   /locus_tag="LSL_0184"
FT   CDS_pept        210088..210753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0184"
FT                   /product="Phosphatase"
FT                   /note="COG0671 [I] Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD98999"
FT                   /db_xref="GOA:Q1WVB8"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB8"
FT                   /protein_id="ABD98999.1"
FT                   /translation="MSVIIKEKKKREPLAYLFTILFFINYFLVFQQAQWLHKIDTAVYF
FT                   KLTRNLNNLQVMFYNVISELSSSRMAIVYTIVLLGILWFIRWQIPGVWITFTVGTGLVV
FT                   GWVARLILRYGSKRVEPEMGYAFPGLHVLGMTILVAIVYIIFLPYFKDKALAYLVGFIL
FT                   GIWLIATSVACIYLGQLHVSDITGALTLGFAWVYYCSNLYIRYAAKLKKIKGFRNSNY"
FT   gene            210768..211238
FT                   /gene="wecD"
FT                   /locus_tag="LSL_0185"
FT   CDS_pept        210768..211238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="LSL_0185"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99000"
FT                   /db_xref="GOA:Q1WVB7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB7"
FT                   /protein_id="ABD99000.1"
FT                   /translation="MKEVEDLIIRKLSSNDLNDFREIITQKEVARMAGFAPVSSFASFY
FT                   LSQMLQNGAWGLVVNKKVVGVICIYDLPVKNSNKKTGEIGFILNQNYWYRGYMSKAIRE
FT                   ICSHVKEDYSQIKAITLVDNIASKKVLERNDFYFSETIMDNDEEKNIFLRNL"
FT   gene            211461..213146
FT                   /locus_tag="LSL_0186"
FT   CDS_pept        211461..213146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0186"
FT                   /product="Acetolactate synthase"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0028 [EH] Thiamine pyrophosphate-requiring
FT                   enzymes [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99001"
FT                   /db_xref="GOA:Q1WVB6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB6"
FT                   /protein_id="ABD99001.1"
FT                   /translation="MTEDKGKRYGADAIIDSLVNHDVKYVFGVPGAKIDRVFERLEHPT
FT                   NEKAPQLIITRHEQNAAFMAQGIGRITGKPGVVLTTSGPGVSNLATGLVTATAEGDPVL
FT                   AISGQVQRTDLLRLTHQSMDNVALLAPVTKYAAEVQEPENISEVIANAYQEAEAAKQGA
FT                   SFVSVPQDVTDSEVKTAPIAPMPAPVLGPASPVESTLLAQRIKTAKLPVLLLGMRASDP
FT                   ETTKSIRNLVEETHLPVVETFQGAGIIPRELEDDFFGRVGLFRNQPGDQLLKHADLVIA
FT                   VGYDPIEYEPRNWNNEGDANIIVIDSMRAEVDKNFQPERELVGDISQTLDFLLPYMKGF
FT                   KLPESSREYLDGLQEKLKLRDEPPAVTENQVTSHPLSIIQALQDRVTDDMTVSVDVGSF
FT                   YIWMARHFRSYNPRHLLFSNGMQTLGVALPWAISAALVRPNTQIVSVSGDGGFLFSSQD
FT                   LETAVRLGLNIVHIIWNDGHYDMVKFQEELKYGKSAGVNFGSVDFVKYAESFGATGLRV
FT                   EKAQDLEKVLDQAFATEGPVVVDIPVDYSDNKELGKQILEDQLH"
FT   gene            213168..213884
FT                   /gene="alsD"
FT                   /locus_tag="LSL_0187"
FT   CDS_pept        213168..213884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsD"
FT                   /locus_tag="LSL_0187"
FT                   /product="Alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /note="COG3527 [Q] Alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99002"
FT                   /db_xref="GOA:Q1WVB5"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB5"
FT                   /protein_id="ABD99002.1"
FT                   /translation="MKDTKKLFQHGTLALLVPGLFDGTLPLSSLLEHGDTGIGTATGLD
FT                   GEMIILDGVPYLVRSDGSVNVLDANKVKVPFANSHFDNPEIEFDVTDATPDQLKDMIFF
FT                   KYNLKNVFFAVKVKGKFDYIKTRAVEGQKKPYPTLTEVADKQAIFEENDGQGTIVGYFS
FT                   PELFHGMASAGFHLHYLNDAHNLGGHLLDYKIKEAKVYLQVFESVETHFPVENEDFMKE
FT                   EFDIDGLRASISSAEK"
FT   gene            214228..215679
FT                   /locus_tag="LSL_0188"
FT   CDS_pept        214228..215679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0188"
FT                   /product="Lysine-specific permease"
FT                   /note="COG0531 [E] Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99003"
FT                   /db_xref="GOA:Q1WVB4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB4"
FT                   /protein_id="ABD99003.1"
FT                   /translation="MSENSNQGEMKRSLKTRHVSMIALGGSIGTGLFVASGSAISTAGP
FT                   GGALVAYIAIGLMVYFLMTSLGEMATYLPVTGSFATYAGRFVDPALGFAMGWNYWFNWA
FT                   ITVAVDVSTSAIVLRYWFPNIPSWVFSLIVLLVIFAINALSVKSFGETEYWLALIKVIT
FT                   VIIFLIVGLLTIIGIIGGHATYLENFTYKKAPFVGGIPAVLSVFVVAGFSFQGTELIGI
FT                   TAGESATPEKSIPKAIKQVFWRILLFYILAIFVIACLIPYTSPNLLGSEATDIAISPFT
FT                   LVFKRAGLASAAAVMNAVILTSVISAANSGMYASTRMLFSLSLTKDAPRVFSLVNNRGI
FT                   PMPALLGTTFVALLTFLSSIFGDKIYTFLVSASGLTGFIAWVGIAISHYRFRRAFKKQG
FT                   HELSELRYHAKWFPFGPLLALVLCILVIVGQDLKSFANLDWQAISVTYMSVPLFLILYC
FT                   YYKIKYKTKVIPLDEVDLTPHKVEK"
FT   gene            215973..217250
FT                   /gene="serS"
FT                   /locus_tag="LSL_0189"
FT   CDS_pept        215973..217250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="LSL_0189"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172 [J] Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99004"
FT                   /db_xref="GOA:Q1WVB3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVB3"
FT                   /protein_id="ABD99004.1"
FT                   /translation="MLDIKDIRLNTEEYKRRLGTRGVKPEEIDELVAEDKKRRELLVET
FT                   ENLKKERNEVSEAIAQAKRNKEDASEQIQAMRKVGTKIKELDEKLAKVEENVKSMAAHL
FT                   PNLPNPTIPVGPDEDSNVELYKVGTPRKFDFEPKAHWDIGEDLGILDFDRAAKVSGARF
FT                   VFYKGLGAKLERAVYNFMLDEHAKEGYTEVIPPYIVKSKSMYGTGQFPKFKDQVYQVNG
FT                   EDMTLIPTAEVPLTNYYREEVIPTEDLPVYFTALSPSFRSEAGSAGRDTRGLIRMHQFN
FT                   KVEMVKYTKPEDSYNELEKMTKNAGNIMEKLGLPYHVITLSTGDMGFSAAMTHDLEVWM
FT                   PAQDTYREISSCSNCEDFQARRARIQYRDENGKLQYVHTLNGSGLAVGRTVAAILENYQ
FT                   NEDGSVTIPEALRPYMQGLEVIKKEK"
FT   gene            217778..219294
FT                   /locus_tag="LSL_RNA004"
FT   rRNA            217778..219294
FT                   /locus_tag="LSL_RNA004"
FT                   /product="16S ribosomal RNA"
FT   gene            219398..219472
FT                   /locus_tag="LSL_RNA119"
FT   tRNA            219398..219472
FT                   /locus_tag="LSL_RNA119"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA Ile anticodon GAT, Cove score 91.61"
FT   gene            219504..219576
FT                   /locus_tag="LSL_RNA120"
FT   tRNA            219504..219576
FT                   /locus_tag="LSL_RNA120"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA Ala anticodon TGC, Cove score 84.64"
FT   gene            219703..222482
FT                   /locus_tag="LSL_RNA007"
FT   rRNA            219703..222482
FT                   /locus_tag="LSL_RNA007"
FT                   /product="23S ribosomal RNA"
FT   gene            222727..222843
FT                   /locus_tag="LSL_RNA008"
FT   rRNA            222727..222843
FT                   /locus_tag="LSL_RNA008"
FT                   /product="5S ribosomal RNA"
FT   gene            222849..222921
FT                   /locus_tag="LSL_RNA009"
FT   tRNA            222849..222921
FT                   /locus_tag="LSL_RNA009"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Val anticodon TAC, Cove score 81.17"
FT   gene            222925..222997
FT                   /locus_tag="LSL_RNA010"
FT   tRNA            222925..222997
FT                   /locus_tag="LSL_RNA010"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.77"
FT   gene            223013..223098
FT                   /locus_tag="LSL_RNA011"
FT   tRNA            223013..223098
FT                   /locus_tag="LSL_RNA011"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Leu anticodon TAG, Cove score 73.01"
FT   gene            223107..223179
FT                   /locus_tag="LSL_RNA012"
FT   tRNA            223107..223179
FT                   /locus_tag="LSL_RNA012"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Thr anticodon TGT, Cove score 86.05"
FT   gene            223184..223255
FT                   /locus_tag="LSL_RNA013"
FT   tRNA            223184..223255
FT                   /locus_tag="LSL_RNA013"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA Gly anticodon GCC, Cove score 83.89"
FT   gene            223265..223350
FT                   /locus_tag="LSL_RNA014"
FT   tRNA            223265..223350
FT                   /locus_tag="LSL_RNA014"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Leu anticodon TAA, Cove score 68.14"
FT   gene            223359..223432
FT                   /locus_tag="LSL_RNA015"
FT   tRNA            223359..223432
FT                   /locus_tag="LSL_RNA015"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Arg anticodon ACG, Cove score 69.22"
FT   gene            223480..223553
FT                   /locus_tag="LSL_RNA016"
FT   tRNA            223480..223553
FT                   /locus_tag="LSL_RNA016"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Arg anticodon ACG, Cove score 67.74"
FT   gene            223558..223631
FT                   /locus_tag="LSL_RNA017"
FT   tRNA            223558..223631
FT                   /locus_tag="LSL_RNA017"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Pro anticodon TGG, Cove score 89.02"
FT   gene            224035..224985
FT                   /gene="pyrB"
FT                   /locus_tag="LSL_0190"
FT   CDS_pept        224035..224985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="LSL_0190"
FT                   /product="Aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="COG0540 [F] Aspartate carbamoyltransferase,
FT                   catalytic chain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99005"
FT                   /db_xref="GOA:Q1WVB2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVB2"
FT                   /protein_id="ABD99005.1"
FT                   /translation="MDKLLSLNNFVSVENLENEDVEKLIKRAEYFKNGGEAPHLNKEVY
FT                   VANLFFENSTRTHTSFEMAERKLGLTVIPFDPGHSSVNKGETLYDTLLTLGALGVDLSV
FT                   IRHSENNYYEKLINLNPDQHLNMGIINGGDGSGQHPSQCMLDIMTIHEQFGTFKGLKVV
FT                   IVGDLKNSRVARSNMQLLTRLGAKVYFSGPEYWYSSEFDKYGEYAPLDELIEDMDVVML
FT                   LRVQHERHDGDKNEKLFSETEYHKLYGLDEKRYNKLKKDAIIMHPGPVNRGVEWADELV
FT                   EAPKSRYVTQMKNGVFMRMAMIEAVMRGRKLGGLE"
FT   gene            224985..226274
FT                   /gene="pyrC"
FT                   /locus_tag="LSL_0191"
FT   CDS_pept        224985..226274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="LSL_0191"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG0044 [F] Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99006"
FT                   /db_xref="GOA:Q1WVB1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVB1"
FT                   /protein_id="ABD99006.1"
FT                   /translation="MATLIKNGNLYQAGRIYQADVLIEDGKIKAIGKNLSDVVKENLVE
FT                   IDATNKLVAPGLVDVHVHYRDPGFTYKETIHTGSLAAAHGGYTTVCAMPNLDPVPDTPE
FT                   LVEKMCSRNQEDGVVKVKQYGSITHGLKSEELVDFVGMKKAGAFAFSNDGSGVQTAGTM
FT                   YQAMKSAAALNMAIVAHVEDNSLLFGGVMNAGKRADELGLPGILGISESSQIARDLLLA
FT                   KETGVHYHVCHVSTKESVELVRLAKQHKINVTCEVSPHHLLLADVDIPGNDPYYKMNPP
FT                   LRGVEDRQALIDSLLDGTIDMIATDHAPHSIDEKTGDMREASFGITGSETAFAMLYTKF
FT                   VKTGIFTLEQLLQWMSINPAEKFGMEDAGELLPGKSADLAIFDLNKEYVIKEEDYLSKG
FT                   INTPFTGEKVYGQTVLTMVDGQKVYQREEK"
FT   gene            226274..227362
FT                   /gene="carA"
FT                   /locus_tag="LSL_0192"
FT   CDS_pept        226274..227362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="LSL_0192"
FT                   /product="Carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0505 [EF] Carbamoylphosphate synthase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99007"
FT                   /db_xref="GOA:Q1WVB0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVB0"
FT                   /protein_id="ABD99007.1"
FT                   /translation="MKRYLILDDGSVFEGEGFGAKRTSFGEVVFTTGMTGYQEAVTDQS
FT                   YANQILVFTNPLIGNYGVNLDDFESLEPNCQGVVCREVARVSTNWRKQESFPEFLEEMN
FT                   IPGISGVDTRALTKLLRSHGTMKGMLVDAGVDIEEAKQRLHNTEITSQMVAEVSTSKAY
FT                   PNPGNKRNIVLVDYGVKHSILRELAARDCNTIVLPYTATAKDILRLKPDGVLLSNGPGD
FT                   PIMMENAVEMVKEIEQKLPVFGICLGHQILSLANGAKTFKMKFGHRGFNHPVKEIATGK
FT                   IMFTSQNHGYAVDPDSIEGTDLIVTHTEINDGTVEGVKHKYYPAFSVQFHPDAAPGPLD
FT                   AIDIFDDFMQIIDQRKEERNNA"
FT   gene            227355..230540
FT                   /gene="carB"
FT                   /locus_tag="LSL_0193"
FT   CDS_pept        227355..230540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="LSL_0193"
FT                   /product="Carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0458 [EF] Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99008"
FT                   /db_xref="GOA:Q1WVA9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA9"
FT                   /protein_id="ABD99008.1"
FT                   /translation="MPKRTDVHKIMVIGSGPIIIGQAAEFDYSGTQACLALREEGYEVV
FT                   LVNSNPATIMTDTEIADKVYIEPLTVESVSRIIRQEFPDAILPTLGGQIGLNLAIALAK
FT                   TGILEELGIKLLGTQLDAIDQAEDRQRFKDLMQELNEPVPDSKTVETVQEALDFAAEIG
FT                   YPVIVRPAFTMGGTGGGLCDNPEQLKEIVANGLELSPATQCLIEKSIMGYKEIEFEVMR
FT                   DADNNAMVVCSMENFDPVGIHTGDSIVFAPTQTLSDREYQMLRNCSLKLIRALKIEGGC
FT                   NVQLALDPNSYRYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEIKNPVTG
FT                   TTFAEFEPALDYVVAKIPRWPFDKFTRANRRLGTQMKATGEVMAIGRSAQEALQKAVRS
FT                   LEIDEKDLISAKAQSATDDEVEEKLFHAQDDRLFYIAEAFRRGYTIEEVHELTKINLYY
FT                   LDIVKQIVELESELSQNKEDLDVLKRAKRYGYSDYTIAKLWGTTEDEVRNLRKEHKLLP
FT                   VYKMVDTCAAEFDSSTPYFYSSYDLENESKKSDKKSVLVIGSGPIRIGQGVEFDYATVH
FT                   SVKAIQKLGYEAIVMNSNPETVSTDFSISDKLYFEPLTLEDVLNVIDLEQPMGVIVQFG
FT                   GQTAINLAAGLEAHSVKILGTTVEDLDRAEDRELFDQTIKNLGLKQPIGKTATTQEQVI
FT                   ACAEEIGYPVLVRPSYVLGGRAMEIVNNEQELLDYLAQNAPAEIDHPILVDAYLSGLEC
FT                   EVDAICDGKDVLLPGIMEHIEHAGVHSGDSMAVYPPQSFDENIKQQIVDATEKLAVALK
FT                   CVGIMNIQFIIHNNEAYVLEVNPRASRTVPFLSKITGIEMAQVATRVILGESLAEQGYQ
FT                   SGLYRESDMVHVKAPVFSFSKLADVDSFLGPEMKSTGEVMGSDYTFEKALYKAFTGAKM
FT                   ELPDNGNVLLTIEDKDKDAVLPLAKRFSKIGYRMFATEGTSQFLRENGLFVQTVDKLGK
FT                   DTGNETSLHDLIVNDGVDLVINTMSHDQEVASDGFVIRQLAIEHNIALLTSLNTADALL
FT                   KALENRSFATNSL"
FT   gene            230559..231503
FT                   /gene="pyrD"
FT                   /locus_tag="LSL_0194"
FT   CDS_pept        230559..231503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="LSL_0194"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /note="COG0167 [F] Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99009"
FT                   /db_xref="GOA:Q1WVA8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVA8"
FT                   /protein_id="ABD99009.1"
FT                   /translation="METKKLAVSLPGLELKNPIMPASGTFGFGDVPSANKYSLDTLGAL
FT                   VIKTTTPEARTGNPDPKISVIEDGVLNAVGLTNPGVDVVVSEKLPALREKYPELPIIGS
FT                   VGGATEDDYVEVATKLSQSGMVNALELNISCPNVHEGGMAFGTVPEVAERLTKKVKEVS
FT                   TVPVYVKLSPNVTDIVAIAKAVERGGADGISMINTVLGMHIDVASGKPVLGNIMGGLSG
FT                   KAVKAIAIRMIYQVAQNTDLPIIGMGGVETVDDVLEMYMAGASAVAVGTAHFHDSMICP
FT                   HLIEELPKRMEELGIESLEELRLNVKKRGAFKL"
FT   gene            231540..231613
FT                   /locus_tag="LSL_RNA018"
FT   tRNA            231540..231613
FT                   /locus_tag="LSL_RNA018"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Pro anticodon CGG, Cove score 77.65"
FT   gene            231806..232273
FT                   /locus_tag="LSL_0195"
FT   CDS_pept        231806..232273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0195"
FT                   /product="Transcriptional regulator ctsR"
FT                   /note="COG4463 [K] Transcriptional repressor of class III
FT                   stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99010"
FT                   /db_xref="GOA:Q1WVA7"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVA7"
FT                   /protein_id="ABD99010.1"
FT                   /translation="MQNRNISDIIEQYLKDILADSRRIEIKRSEIAQQFDCVPSQINYV
FT                   IKTRFTLKNGYVVKSKRGGGGYIRIVKVDLAENQSVLDDLISAIGTEITENQAYQLISS
FT                   LYEDGVFSRKEANYVLAAISRQALDLPTAEMENMIRARILVSILNQLRCEE"
FT   gene            232289..234781
FT                   /gene="clpC"
FT                   /locus_tag="LSL_0196"
FT   CDS_pept        232289..234781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="LSL_0196"
FT                   /product="Negative regulator of genetic competence"
FT                   /note="COG0542 [O] ATPases with chaperone activity,
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99011"
FT                   /db_xref="GOA:Q1WVA6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVA6"
FT                   /protein_id="ABD99011.1"
FT                   /translation="MAMEERYTPSAKQVLVLAQQQANYFKHQAIGTEHLLLALTMEKNG
FT                   VAAKVLQSFVVTEVDVREEIEHIVGYGNLQRRGADTYLPYSPRTRYVLERAREHAKLFN
FT                   VEKVGTEHILLALLEDDKTISSRILAALNIDLRKVKNITYRTMGVDATTANRTRKKLAL
FT                   SEKKQDNGTPTLDELARDLTEMVRKDQIDPVVGRDNEIKRVVQILSRRTKNNPVLLGEP
FT                   GVGKTAVAEGFSQKIVNGEVPDNLKNKRVMMLDMGSLVAGTKYRGEFEDRLKKIIEEIR
FT                   EDGNVILFIDEMHTLIGAGGAEGAIDASNILKPALARGEVQVIGATTLNEYQKYVEADA
FT                   ALERRFASVTINEPTPEVALTILKGLRPKYEKHHQLQITDEALESAVKLSKRYIASRFL
FT                   PDKAIDLMDEAAARVRINNAQKVDKVSAIKKKLSELSQEKTEALLKEDFEKAAEIRNEE
FT                   LKIQEKLEKQIQRDKDEEDSNNYRVKVTAEDIAEVVSEWTGVPVTQINRSEGDRLIRLE
FT                   KILHNRVIGQDEAVKAVSKAIRRARSGLKDPTRPIGSFMFLGPTGVGKTELAKALAEAM
FT                   FGSEDSMIRIDMSEYMEKYTTSRLIGSPPGYVGYDEGGQLTEKVRNNPYSVVLLDEVEK
FT                   AHNDVFNILLQVLDDGFLTDSKGRKVDFRNTIIIMTSNLGATALRDEKSVGFGAKDVSD
FT                   DYEAMAAKVRETLKKTFRPEFLNRLDEIVVFHSLNKEEIHQIVKLMAKNIIDRIKEQNI
FT                   NLKITPAAIDIVAEAGFDAEYGARPIRRILQDKIEDLLSEELLAGNIETGATVTIGAKK
FT                   GEITIKVKNPVAAEKINS"
FT   gene            235025..238624
FT                   /gene="rpoB"
FT                   /locus_tag="LSL_0197"
FT   CDS_pept        235025..238624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LSL_0197"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085 [K] DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99012"
FT                   /db_xref="GOA:Q1WVA5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA5"
FT                   /protein_id="ABD99012.1"
FT                   /translation="MNNLAGHLVKYGKHRVRRSYSRIKEVLDLPNLIEVQTDSYKWFLD
FT                   EGLREMFDDIMPIEDFQGKLSLEFVDYQLLEPKYTVEEARQHDANYSAPLHVTLRLINH
FT                   ETGEIKSQDVFFGDFPLMTKQGTFIINGAERVIVSQLVRSPGVYFNSELDKNGRTNYGT
FT                   TVIPNRGAWLEYETDAKNVAYVRIDRTRKIPLTELIRALGYGSDNEIVEILGSNSDSLM
FT                   LTLEKDVHKNMDDSRVEESLKDIYERLRPGEPKTADSSRSLLTARFFDPKRYDLAPVGR
FT                   YKINKKLDLKTRLLNLTVAETLADPDTGEIIVNKDEVIDKQVMDKLAPYLARDDFKTFT
FT                   FHPSEEGVVQEPMTLQIVKVYSPKDPEKVVNVIGNANVDIQFKHITPADIVASMNYFFN
FT                   LQEGMGSTDDIDHLGNRRTRSVGELLQNQFRIGLSRMERVVRERMSIQDTSTVTPQQLI
FT                   NIRPVVASIKEFFGSSQLSQFMDQTNPLGELSHKRRFSALGPGGLTRDRAGYEVRDVHY
FT                   THYGRMCPIETPEGPNIGLINSLSSYARINKYGFVETPYRRVSWETHKVTDKIDYLTAD
FT                   EEDNYVIAQANSPLNDDGSFVDDVVMARKKDDDVEISTEKVDYMDVSPKQVVAVATACI
FT                   PFLENDDSNRALMGANMQRQAVPLIKPHAPLVGTGIEYKAAHDSGVALISEHEGTVEYV
FT                   DAREIRVRRDDGSLDKYKLMKFHRSNGGKNYNQTPIVRVGDRVDADEVLADGPAMENGE
FT                   LALGQNPLIAFMTWDGYNFEDAIAINERLVKEDVYTSIHIEEHESEARDTKLGPEEITR
FT                   EIPNVGEDALKNLDEFGIIRIGAEVKDGDILVGKVTPKGVTELSAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGAGGIVQDVKIFTREGGDELSPGVNMMVRVYIAQKRKLQVGDKMAGRH
FT                   GNKGTVSVVIPEEDMPFMPDGTPIDIMLSPMGVPSRMNIGQVLDLHLGMAARKLGIHVA
FT                   SPVFDGARDEDIWSALQEAGLPGDGKTVLYDGRTGEAFDNRIAVGVMYYLKLAHMVDDK
FT                   IHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGR
FT                   VKTYEAIVKGEPIPKPGVPESFRVLVKELQALGMDMKVLDADKNEIELRDMDDEDDDIV
FT                   NVDALKKFAKEQEEKKAKEAEQETAEKEETKTE"
FT   gene            238653..242318
FT                   /gene="rpoC"
FT                   /locus_tag="LSL_0198"
FT   CDS_pept        238653..242318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LSL_0198"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086 [K] DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99013"
FT                   /db_xref="GOA:Q1WVA4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA4"
FT                   /protein_id="ABD99013.1"
FT                   /translation="MIDVNKFDSMQIGLASSDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFDERIFGPTKDWECACGKYKRIRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVTHI
FT                   WYFKGIPSRMGLVLDMSPRALEEIIYFASYVVTDAGDTALEKKQLLTEGEYREKREEYG
FT                   DGFKAAMGAEAIRTLLRDVDLEKECAELKEELREATGQKRTRAVRRLDILEAFLNSGNR
FT                   PDWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIDVGPKLKLNQMGIPHEMALELFKPFMMRELVKREMASNIKNAKRKIERRDEDIWD
FT                   VLDDVIKEHPVLLNRAPTLHRLGIQAFEPVLVNGKAMRLHPLACEAYNADFDGDQMAIH
FT                   VPLSDEAQAEARLLMLAAHHILAPKDGKPIISPSQDMTIGNYYITLEEAGREGEGMVFK
FT                   DVNEVRTAYQNGYVHLHTRIGLQASSLAKLGTPFTDWQKERILITTAGKAIFNEILPAD
FT                   FPFLNEPTQENLTGMTPDKYFVEPGTDIKEFIKNQPLVGPFKSGFLSDIIAQVYKEYKV
FT                   TATAELLDRMKDLGYYESTKSGLTVGIADVTVLKEKPEIIEQAHKNVATVAKQFRRGLI
FT                   TDEERYNRVISIWNKAKDDIQAKLVENMDPSNPIQMMSDSGARGNISNFTQLSGMRGLM
FT                   AAPNGKTMELPVISNFREGLSVLEMFLSSHGARKGMTDTALKTANSGYLTRRLVDVAQD
FT                   VIIREEDCHTDRGLDVTAITEGNEMIEPLYDRILGRYTMKEVKDPNTGEIIVPANVLVE
FT                   ESEARKIVDAGVQKVTIRSAFTCNTRHGVCERCYGRNLATGDEVEVGEAVGTVAAQSIG
FT                   EPGTQLTMRNFHQGGVAGGDDITQGLPRVQELFEARNPKGRAVITEVTGVVDTVEENPA
FT                   ERTKEVTVKGETDTRTYSLPFTSVLKVKEGDQVHRGDALTVGSIDPKELIKVRDVLSTE
FT                   NYILREVQKVYRMQGVDISDKHIEIMTRQMLRKVRIMDPGDTDMLPGTLLDISQFKDRN
FT                   TSAIIEGRIPATARPVLLGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLK
FT                   ENVIIGKTIPAGTGMKKYHDIEPEVVNSNVTDGVYSISELEEKINEQQNNVESSN"
FT   gene            complement(242423..243079)
FT                   /gene="pilD"
FT                   /locus_tag="LSL_0199"
FT   CDS_pept        complement(242423..243079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="LSL_0199"
FT                   /product="Type IV prepilin leader peptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="COG1989 [NOU] Type II secretory pathway, prepilin
FT                   signal peptidase PulO and related peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99014"
FT                   /db_xref="GOA:Q1WVA3"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WVA3"
FT                   /protein_id="ABD99014.1"
FT                   /translation="MIYIFFLLFILGTCLGSFISCVAYRYKLGISIIYPRSFCDNCSQT
FT                   LQHWQLIPIIGFILQKGKCHFCKQKIPLSSTVIELAIGVIFIFNTIIIANTNLIFTSLL
FT                   VVWLTLISLEDYYTLSVDSITLEYGGLILLIFRFHTVITNLKANFLIIILFIIILISCN
FT                   LLNKFGTADTILIVFSFLLLGFYNTLVVILLSCILGIISYLIKRDFSASHPLFHI"
FT   gene            243364..243777
FT                   /gene="rpsL"
FT                   /locus_tag="LSL_0200"
FT   CDS_pept        243364..243777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="LSL_0200"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COG0048 [J] Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99015"
FT                   /db_xref="GOA:Q1WVA2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA2"
FT                   /protein_id="ABD99015.1"
FT                   /translation="MPTINQLIRKGRKSKGSKSNSPALNFGYNSYKKVQTNNSAPQKRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVEGRMQSRSKYGAKKPKK"
FT   gene            243812..244282
FT                   /gene="rpsG"
FT                   /locus_tag="LSL_0201"
FT   CDS_pept        243812..244282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="LSL_0201"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COG0049 [J] Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99016"
FT                   /db_xref="GOA:Q1WVA1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA1"
FT                   /protein_id="ABD99016.1"
FT                   /translation="MPRKGAVAKREVLPDPIYNSKLVTRLINRLMLDGKRGTASKILYQ
FT                   AFDIIKEQTGNEPLDVFEEAMKNIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWL
FT                   VQYSRLRGEHTMSERLAKEIMDAANNTGAAVKKREDTHKMADANRAFAHYRW"
FT   gene            244403..246496
FT                   /gene="efg"
FT                   /locus_tag="LSL_0202"
FT   CDS_pept        244403..246496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efg"
FT                   /locus_tag="LSL_0202"
FT                   /product="Protein Translation Elongation Factor G"
FT                   /note="COG0480 [J] Translation elongation factors
FT                   (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99017"
FT                   /db_xref="GOA:Q1WVA0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WVA0"
FT                   /protein_id="ABD99017.1"
FT                   /translation="MANKREFPLEKTRNIGIVAHIDAGKTTTTERILYYTGKIHKIGET
FT                   HDGASQMDWMEQEQERGITITSAATTAQWKENRINIIDTPGHVDFTVEVERSLRVLDGA
FT                   VVVLDAQSGVEPQTENVWRQATTYGVPRIVFVNKMDKIGANFDYSVSTIKDRLQANPLP
FT                   VQMPIGAEDSFEGVIDLIEMKADLYDEDELGSKWDTVDVPDEYKEDAQARRDEMIEALA
FT                   DVNEDIMDKYLEGEEISNDEIRAAIRQATLNLDVFPVFAGSAFKNKGVQMMLDGVNDYL
FT                   PSPLDVKPYKATDPETGEEIELKADDSAPFAGLAFKIATDPFVGRLTFFRVYRGTLEAG
FT                   SYVLNATKGKRERVGRLLQMHSNHRNEIPEVFSGDIAAAIGLKNTTTGDSLTDPKTPLI
FT                   LESMEFPDPVIQVSVEPKSKADQDKMDVALQKLAEEDPTFKAETNPETGETLIAGMGEL
FT                   HLDIIVDRMKREFNVEATVGEPQVAYRETFTKQVSAQGKFVRQSGGKGQYGDVWIEFTP
FT                   NEEGKGFEFEDAIVGGVVPREYIPSVEQGLKEAMQNGVLAGYPLIDVKAKLYDGSYHDV
FT                   DSSEAAFKVAASLALRNAAPKGGAVILEPIMKVEIIAPEDNLGDVMGHVTARRGRVEGM
FT                   EARGNAQVVNAFVPLAEMFGYATVLRSATQGRGTFTMTMDHYEPVPKSIQDEIIKKNGG
FT                   NAE"
FT   gene            246600..247331
FT                   /gene="sir2"
FT                   /locus_tag="LSL_0203"
FT   CDS_pept        246600..247331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sir2"
FT                   /locus_tag="LSL_0203"
FT                   /product="SIR2 family protein"
FT                   /note="COG0846 [K] NAD-dependent protein deacetylases, SIR2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99018"
FT                   /db_xref="GOA:Q1WV99"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV99"
FT                   /protein_id="ABD99018.1"
FT                   /translation="MDENILKLKKLVSESSNIVFFGGAGVSTESGIPDFRSEQGIYNTV
FT                   KNFGYPPEQILSHSFFMKNPEKFYDFYRSTMIYENAKPNLAHLRLAKLEKQGKLKAIVT
FT                   QNIDGLHQLAGSKTVYELHGSIHRNYCMKCGKFYPLSTITESKGVPQCKECGGTIKPDV
FT                   VLYEEGLDEEIINNSIKAIKKADMLIVGGTSLNVYPAASFVNYYDGNKLILINKSKTPY
FT                   DRYADLLIHDSIGKVFNEIIE"
FT   gene            247349..248533
FT                   /locus_tag="LSL_0204"
FT   CDS_pept        247349..248533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0204"
FT                   /product="Aminotransferase class I and II"
FT                   /note="COG1168 [E] Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99019"
FT                   /db_xref="GOA:Q1WV98"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV98"
FT                   /protein_id="ABD99019.1"
FT                   /translation="MYNFDKVAKFQNSLKWHVNDNELPMTLGDMDFEVAPEIITELHKR
FT                   IEGKNFGYEYIPYEYYASVAKWYKEMYNCTLDISWMSFSQGVVATLSAIITNLMSEDSV
FT                   ITVLTPGFDKFKKVGEGKQKVLVSELIYDKEKRDYDINWLDLEDKLKKTNLFVLCNPHS
FT                   PVGKIWSQKDLEKILKLSLKYDFKIFSDEIHGEITFEKKYTPLFSLDEKLLKNTIIAVS
FT                   PSKAFNIAGIQTATIITPNKELKEQVDNAIKSFHLNEANSLAVPATIAAYTEGRVWLEE
FT                   LKDYLRENRNFIERFLEHNVPDVKPSLNEASYFLWLDISSLNVDAQELTKFIRKKTGLI
FT                   LTAGDKFDGNGKQFLRMNIATSTDLIEDALRRLQRAVVLFKRKDDDLMSLILNK"
FT   gene            248688..249377
FT                   /locus_tag="LSL_0205"
FT   CDS_pept        248688..249377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0205"
FT                   /product="Two-component response regulator"
FT                   /note="COG0745 [TK] Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99020"
FT                   /db_xref="GOA:Q1WV97"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV97"
FT                   /protein_id="ABD99020.1"
FT                   /translation="MKILIVDDDKDIVELLSIYVENEGYEVEKAYNGKEALSKLNMNPD
FT                   IALMILDVMMPQMDGMEVIREVRKESQIPVLILSAKTDDLDKIQGLVQGADDYVTKPFN
FT                   PLEVMARVKSLLRRAEHNVKNNELDQIEIGPLIIKKDSHEVKTLEGKEIKLTALEFGIL
FT                   HLLASHPNRVFSADEIFERVWQQESVVSAKTVMVHVSHLRDKIEDATNGEQVIQTVWGV
FT                   GYKIESH"
FT   gene            249405..250556
FT                   /gene="baeS"
FT                   /locus_tag="LSL_0206"
FT   CDS_pept        249405..250556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeS"
FT                   /locus_tag="LSL_0206"
FT                   /product="Two component system histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG0642 [T] Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99021"
FT                   /db_xref="GOA:Q1WV96"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV96"
FT                   /protein_id="ABD99021.1"
FT                   /translation="MKFHITGREKSELLGEGILTIILLILLNMSLYVILNQLLVSNPDL
FT                   ASGIFLIKTSLDFKYAHIQLWSWGWIFIILMAVVDVIVVYWRLVRRYHQMQLRHIINEL
FT                   HYIADGHFNHRIPFQLKGQMQRVVASVNALVDSTIKAMEDEREIERSKDELITNVSHDI
FT                   RTPLTSIIGYLGLIEDKQYRSEEDILKYTHTAYLKSKQMKSLVDDLFEYTKVRQTDAPL
FT                   QIQSLELNAMLEQIGASFELEANKKGMEINTILPDSPVKIEADPEKLARVFNNLITNAL
FT                   KYGSDGKNIYLQLTKVDEKEIEIRISNDGEPIPEKSLRQVFDRFYRVESSRSKETGGTG
FT                   LGLAIAQSIIELHHGYIYVESNKNLTSFIMRLPIKHDNVVKKS"
FT   gene            complement(250664..251953)
FT                   /pseudo
FT                   /locus_tag="LSL_0206b"
FT   misc_feature    complement(250664..251953)
FT                   /pseudo
FT                   /locus_tag="LSL_0206b"
FT                   /note="Similar to transposase ISLasa4a, ISL3 family;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            complement(252176..253465)
FT                   /pseudo
FT                   /locus_tag="LSL_0206c"
FT   misc_feature    complement(252176..253465)
FT                   /pseudo
FT                   /locus_tag="LSL_0206c"
FT                   /note="Similar to transposase ISLasa4b, ISL3 family;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            253676..254545
FT                   /locus_tag="LSL_0207"
FT   CDS_pept        253676..254545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0207"
FT                   /product="Galactose mutarotase-like"
FT                   /note="COG2017 [G] Galactose mutarotase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99022"
FT                   /db_xref="GOA:Q1WV95"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV95"
FT                   /protein_id="ABD99022.1"
FT                   /translation="MAVKIENEKLFVTINEHGAELASLINKSNGINYLWSGDSKYWGRK
FT                   SPVLFPIEGALKDGKMFVDGKEYHMGQHGFARDMDFEVKKLTKESVCFELKSNTETLEK
FT                   YPYEFIFRLVYELKEETLVVRYEVENPSDSEMFFGLGAHPAFSVPLGEAAYDDYYLEIT
FT                   PEKTRKVLPLKGGLVDNINTIDGESRLEISHDVFAKDAIIYDLGEEPTKFSLKNTKNNY
FT                   GVEVFTPNSKFAGIWSSYPAKGQFVCIEPWWSLADTVYTDGNFKEKFATNKLNGKESFD
FT                   AYFEITVF"
FT   gene            254666..255835
FT                   /locus_tag="LSL_0208"
FT   CDS_pept        254666..255835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0208"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0477 [GEPR] Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99023"
FT                   /db_xref="GOA:Q1WV94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV94"
FT                   /protein_id="ABD99023.1"
FT                   /translation="MKKSIKPIASLILLYIGYMLLFADRTVMNISMAYIGKEFQISPAA
FT                   LGATASAFFLGYTLMQIPGGIVTDILGSKKTVIISLILWSLLTAFTGLATSLMTLVVIR
FT                   FLFGLAEGPYPSAALKQISEEYDKSDRSQATSVTISSNYAGAAIAPLIIVPIIASHGWR
FT                   VSFYFLGILGLILVGLYYLIERPIKSKKETTTAKKINWREIDSRIWIFVIIGLVLNVIT
FT                   KGLETWMPIYFLQAQHINLKNLAWLVPLPVIAGGIAAFISGFVMVHIFRKRERWMIFIS
FT                   SLLTLIFMFGMYKSTTLVWIVIFEILVYFTKSLAFTGIFSFVAQILDEKTYGSSIGVVN
FT                   FGGQLGGFIGPLLIGWLVQLSGSYSVAFVGLVVCALIAAITSTFVKNIK"
FT   gene            255956..257716
FT                   /gene="dxs"
FT                   /locus_tag="LSL_0209"
FT   CDS_pept        255956..257716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="LSL_0209"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="COG1154 [HI] Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99024"
FT                   /db_xref="GOA:Q1WV93"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV93"
FT                   /protein_id="ABD99024.1"
FT                   /translation="MNQHPDYILNQINSPKDVKNLTIDDLKKVATEIRQLVVEKDAAIG
FT                   GHVGPNLGIVETTIAFHYVFDSPKDKVVWDISHQSYPHKMLTGRKEAFLDPDHYRNVTG
FT                   YSNQDESEHDYFKVGHTSTSIALATGMAKARDMKNENGNIVAVIGDGSMSGGLALEGLN
FT                   NAAKLKSNLIIIFNDNQMSIDDVNGGMYKMFAELRETNGQSSNNLFKAMGLDYRYVDNG
FT                   NDLETMISVLEEVKDIDHPIVVHINTLKGEGYQPAIERKREFHWHVPFNVEDGSTKNVA
FT                   TGESYNKLILDELGRQIDDGKPIMAINAAIPGVFDLVPFKEKYPDNYDDVDIAEQYSIT
FT                   YATGLAANGARPVVFHNSTFLQRAYDQLEHDMALNGYPVVMLVKGGHITENSNTHQGIF
FT                   DIGMISSIPNLEYLAPTNAEELISMLRWALTQTDKPVVIREPVTEVRHGEADDDYTEIN
FT                   YRVANQGEKVAILGLGAFYKLGEDVQRKLKEDLNVDATLINPISATTLDVETLNNLKKD
FT                   HELVVTLEDASMVGGFGEKVDHFYANSEMKVLNFGAQKELTDMVPVEELYDRYHLNPEQ
FT                   IVDDIKRVID"
FT   gene            257836..259821
FT                   /locus_tag="LSL_0210"
FT   CDS_pept        257836..259821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1136 [V] ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99025"
FT                   /db_xref="GOA:Q1WV92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV92"
FT                   /protein_id="ABD99025.1"
FT                   /translation="MPVMELKNVTKTYKMAGGGTFEALRGISASFEAGELVAIVGESGS
FT                   GKSTLMNAIGGLDSDFGGEIIYEGKNLRNFSTQELVDYHKKSIGFIFQNFNLISHLNLI
FT                   DNVSMAMTLSNVSEDFRKKRAKELLRKVGLEKHMYKKPDQISGGQKQRVAIARALVNDP
FT                   DVIIADEPTGALDAETTDTILDMIREIAEEGKLVLMVTHSDKVASHCSRVLRIDNGELI
FT                   SDEQQLDLEYTENTREDIKVKNMSMWKAIKLAFLNMKAKLGRNLLVALGSSIGIMSVVL
FT                   MLALGKGVTSYVSSTMKSYTNPNITEVHKKSSTQQTTKNPQNMSREEIAKQQQENMAAL
FT                   TGSGTNTGFTKKDIEKLSKIKHVDRYQKGYSSFSLGTNTVKYNNKQASLMMLQTMSDSI
FT                   SKSSIVEGKAPKNNHEIMLDRATADLLGKNILDKEVTLTLKIGEKTITQNFKVTGLYES
FT                   QSQSSSTVFFTYAGLQDLYKTNQEKLLPNVVYLHTANKDNTKMIKDKVKDLGYTGSMQE
FT                   QMTEMFTKMLNIITWVLTAIAAVSLVVSAIMILVVLNISVVERTKEIGVLKALGARRKD
FT                   IRRIFASEAFLIGITSGAIGVVVTYVLGFFINNFTKAAFEVNVVSMTTKYAIAGIVISV
FT                   VISMIAGILPSNRASKLDPVEALRKE"
FT   gene            259832..260482
FT                   /locus_tag="LSL_0211"
FT   CDS_pept        259832..260482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0211"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99026"
FT                   /db_xref="GOA:Q1WV91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV91"
FT                   /protein_id="ABD99026.1"
FT                   /translation="MPKEIFFGIDKEKQNRIIQAAIKVFSSHNYNDSSINEVIKLAKIP
FT                   RGSFYQYFEDKRDLYLYIAQKIMQNFRDDFFKELDEQNGDIFATVKIVFPKQIHEVLGG
FT                   EYSNFYYYLLQASFMKDFRQKEVKSKDNSKHGWNVKQDFDVVYKMIDKEKLKIKSRSDF
FT                   DMFIRILITPFIIVITDTFLQMKHESDIPKIDIEEKKQEYLHKLEFIEYGFSK"
FT   gene            260504..262237
FT                   /locus_tag="LSL_0212"
FT   CDS_pept        260504..262237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0212"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /note="COG1132 [V] ABC-type multidrug transport system,
FT                   ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99027"
FT                   /db_xref="GOA:Q1WV90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV90"
FT                   /protein_id="ABD99027.1"
FT                   /translation="MVKLMRRNLDWWAVITATIFLGFQVVCDLSLPNLTSNLINNGVAK
FT                   GNVGYIWQIGLQMLGLTLVGIFAAAGNVYFASTQAQKMGARLRGKIFKKVLSFGNYEMD
FT                   KFGSSSLITRTTNDVMQIQNVTIMMLRMMIMAPLMLIGASVMAYFNEKRLTSIFLVSIP
FT                   ILLIAIGCAMYFAVPLFQKLQKQIDRINLIFREGLTGVRVIRAFRQDKFEQERFDRANK
FT                   DYTETGIKVFSIVSLMFPIMTLVLNVTNMGIIWFGAKLIANHEMQVGNLVAFMTYASMI
FT                   LFSFMMLSMIFVLVPRAEAAAKRINAVLEIENSINDVESEIDSDKDKLRASLEFKDVSF
FT                   RYRGAEDLALDNLSVDVKAGETLAIIGGTGSGKSTLINLIPRLYDVNSGEVLVDGNDVR
FT                   KYSLHDLHDKVAFVQQKAVLFKGTIRSNLLIGNPEATEEDMWKALEIAQAKDFISDLPD
FT                   GLDAVVEQGGDNFSGGQKQRLAIARAIIKPASIYVFDDSFSALDFKTDAKLRLALRQDE
FT                   RISKAIIVIVAQRISTVTGADHIVVLDEGKVVGQGTHKELLADNTTYQEIVESQMKGAA
FT                   I"
FT   gene            262237..264060
FT                   /pseudo
FT                   /locus_tag="LSL_0212b"
FT   misc_feature    262237..264060
FT                   /pseudo
FT                   /locus_tag="LSL_0212b"
FT                   /note="Similar to ABC transporter, ATP-binding protein;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            264369..264798
FT                   /pseudo
FT                   /locus_tag="LSL_0212c"
FT   misc_feature    264369..264798
FT                   /pseudo
FT                   /locus_tag="LSL_0212c"
FT                   /note="Similar to acetyltransferase, GNAT family;
FT                   nonfunctional due to frameshift"
FT   gene            265057..266436
FT                   /locus_tag="LSL_0213"
FT   CDS_pept        265057..266436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0213"
FT                   /product="ATPase associated with chromosome
FT                   architecture/replication"
FT                   /note="COG2110 [R] Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99028"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV89"
FT                   /protein_id="ABD99028.1"
FT                   /translation="MSETMENYIYCRVIFEENGKSYYYLTDDEEIKPLDLVVVPVGIDG
FT                   HEKIAQVIKVEKYTIHTVPYPLDKIKKIIRKCKLTDFRKLENKLAEDKLKRESVDDEEL
FT                   SINLLNLGVQAYRRGDYEIAKEYYEDAAQLGNSQAACNLGYIYAYGRTGVKDSERAFYY
FT                   FVQASLDGNSNGSYKVGDAYFYGDFVEKNKLLAFKYYQISEEQLGPEDLDIRSDIYYRL
FT                   ALCYHQGAGVVPDDMGALTYINLAQTSAYYDRLIGKYNYEELKRKIENLREKILLNLNH
FT                   VDNKTKIRLLKADITKVDNVDAIVNAANTSLLGGGGVDGAIHRVAGPLLLKECRQLNGC
FT                   EVGQAKITSGYNLPVEYVIHTVGPIWKGGNADESQLLVACYRNSLRLAQKCNIRKIAFP
FT                   AISTGIYGYPVVEATKIAFQVVKEYVQDNPGDFDLVEFVLFDDSTYNVYLKETGSNLIE
FT                   L"
FT   gene            266536..267093
FT                   /locus_tag="LSL_0214"
FT   CDS_pept        266536..267093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0214"
FT                   /product="LemA protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99029"
FT                   /db_xref="GOA:Q1WV88"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV88"
FT                   /protein_id="ABD99029.1"
FT                   /translation="MGLIIVIALVVIVVAVYISMYNGLQRAKVNTDESWSQIDVQLKRR
FT                   NDLIPNLVETTKGYAKHERETLSKVVELRNQMVALPADVDPQKKMELSNQLTDSLKSIF
FT                   ALAENYPDLKASQNFTQLQEELTNTENKIAYSRQLFNSSAAVYNQKLLTFPSNVVAKMH
FT                   HFTKVNYLEIPAEEKEAPKVSF"
FT   gene            267105..267992
FT                   /gene="htpX"
FT                   /locus_tag="LSL_0215"
FT   CDS_pept        267105..267992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LSL_0215"
FT                   /product="Endopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG0501 [O] Zn-dependent protease with chaperone
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99030"
FT                   /db_xref="GOA:Q1WV87"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV87"
FT                   /protein_id="ABD99030.1"
FT                   /translation="MLYQQIAKNKRKTVLVMAGFVFLAGLIGAAIGYAFMGSAQTGIII
FT                   AVVVGIVYMFVILGQSTDVVMSMNNAQEITEQQAPELWHIVEDMAMVGKVPMPRVFIID
FT                   DPSPNAFATGPDPEHAAVAATTGILQRLNREELEGVMAHEVSHIRNYDIRLQTYALALA
FT                   SVISFLANMGMNAMWWGGGRRDDRDNGNAGQVIMLLLSVLAIILGPLAASMAQMALSRN
FT                   REYLADASAVELTRNPQGLINALRKISMSEPMQNADPSSASMYIANPFKDGSWTHLFDT
FT                   HPPIEKRIDRLEHM"
FT   gene            complement(268098..268170)
FT                   /locus_tag="LSL_RNA019"
FT   tRNA            complement(268098..268170)
FT                   /locus_tag="LSL_RNA019"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Thr anticodon GGT, Cove score 72.38"
FT   gene            complement(268239..270506)
FT                   /gene="rep"
FT                   /locus_tag="LSL_0216"
FT   CDS_pept        complement(268239..270506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="LSL_0216"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG0210 [L] Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99031"
FT                   /db_xref="GOA:Q1WV86"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV86"
FT                   /protein_id="ABD99031.1"
FT                   /translation="MDNEKALEQKRVDDVMNEIQKQLDATQIEYDKAHKETTSVERNYV
FT                   QNARVNTYEVDDQMETNAEIQQQKNLVAKTIENETILKKQLSTLKILQDSAYFGRIDIH
FT                   ENGEEDSETLYIGTSSLVDENQDFLIYDWRAPISSIYYNGTLGPVSYETPMGEQFAELK
FT                   KKRQFTIKKGVITNMFDTNETIGDEILQSVLGEHSDEYMRNIVATIQAEQNDIIRDVKH
FT                   DLLLVQGVAGSGKTSAILQRIAFLLYHSRDKLNAEQIVLFSPNLLFSHYISEVLPSLGE
FT                   KNMRQITLAKFLNNRFEGLQVESLFDKYEKKITSSKKTNSIESIKEDPQFMHTVEEYVQ
FT                   NVSSSQLRFTDIMLDSEIFFSHNEIHDIYSQLPQAMKPSQKFAETKNLLIKQLNRKIKE
FT                   NAQADWVRSEIENLSDEEYYDLLGTKRRHAFQAIDDEEFYIGRKIVKKRFAPVYDALYN
FT                   NYFIDYYAQYSDFLANKLPEAVDLFNQNLEFHKIDLVDAAPLLYLRDLLTGSGRNQAIA
FT                   HLFIDEMQDYTLPQLMYLKYIFPNAKLTLLGDSEQALFNEFRTPQELLDYFNKHLNVKK
FT                   SRIIKLNKSYRSTQQITNFMKALLPDGNEIQAFTRQGKKPELIIASKENGLHALKLELK
FT                   QRDLSSPVALITKNQAESDFLYQKLRKSFDSVTLLEDKDRSLPKGIVILPIYLAKGLEF
FT                   DDVIAYDISHDNYSGINDTGILYTICSRAMHRLTLISCGKPSSLIMSIPSDLYTTKSTV
FT                   TL"
FT   gene            complement(270630..271655)
FT                   /gene="czcD"
FT                   /locus_tag="LSL_0217"
FT   CDS_pept        complement(270630..271655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="LSL_0217"
FT                   /product="Cobalt-zinc-cadmium resistance protein"
FT                   /note="COG0053 [P] Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99032"
FT                   /db_xref="GOA:Q1WV85"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV85"
FT                   /protein_id="ABD99032.1"
FT                   /translation="MSKIKKHLQEEFEDWEREQLKQLHSLNAAWRHLILNVLAYLSISI
FT                   IEYFLAEISNSQTLRADAFNNISGIVSTMLLMIGIHIARDIDDDDIAGMAPLPKLNMSQ
FT                   RENDQRVQFTRFRYETVFTLVTGVVMIGIAISVISTGIINLWKPDKRVIPEPIALVGAG
FT                   IATVIMLIVWYLNRRAGRKLQNAALSASAQDSLSDAFTSIGTLISISGALIFKITWLDG
FT                   ATSILVGLFILYSGFKIFMDSSLNLVDYFDPEVEEEYRNVVLSVPGVAHLSELKAHYNG
FT                   NIVSLDIVVMVDAKMSVLDSYRIAENIERIMHHRFGIMDTDVAFIPDPSSIDDDEIKDK
FT                   F"
FT   gene            271973..272992
FT                   /gene="trpS"
FT                   /locus_tag="LSL_0218"
FT   CDS_pept        271973..272992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LSL_0218"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COG0180 [J] Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99033"
FT                   /db_xref="GOA:Q1WV84"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV84"
FT                   /protein_id="ABD99033.1"
FT                   /translation="MAKEIILTGDRPTGKLHVGHYIGSLKKRVSMQNSGKYDSYIMIAD
FT                   QQALTDNARDPEKIKNSLIQVALDYLAVGLDPKKSTIFVQSQIPALAELNLYYLNLVTV
FT                   SRLERNPTVKAEIQQKHFERSIPAGFFTYPVSQAADITAFKANLVPVGDDQEPMLEQTR
FT                   EIVRTFNSIYGEVLVEPQGVFAPKGSGRLPGLDGNAKMSKSLNNAIYLSDDADTLRKKV
FT                   MSMYTDPNHIHVEDPGKVEGNMVFTYLDIFDKDKDKVAELKEQYRAGGLGDVKIKRYLN
FT                   EVLEAELGPIRARREEFAKDIPAVYAMLKEGSEKANEVANKTLEEVRRAIGVNYFDNI"
FT   gene            273081..274010
FT                   /gene="gppA"
FT                   /locus_tag="LSL_0219"
FT   CDS_pept        273081..274010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="LSL_0219"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="COG0248 [FP] Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99034"
FT                   /db_xref="GOA:Q1WV83"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV83"
FT                   /protein_id="ABD99034.1"
FT                   /translation="MQNLVILDFGSNSTRLSINEVSDEGKYREVFRAKEMTRMAEGMGN
FT                   SEKKVLQADAIERTLDAVRKFQKHYENLPNLKIKGIATAAVRVAENKEEFLEKIKSLTG
FT                   VEVEILSGSAEAYYDYVGVANCLDVKDAVICDMGGGSFEVILMKNKKALNLISIQYGAV
FT                   SLTEKFQTQDKINAGNLFEFEVFLRELFAKKLPWLSEAKDLPLVLLGGANRTVARKKLD
FT                   KLDEKDTTNIHNFRVYKEEFQRIYRKWLDMDKTERATDLGDESSRADIIIGGLTPVMQL
FT                   MLQCESPYVMFSESGVREGIIFELLAEK"
FT   gene            274135..274860
FT                   /locus_tag="LSL_0220"
FT   CDS_pept        274135..274860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0220"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1131 [V] ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99035"
FT                   /db_xref="GOA:Q1WV82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV82"
FT                   /protein_id="ABD99035.1"
FT                   /translation="MKINNQRIQLQNIKKKFGNDNVLNSVNLTVNSGEIVGLIGPSGSG
FT                   KSTTIKILLGMEKADEGEALILEKRMPNRKLLADIGYMAQSDALYESMTARENLRFFGY
FT                   MKDVAKKELPKEIEYVAEVVDLTNYLDKKVSGYSGGMKRRLSLAIALLAKPKIIILDEP
FT                   TVGIDPALRLKIWKELAKLRDEGRSILVTTHVMSEAELTDRVALLFEGKIIAFDKPKKL
FT                   EDEYKVNNIEEVFLKVEGE"
FT   gene            274863..275975
FT                   /locus_tag="LSL_0221"
FT   CDS_pept        274863..275975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0221"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG0842 [V] ABC-type multidrug transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99036"
FT                   /db_xref="GOA:Q1WV81"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV81"
FT                   /protein_id="ABD99036.1"
FT                   /translation="MKTLVIAKKVVIELIRDKRTVLLMFVAPLLILCLLNLMFSASTKT
FT                   KVTIGTVDVNNQINRKMDQVDGTTVKKYESEKHAKKDLDANSLDGVISYKSKQYDVTYA
FT                   NLDVSKTVMTKKVLESALMKDNVSKLQSMVVKQGQVIAKLTGQQESVKMNKSKISIKNH
FT                   YNYGNSKTNFFDKMAPILIGFFVFFFVFLISGMALLKERISGTLERLLATPVKRSEIVY
FT                   GYMLGYGLMALAQASLITVVGIKLLDIEIIGSIFSVIIIAVLLGFVALAFGILLSTFAS
FT                   SEFQMMQFIPLVVVPQIFFSGIIPLDSMADWAQRIGKILPLTYAGEALSAIIMQGAGLI
FT                   DVGKDILVLIIFLVVLLILNILGLKRYRKV"
FT   gene            275988..276635
FT                   /locus_tag="LSL_0222"
FT   CDS_pept        275988..276635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0222"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99037"
FT                   /db_xref="GOA:Q1WV80"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV80"
FT                   /protein_id="ABD99037.1"
FT                   /translation="MENKTILEDYEEILGNKKLTNGQEKALLSVINLFAKQGYDATSTA
FT                   QIAKNAGISEATIFKYYSTKEKLLLEIINLITTELFPKFQRKFFSEVNEVSDKSLKEIV
FT                   TFIVINRFEFMKKNHQILRIFIQESLTKIKIRQMVSEGFVEAIKSNQEIFTEFRKLVGS
FT                   KHPDYDAIVLVRIITGPMIAYFLQRFIFAPNAPCDEKRDLDLIITQILSGLE"
FT   gene            complement(276778..277581)
FT                   /locus_tag="LSL_0223"
FT   CDS_pept        complement(276778..277581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0223"
FT                   /product="Amino acid ABC transporter, substrate binding
FT                   protein"
FT                   /note="COG0834 [ET] ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99038"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV79"
FT                   /protein_id="ABD99038.1"
FT                   /translation="MKKVLISILSGIILSLVILISAPTHISADTLKVGILADNKPYSYL
FT                   TNKKVTGFEVELSKKIAQEMDANIKFVKVSDRKKLQKLVSEHQIDLALGQFDKTTLSSK
FT                   LITTDTYLYPQNVLFTGTHRHISSIEDLQNKKVGILANGNQHQLLTSLQMKPKVYNSIS
FT                   SLMKALENKKIKAGILTDYEYTAYLNKHPELTSAYLQALNSTKKSDLPKLTLTRIKDPQ
FT                   ITSQQLVGITDKRNTKLNQALDKLKDGNDIIDLSQKYFSQDLTKP"
FT   gene            277661..278926
FT                   /locus_tag="LSL_0224"
FT   CDS_pept        277661..278926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0224"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase /
FT                   3-hydroxy-3-methylglutaryl-coenzyme Auctase"
FT                   /EC_number="1.1.1.34"
FT                   /EC_number="1.1.1.88"
FT                   /note="COG1257 [I] Hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99039"
FT                   /db_xref="GOA:Q1WV78"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV78"
FT                   /protein_id="ABD99039.1"
FT                   /translation="MEGFKKYYKKNWIERLEILKKQEILSQEDIDRLKSQAIDVSLGET
FT                   QIENFITQYLLPEGLALNYVINGKEYLIPMVTEEPSVIAASSHGAGIVKKSGGFKASVK
FT                   QRLMLGQVIVEKIEDVDKFEDDILKNEDELLEIANQAHPSIVRRGGGARWIRVRKLDKS
FT                   IVSIDLAVDVQEAMGANMLNTMLEAIAATIREKYEQDVVMSILSNYATECLATAICDIP
FT                   VASLTKNGMSGEKIAEKIAQASYIAQIDPYRATTHNKGIMNGIDGVVIASGNDWRAIEA
FT                   GAHAYAAKDGSYRGLSTWKVIGGTLHGEITLPLPLGSVGGSIGIVPLVKVNHKLLEIEN
FT                   AIELEKVVASVGLGQNLAALYALVTEGIQKGHMRLQLKSLVSSIGATEEEIPLVVSELE
FT                   KLNKRDMSTAKEILDNLRNEGK"
FT   gene            278926..279882
FT                   /locus_tag="LSL_0225"
FT   CDS_pept        278926..279882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0225"
FT                   /product="IpaB/EvcA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99040"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV77"
FT                   /protein_id="ABD99040.1"
FT                   /translation="MTEEINFSKATKSLMKKVEAIFPEGVGINVKKDFKLGYVRHDQAQ
FT                   QYLRGGQLMIDIYDMTRPDYTVAHELLHFLHMFNGAPQISFNLTTKKKDLDTKFMATGL
FT                   ELYDIVMHDYVYREQAELGMMTDEIKELYFKGVLSVLKPEQGERDQWMVLRILTLLDTL
FT                   LFFKDEQDSIKDKLMELYPISFEAAQRLYEILIERSLDSAFAIRRTVVKLFKAFDDELS
FT                   KLGMVPMNMTEFATLSVVLSERQMRLQVRQLFNIVHSPLDDNLTFKSAYVGQWKNDGQN
FT                   SFVLADPGKDSAKKFVEYYNMKVTDFLDSIGIEYLKR"
FT   gene            279986..282013
FT                   /gene="metG"
FT                   /locus_tag="LSL_0226"
FT   CDS_pept        279986..282013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="LSL_0226"
FT                   /product="Methionyl-tRNA synthetase / Protein secretion
FT                   chaperonin CsaA"
FT                   /EC_number="6.1.1.10"
FT                   /note="COG0143 [J] Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99041"
FT                   /db_xref="GOA:Q1WV76"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV76"
FT                   /protein_id="ABD99041.1"
FT                   /translation="MGEKPTFYITTPIYYPSGKLHIGNSYTTIACDVLARYKRLQGYDV
FT                   FFLTGTDEHGLKIEQKAQALGMQPQEYVDKMAADIKELWKKLEITNDKFIRTTDDYHEK
FT                   AVQNIFEKLLAKGDIYLGKYRGWYSVSDEEYFTESQLAEVYRDEDGNMIGGKAPSGHEV
FT                   QLVEEDCYFFKMSKYADRLVKYYEEHPDFIIPDTRKNEMLNNFIKPGLEDLALTRTSFN
FT                   WGVKVPSNPEHVVYVWIDALCNYITALGYETGDDDSLFKKYWPADVHMVGKEIVRFHTI
FT                   YWPIILMALDLPLPKHIIGHGWLLMRDGKMSKSKGNVVYPEMIVERYGLDALRYYLMIA
FT                   VPFGNDGVFTPEDFIGKINFDLANDLGNLLNRTVAMINKYRGGQIPELKSGVTAFDKDL
FT                   EDVAANTIKNFEEQMDSVHFSNALDEVWKLVARSNKYIDETEPWILAKDETKKDELDSV
FT                   LAHLAASLRLVAILIQPVMTHTPKEIFAQLGLNSDDMAIQGVSYFDLPAGAQVVAKGTP
FT                   IFPRLDVEEEQEYIKSKMTKNEKAKGRKAMAEKAKENWDPENTTLVLTKDEIKFDKFDK
FT                   VELKVAEIKEVSKVEGADKLLKFRLDAGDEGDRQILSGIAQWYPNPEELVGKKVIAVTN
FT                   LKPRKMRGEVSQGMLLSAEFGETVQLITVSENIPNGSLVG"
FT   gene            282147..282917
FT                   /gene="tatD"
FT                   /locus_tag="LSL_0227"
FT   CDS_pept        282147..282917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="LSL_0227"
FT                   /product="DNase, TatD family"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG0084 [L] Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99042"
FT                   /db_xref="GOA:Q1WV75"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV75"
FT                   /protein_id="ABD99042.1"
FT                   /translation="MEIFDSHTHINSHEFDNDIPDVIERAKALDVTEMLVIGYDDDSRK
FT                   KLQEIIQEYPHIYGAVGCHPEDALNYNAEYEQELRKYLELEKFVAVGEIGLDYYHDSPK
FT                   KVQHEVFEKQIALAQELNLPISVHNRDAFEDCYAILKNMNIQKNGGIMHSFNGDAIWAE
FT                   KFLDLGMELSYSGVVTFKSAKDVQESMMMTPLEHMLVETDAPYLTPMPYRNRMNEPAMT
FT                   RYTLEFIAEKRGISSEELAEITRKNTERVLKINE"
FT   gene            282928..283485
FT                   /locus_tag="LSL_0228"
FT   CDS_pept        282928..283485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0228"
FT                   /product="Ribonuclease M5"
FT                   /note="COG1658 [L] Small primase-like proteins (Toprim
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99043"
FT                   /db_xref="GOA:Q1WV74"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV74"
FT                   /protein_id="ABD99043.1"
FT                   /translation="MKIKEVIVVEGKDDTKRIQMAVNADTLETRGSAISDETLDQIEDL
FT                   YDKRGVIVFTDPDFSGEKIRKIITEAIPGVKHAFLTKHDAAPSHKGSLGVEHASPEAIR
FT                   EALAHLYTEVPDGEPLISREDLAVAGLTSGPQAKEYRRRLGEYLRIGYTNGKQLYKRLK
FT                   LFQITPDEFKKALEYIKNEDNY"
FT   gene            283497..284387
FT                   /gene="ksgA"
FT                   /locus_tag="LSL_0229"
FT   CDS_pept        283497..284387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="LSL_0229"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0030 [J] Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99044"
FT                   /db_xref="GOA:Q1WV73"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV73"
FT                   /protein_id="ABD99044.1"
FT                   /translation="MANELPEIANPTRTRAIMETYGLTFKKSLGQNFLTDINILKNIVA
FT                   AAEVSEEDNVIEIGPGIGALTEQLAKRANKVMALEIDDRLLPVLADTLSPYENVEVVHQ
FT                   DILKADLKALIAEHFEPGHKLKLVANLPYYITTPILMHLLDSGIEFETIVVMMQKEVAE
FT                   RLAANPGTKAYGSLSVAVQYEMDSEIAFIVPKTVFVPQPNVDSAIIVLNKKKVKPKEPQ
FT                   DEKHFKKLVKGSFMHRRKSLWNNLQSLYGKDPETKEKMLQALEVADIKQSIRAEKLTVA
FT                   DFINLSDALVKMGIN"
FT   gene            284475..284708
FT                   /locus_tag="LSL_0230"
FT   CDS_pept        284475..284708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0230"
FT                   /product="VEG protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99045"
FT                   /db_xref="GOA:Q1WV72"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV72"
FT                   /protein_id="ABD99045.1"
FT                   /translation="MPITITSIKAKLDGKIGEPLTITSRLGRKKSKTRHGVLRETFPSV
FT                   FIIELNHDENAVERVSYSYTDILTKNIELNFG"
FT   gene            284804..285652
FT                   /locus_tag="LSL_0231"
FT   CDS_pept        284804..285652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0231"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG4814 [R] Uncharacterized protein with an
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99046"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV71"
FT                   /protein_id="ABD99046.1"
FT                   /translation="MKKIILKIVLIILLVLVGFQITSLLPSKNKPLREDKLLNDINYSD
FT                   TPTLLIPGWAGNKWTYNRMIDTYQDENVAQKTMTIHVSPTGKVKVHGTVKNKKNAMIQV
FT                   LFDWNYTASYRPQTKWLTNVMLILHDKYHINKMNVIAHSWGGSAWLHALAGSSKLQKEI
FT                   KFSRVILLGVPVEESFDDISYKKAKKIHSTDGNYQKLVAQTKYLRLRAKIKFYNFLGEI
FT                   KNENTDGSVPHVQSEFLQKIVNPKWAYYSQMTFEDTSHSGLHSDEKVLKEIEQILWEKE
FT                   K"
FT   gene            285665..286783
FT                   /gene="avtA"
FT                   /locus_tag="LSL_0232"
FT   CDS_pept        285665..286783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="LSL_0232"
FT                   /product="aminotransferase"
FT                   /note="COG0436 [E] Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99047"
FT                   /db_xref="GOA:Q1WV70"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV70"
FT                   /protein_id="ABD99047.1"
FT                   /translation="MNLPEFGVEAWLNKWEKSAKYDISQSSIDSLTLEELIGLDGTKVE
FT                   DFFAQHSTDKLNYGWIEGSPEFKELVAELYQNMPADNILQTNGATGANMLSIYALVEAG
FT                   DEVISMIPSYQQLYDIPRSLGAKVKLLNLDEKKDWSFKIDELKELVTPKTKLICLNNAN
FT                   NPTGTVFDTDFMEEVVKIAKEVDAYILVDEVYMPLNKDRKFVSIVDMYDKGIATNSLSK
FT                   TFSLPGLRIGWTASNKEVADIFRKFRDYTVICGGVLNDALAVHALRNRDKILQRNEEIV
FT                   KNNLEIVENWLKTEPRVSWCTPHSVSTSFIKLDIPQDDYSFCEDLLREKGVLLVPGTAF
FT                   DRPQHARLGYCCNPKILQQGLEKLSEYLRKFD"
FT   gene            286827..287297
FT                   /gene="argR"
FT                   /locus_tag="LSL_0233"
FT   CDS_pept        286827..287297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="LSL_0233"
FT                   /product="Arginine repressor, argR"
FT                   /note="COG1438 [K] Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99048"
FT                   /db_xref="GOA:Q1WV69"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV69"
FT                   /protein_id="ABD99048.1"
FT                   /translation="MNRIARRELMEQLFADNKITTQEQLQQLLRSEGVEVTQATISRDM
FT                   RILNIVKVSDQNGNTYYKQMKVEGEKNYERLFQEINDNVLGIQRINFINLIRTTVNSSY
FT                   ANILAAKLDDLELAEIAGTLAGNDTVVVFSKNEEDAEIVYKMIYEHMDGDLK"
FT   gene            complement(287336..288205)
FT                   /gene="ispE"
FT                   /locus_tag="LSL_0234"
FT   CDS_pept        complement(287336..288205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="LSL_0234"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="COG1947 [I]
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99049"
FT                   /db_xref="GOA:Q1WV68"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV68"
FT                   /protein_id="ABD99049.1"
FT                   /translation="MEISEKAPAKLNLSLDTPFRHQDGEPEWRMVMTAIDLSDYVHIKT
FT                   IPNSKEITVQTNTGFLPCDQRNLAYQAAKLLQSKLDKPEGVEIEIDKHIPVSAGMGGGS
FT                   ADAAAVLRGLNKIWNLNMSREELAKLALTIDSDVPFCVYSEPALVTGRGEKITPIGPLP
FT                   PMWLVIAKPQASVSTPTILRQIHEQHLNHQEVQNVVSAIKQQDFDKMCRHMGNALEPIT
FT                   MKKCPDIIKIKDKMLQFGADAAQMSGSGPTVFGISQKKSRATHIYNSLRGFCKEVYLVR
FT                   ALDSLTTK"
FT   gene            288421..289728
FT                   /gene="amtB"
FT                   /locus_tag="LSL_0235"
FT   CDS_pept        288421..289728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="LSL_0235"
FT                   /product="Ammonium transporter"
FT                   /note="COG0004 [P] Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99050"
FT                   /db_xref="GOA:Q1WV67"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV67"
FT                   /protein_id="ABD99050.1"
FT                   /translation="MINQANTAFVLISTILVFFMTPGLAFFYGGLVSKKNVVNTMFSVF
FT                   VISGLAILLFVSVGYVICFGKDVSGMFGWGHNFFLSRYELTKMYSKSLGIDNGTYLVFQ
FT                   MMFSIITPALFVGAVVGRMRFNFLILFVSLWSIFVYYPMVHMVWSPNGLLGKIGMLDFA
FT                   GGTVVHINAGITALVLSIFLGPRIKYNIENSEHYNLPWVLLGTSILWIGWYGFNVGSAL
FT                   GIDKVAIQAFLTTTVSTGASLIAWMILDLKFHSKPSLVGICTGALCGLVGITPAAAYVS
FT                   TLGAIIIGVLCSIVSFIFVEKIKPKLKYDDPLDAFGCHGISGILGSILTGVFANKAINS
FT                   NISESGLLYGGVHLFLIQVLGTVCTIIFVIILSTILVVCCKKLVKMRVTSEEELIGLDK
FT                   VEHNEKVDSYVKSDASDVRKYRAEFRGQLSKFEKRR"
FT   gene            complement(289941..291086)
FT                   /gene="xerC"
FT                   /locus_tag="LSL_0236"
FT   CDS_pept        complement(289941..291086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="LSL_0236"
FT                   /product="Phage integrase"
FT                   /note="COG0582 [L] Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99051"
FT                   /db_xref="GOA:A0JQA1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA1"
FT                   /protein_id="ABD99051.1"
FT                   /translation="MATFRKYKTKKGMLWRYQILVGTDTVTGKRKYKTKGGFYTKKEAK
FT                   LAADEIEKKISNPTFLDNENITFGEVYDRWIVNYKLTVKESSFYTVELQYKSKILPILG
FT                   NKKINQITTIECQDLINYWYSIPLKNYKAIFNLITRIFKYAKQLKIVTDDPTSSVIIPK
FT                   ASRQFNNLEHSRNYYTRDELKTFLEYAEKHEKHKIYVLFRLLAFSGMRKSEALALTWND
FT                   IDFEKAQITINKTIILVSKVKVTTPKTKSSNRTVFIDKKTVSILREWRLSQKKELLQKG
FT                   FNALSPNQLVFPDKNNHYIIPTTISKMMNRVSEGSNLHHITVHGLRHTYATLAAQGGMS
FT                   VKQLQAQLGHSKVEITLDVYTSITDEQRKDTANQYTSFVNF"
FT   gene            complement(291235..291630)
FT                   /locus_tag="LSL_0237"
FT   CDS_pept        complement(291235..291630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0237"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99052"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA2"
FT                   /protein_id="ABD99052.1"
FT                   /translation="MRKRYLSKRIIKNQYRFLWENGIQKSIRYKQLAKRDKEYLNQINN
FT                   IFKTESDIVHFKNKRSSTAIYLEEIIKTDIKFNQNILKQRINSIHVFCIDLLPRILKID
FT                   FNQFSMNQKIEYTNLVNYLKPKPFKNN"
FT   gene            complement(291510..291944)
FT                   /locus_tag="LSL_0238"
FT   CDS_pept        complement(291510..291944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0238"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99053"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA3"
FT                   /protein_id="ABD99053.1"
FT                   /translation="MNYIDEINEYRVFCKKYYPYSGSNSFLNDKNNRIFLLHLFQLINL
FT                   FEIYTDYDVSDNKHLEQISKMILTILLDLLLAIPTNNDLFVSICIRQLSEKLLDLVYSE
FT                   FCEKDISQKELLKISIVFYGKMVYKSLLDISNLQNVTKNT"
FT   gene            complement(291941..292384)
FT                   /locus_tag="LSL_0239"
FT   CDS_pept        complement(291941..292384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0239"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99054"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA4"
FT                   /protein_id="ABD99054.1"
FT                   /translation="MNDAEILKKILKKLSLKISKNESISLLYALYTTILLSKELFKFNV
FT                   DIKNFLVPIFNKLQSQPEFSKQRKPLEFGDYVYRSRSLIIARFIRIIQKSEDKSIDILI
FT                   SAAQELVDSKYNNVSKKTPTTEKKKKSHKNSVDELLKIFGRYQ"
FT   gene            complement(292377..293300)
FT                   /locus_tag="LSL_0240"
FT   CDS_pept        complement(292377..293300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0240"
FT                   /product="cII-like protein, phage associated"
FT                   /note="COG0455 [D] ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99055"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA5"
FT                   /protein_id="ABD99055.1"
FT                   /translation="MSDEGKVISFINMKGGVGKTTLTKEIGYHLATVKNLKVLLVDVDP
FT                   QINLTQSVFRKFGFAPSESIAHSMEKSEETGSYRNIKVTKASIQNILNGNISNQNPTSD
FT                   YTKAIVDIPNTNLSIIPDEFGLDFTNRNLNGGQLENGLYNFIYKNNLKNKFDYILIDCP
FT                   PTYSSYTISALKPSDYYIIPVRPEAYSILGVNMLEEVIKQIKNENEVYFRDRSLRNLGI
FT                   ILSGVKENARKGIENLIEDIVSSSVLKDNNIEIFKNRFLYNPSLQSNMAYFITDGRAEK
FT                   ISKPNLNDLTNELLSRIKHMEGEKNE"
FT   gene            complement(293385..293603)
FT                   /locus_tag="LSL_0241"
FT   CDS_pept        complement(293385..293603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0241"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99056"
FT                   /db_xref="GOA:A0JQA6"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA6"
FT                   /protein_id="ABD99056.1"
FT                   /translation="MRRYFHSLHNFMLFCLGTLFTLSIIDGFLSAFLPNSPAIIFFDKF
FT                   LSTGISPLLIFCFGVAIGEIDKKDKFK"
FT   gene            complement(293709..294485)
FT                   /locus_tag="LSL_0242"
FT   CDS_pept        complement(293709..294485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0242"
FT                   /product="cI-like repressor, phage associated"
FT                   /note="COG0640 [K] Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99057"
FT                   /db_xref="GOA:A0JQA7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA7"
FT                   /protein_id="ABD99057.1"
FT                   /translation="MPRTELTPQDKEYKKVISATLNELLQLSGKKQIDITRQTGIPAST
FT                   LTGYFKGTRLPSPVNVQKLADFFNVLKSDVDPRFKKISESDTDGLRIRLLSKYEKLNTE
FT                   NKKKVVDYADNKLKDQKRQQNKIHPINENDNTYYVDVLGSVSAGTGEWLTDEQHEEVMV
FT                   NNEPPAHDFALRVNGDSMTPIFSDGQIIYVNKIYDTEEVRNNQFVIAELNGDSYVKKIV
FT                   FDDNRKNCRLISLNKKYADIEIKKSDDFKIVGVVII"
FT   gene            294545..294694
FT                   /locus_tag="LSL_0243"
FT   CDS_pept        294545..294694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0243"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA8"
FT                   /protein_id="ABD99058.1"
FT                   /translation="MKKTAKKNEKIVEIRINEYYNIHVRLIRALRKLKKGESYEECTKK
FT                   EETN"
FT   gene            295016..295222
FT                   /locus_tag="LSL_0244"
FT   CDS_pept        295016..295222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0244"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQA9"
FT                   /protein_id="ABD99059.1"
FT                   /translation="MKIVIQTTKGTIESPEFPEIVREPLKEKIDKLADDLMDSWFNHSV
FT                   YFRVDGWACILNKKEFISITLTD"
FT   gene            295260..295475
FT                   /locus_tag="LSL_0245"
FT   CDS_pept        295260..295475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0245"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99060"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB0"
FT                   /protein_id="ABD99060.1"
FT                   /translation="MKKETAREYYLKQFKHENDKVSDLFGSDIDKVGTEIVNLLKEKDL
FT                   THEQAYASLQYAYNLIKYESNFLKLQ"
FT   gene            complement(295477..296082)
FT                   /locus_tag="LSL_0246"
FT   CDS_pept        complement(295477..296082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0246"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99061"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB1"
FT                   /protein_id="ABD99061.1"
FT                   /translation="MRTRSRLVLLSSLHDSTQFIAPGQIKIKYLKNKKETYQDLPAGIL
FT                   VHLSFLNPSPHDIAFFQLGFHTQDKVIEAYTQKSVSYLSADNLNFIYTFPNSGYMADLN
FT                   MPLRPYGIFKANSYVAFDFFMPIRVDDDRLPKCVTFKIRYAVSKFPYFGKKSRFKTCKL
FT                   KIDTSTYFETIQELQKQVQQLTKTKLNYPSKSPHHLKK"
FT   gene            296306..296497
FT                   /locus_tag="LSL_0247"
FT   CDS_pept        296306..296497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0247"
FT                   /product="Dna binding protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99062"
FT                   /db_xref="GOA:A0JQB2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB2"
FT                   /protein_id="ABD99062.1"
FT                   /translation="MWDQLEELLKSKNITRYKLSKLTGIGQTTLQSYKDGVEPSFKNMC
FT                   KIADALDVSLDYFRKRDD"
FT   gene            296500..296640
FT                   /locus_tag="LSL_0248"
FT   CDS_pept        296500..296640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0248"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB3"
FT                   /protein_id="ABD99063.1"
FT                   /translation="MKEDITDLISTSINELKNASQKEDIIVESKIINTIISLCEAYKNI
FT                   I"
FT   gene            complement(296633..296806)
FT                   /locus_tag="LSL_0249"
FT   CDS_pept        complement(296633..296806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0249"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99064"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB4"
FT                   /protein_id="ABD99064.1"
FT                   /translation="MNNMLSNEQIAHDLAIAFVSAKLSKETYISSDISVITAYEDAYSD
FT                   FLRLLNKIRTVR"
FT   gene            296879..297070
FT                   /gene="cro"
FT                   /locus_tag="LSL_0250"
FT   CDS_pept        296879..297070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cro"
FT                   /locus_tag="LSL_0250"
FT                   /product="Cro-like protein, phage associated"
FT                   /note="COG0640 [K] Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99065"
FT                   /db_xref="GOA:A0JQB5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB5"
FT                   /protein_id="ABD99065.1"
FT                   /translation="MPKITLKAARVNAGLTQKEAAKKIGISYQTLSDYEKDESKIKLSM
FT                   IRKMCSVYNMPIDCIFLK"
FT   gene            297109..297837
FT                   /locus_tag="LSL_0251"
FT   CDS_pept        297109..297837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0251"
FT                   /product="Phage antirepressor protein"
FT                   /note="COG3645 [S] Uncharacterized phage-encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99066"
FT                   /db_xref="GOA:A0JQB6"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB6"
FT                   /protein_id="ABD99066.1"
FT                   /translation="MNELIKVKTKEDVQVVSARELHETLGVKTRFSLWVKQNFKHFREN
FT                   IDFSSVVTTTHQNQYGGTKEIQDYALTIEMAKHIAMMSGTDKGYEIRDYFIKVEQAWNS
FT                   PEMVMKRALEIANKKVEKLKLENQQMQPKALFADSVAASHTTILIGELAKILRGNGINI
FT                   GANRLFQWMRDQGYLISRKGTDYNMPTQRSMNLGLFKIKESTITHSNGSVSISKTTKVT
FT                   GKGQQYFINKFMKMNETAIG"
FT   gene            297864..298049
FT                   /locus_tag="LSL_0252"
FT   CDS_pept        297864..298049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0252"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99067"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB7"
FT                   /protein_id="ABD99067.1"
FT                   /translation="MIVTATYKYDLSDDDIERIAERVVRKLEINSNKQKQLNTVVYLHK
FT                   HFGDGEKGIKIFRISN"
FT   gene            298348..298527
FT                   /locus_tag="LSL_0253"
FT   CDS_pept        298348..298527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0253"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99068"
FT                   /db_xref="GOA:A0JQB8"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB8"
FT                   /protein_id="ABD99068.1"
FT                   /translation="MNSTGKGFINLSSLAAIFFSGLSFGMGHLYIGSGFVAWFVLSLVA
FT                   LTEIRKDEEAKEND"
FT   gene            298520..298657
FT                   /locus_tag="LSL_0254"
FT   CDS_pept        298520..298657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0254"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99069"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQB9"
FT                   /protein_id="ABD99069.1"
FT                   /translation="MISLSMLVVGILVGLMLYPMVEAIEDGTFFDWGDENEEVRTHERR
FT                   "
FT   gene            298644..298880
FT                   /locus_tag="LSL_0255"
FT   CDS_pept        298644..298880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0255"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99070"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC0"
FT                   /protein_id="ABD99070.1"
FT                   /translation="MKEGKKVVEIKKIGAATPISMSSDYQKEIIRNITNLKNMESIQLY
FT                   IHINILFTVPHLEQEQYEFLKKLESIYGRYDDG"
FT   gene            298873..299589
FT                   /locus_tag="LSL_0256"
FT   CDS_pept        298873..299589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0256"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99071"
FT                   /db_xref="InterPro:IPR041242"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC1"
FT                   /protein_id="ABD99071.1"
FT                   /translation="MDNFEFKFDRIVGSKVQFEVDDLDAFKKELRKGHLKFNASPADHN
FT                   MISNAQRKKIYALFRDISDYTGYEEQEVKNRLKLQFSYNTGYGNFSLSNCTKELATQFI
FT                   RFVIEFCFRYDIPFDSKVMENTIDAERRVFLCLVHRQCTVCGSRQGLQINHEDTVGMGN
FT                   NRNHIDHRNHRLEMLCFKHHSEFHNIGAKAFADKYHFHGIKLSDKSILSLKLMSQKQMD
FT                   EFDEEYKRQKELNRNG"
FT   gene            299582..300565
FT                   /locus_tag="LSL_0257"
FT   CDS_pept        299582..300565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0257"
FT                   /product="Replisome organizer, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99072"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC2"
FT                   /protein_id="ABD99072.1"
FT                   /translation="MAEKRYFWIKLQMDFWKSPVVKMLRKPSGGDTYAVIYLEMILLSL
FT                   ENNGYIYYSGVGDSFAEEIALVLDEETINVEFVLAFLKQKRLIEFSDDTSFKFTEDVTA
FT                   DLVGSESASAHRVRAYRKRQKTIASEQKTLQCNINETNRNLDIDIDKEKDIDNNIRSFS
FT                   DENDQVNSQNKQPKEQPKSSSNKQHKPTKKELDERFESLWALYPRKVGKQKARKYYERA
FT                   VKNGTSDEIIKKGIESYNKEIRVQGTQTNFIQHGATWFGNAGWENEYNFEPPKRNNTQR
FT                   QLIQKEKLPDWAKNAGKKQPSNSIMSRTEKAKNEAEINELLRRLSQ"
FT   gene            300562..300765
FT                   /locus_tag="LSL_0258"
FT   CDS_pept        300562..300765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0258"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99073"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC3"
FT                   /protein_id="ABD99073.1"
FT                   /translation="MKKRIAEFKDAKGQFVKRYDKLVDKDGIQYMVSEHHDRYLVLVSL
FT                   SDVRPPMPVIPSDLKNDYVKVG"
FT   gene            300769..301035
FT                   /locus_tag="LSL_0259"
FT   CDS_pept        300769..301035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0259"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99074"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC4"
FT                   /protein_id="ABD99074.1"
FT                   /translation="MERKIIDEWPIDAKYTAVKFSDDTYGLKQFIANKGDLFEDDLVVL
FT                   YSPKIDSMRCFETSEHLAEIRKFVEFLDDVVVKEGMENGKSKD"
FT   gene            301016..301432
FT                   /locus_tag="LSL_0260"
FT   CDS_pept        301016..301432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0260"
FT                   /product="Replication terminator protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99075"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC5"
FT                   /protein_id="ABD99075.1"
FT                   /translation="MAKVKINFSIDSLAEGAGKELIERELSDIFNNINDPNADPTKKRS
FT                   LIVKVDFVPDADYDEVKASINVSSKLAPAAPVTTKIMTGRDLNTGMIAASELKSGVKGQ
FT                   TYIDEQGDVRTDTGEKVEDIEKKSKIIDLQEKRG"
FT   gene            301437..302165
FT                   /locus_tag="LSL_0261"
FT   CDS_pept        301437..302165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0261"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99076"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC6"
FT                   /protein_id="ABD99076.1"
FT                   /translation="MDLTKEALDYLTERGIRPEERKLKINGQEYIIDKNGEPVLVEPVI
FT                   YKAKEPIRLNTLSGLVDYIKSNIDGFDDLILHVVDEKLVELKGKLQPNGDRELLAVATA
FT                   IVPEFDFDSCMDIESFNIALQSQFVKTDDRDILLKVVGNLKEDNVRSTGDDGISQAVTI
FT                   KSGIATAENIKVPNPVILAPYRTFVEVEQPESKFIFRMQSGPRGAIFEGDGGLWRVEAI
FT                   KTIAKFLEKRLEGTGVVLLA"
FT   gene            302158..302382
FT                   /locus_tag="LSL_0262"
FT   CDS_pept        302158..302382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0262"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99077"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC7"
FT                   /protein_id="ABD99077.1"
FT                   /translation="MLNFSKCKNSLLGVMQMEATYIVYDDKERILTVGTAKEIAEYLGI
FT                   GITSVYTLSSDLKRGVINPKIKIYSVRGI"
FT   gene            302384..302581
FT                   /locus_tag="LSL_0263"
FT   CDS_pept        302384..302581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0263"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99078"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC8"
FT                   /protein_id="ABD99078.1"
FT                   /translation="MDIEFIGYVIKLGNYYFGGRTQNSISIHKKPQQAEIYSDDELGIA
FT                   ERVASDLGGTIRKIYVSDKE"
FT   gene            302587..302916
FT                   /locus_tag="LSL_0264"
FT   CDS_pept        302587..302916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0264"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99079"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQC9"
FT                   /protein_id="ABD99079.1"
FT                   /translation="MNENKKTKALVEELENEFPNIYDRINYGLYVFVIDENGKIYDDES
FT                   EPDFNEDDIEEVQVIYNGDAVSVFPNFIGKCTFKANTVKYENLDVITRVIGIIGKHFKN
FT                   WKELN"
FT   gene            302917..303093
FT                   /locus_tag="LSL_0265"
FT   CDS_pept        302917..303093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0265"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99080"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD0"
FT                   /protein_id="ABD99080.1"
FT                   /translation="MIRKQSPRQKIRNRARYWDSDYLAGFIKGLKIRQEYEYQRGMRDL
FT                   YKKVVKKHGLDDD"
FT   gene            303160..303522
FT                   /locus_tag="LSL_0266"
FT   CDS_pept        303160..303522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0266"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99081"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD1"
FT                   /protein_id="ABD99081.1"
FT                   /translation="MNENIMAMVAELESNFPIKWEQHDKIKDLHFKIYDDRGYKFGIDK
FT                   EFNEKRFDYMRFYYKGEKGEIYTLDETECIVRIPDKMSWEEFRGIGAILSITSKYMNSI
FT                   KFNKMSELARVWKYDK"
FT   gene            303512..303745
FT                   /locus_tag="LSL_0267"
FT   CDS_pept        303512..303745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0267"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD2"
FT                   /protein_id="ABD99082.1"
FT                   /translation="MINKIFVVTGTRYSTDVEIWHTRTDLFHNIIGIYSTKKHADEIAE
FT                   QIGRSRESNYFPESIDVEEYELIEGTYYLQDE"
FT   gene            303759..303986
FT                   /locus_tag="LSL_0268"
FT   CDS_pept        303759..303986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0268"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99083"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD3"
FT                   /protein_id="ABD99083.1"
FT                   /translation="MIEELTKEQKQAKLAEWSCKMDVLTVMLNAIEDDLENRLSNQFKF
FT                   REFNEFKDEFSNLVFEFNQLDLKLKLTQMH"
FT   gene            304471..304713
FT                   /locus_tag="LSL_0270"
FT   CDS_pept        304471..304713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0270"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99084"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD4"
FT                   /protein_id="ABD99084.1"
FT                   /translation="MAKKYKIEFTDDDMENMKLYIDGEEKLINFLKLTYHIDESYKKDT
FT                   KKVVLRYLEPNTYEVKFDVLGNQLGLLDIVPSDFD"
FT   gene            304728..305168
FT                   /locus_tag="LSL_0271"
FT   CDS_pept        304728..305168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0271"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99085"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD5"
FT                   /protein_id="ABD99085.1"
FT                   /translation="MKYLGTNEAMPAKVGSYKGYRYFIIPSLFGALNGYIELPKSWKDG
FT                   DEDELTVHGGVTFKGYVRDGASKVKVIGFDTLHAFDDQETRDLKSIEKECKYMIDEMIE
FT                   VMAKHRPLRANTEITLELADELGKLAAKQGLSFDELGYLHKK"
FT   gene            305179..305460
FT                   /locus_tag="LSL_0272"
FT   CDS_pept        305179..305460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0272"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99086"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD6"
FT                   /protein_id="ABD99086.1"
FT                   /translation="MGKAYFNVEDIYGNRHREVETIREMDNTVLVFDIDDHETYTIRKE
FT                   DVGMKLNRPAIRREKFNLSQNKRIWRNHQKELKDIRYKYARKVYSGIE"
FT   gene            305478..305660
FT                   /locus_tag="LSL_0273"
FT   CDS_pept        305478..305660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0273"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99087"
FT                   /db_xref="GOA:A0JQD7"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD7"
FT                   /protein_id="ABD99087.1"
FT                   /translation="MLLNGYIARGIMTICLIYIASSYTFVIFNDKDNYENSKDIVGIIG
FT                   VIVVSVAFLLLFLGK"
FT   gene            305735..306175
FT                   /locus_tag="LSL_0274"
FT   CDS_pept        305735..306175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0274"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99088"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD8"
FT                   /protein_id="ABD99088.1"
FT                   /translation="MEELMIPGMKNIDYDKTADNVARFLTDKRYYPRLCKIYQQASPEF
FT                   IQSPSLSGMPGGSIGNSNEEKLVKYLYAKSIVDGVADTYDKGSVELKVVLDNTLGKISA
FT                   VEAMIKLHFENTRYYQVKKRALNEFADGLEMKVNCPDLHVYC"
FT   gene            306272..306517
FT                   /locus_tag="LSL_0275"
FT   CDS_pept        306272..306517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0275"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99089"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQD9"
FT                   /protein_id="ABD99089.1"
FT                   /translation="MYKMIKFIGSEVTKSTQKINNSILMFNSVVFDRKNISFSSKYKVP
FT                   KDDKSSIREDYKRIGKDIYKVLNNYEQRNQKRLAEQ"
FT   gene            306504..306944
FT                   /locus_tag="LSL_0276"
FT   CDS_pept        306504..306944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0276"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99090"
FT                   /db_xref="GOA:A0JQE0"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE0"
FT                   /protein_id="ABD99090.1"
FT                   /translation="MQSSKVNVDEVIDSVKKLPREEQEMAISKLEMYSGPIPHPDILEK
FT                   YDELDPGAAKLIIENGVKESEHRRKLEVQAMNYTAKDSKRREWMGFFLGIIIILVGALL
FT                   IYLGHTITGTVLSGISAVSLVSLFVGNSSEEDKSEKKEDKNS"
FT   gene            307201..307863
FT                   /locus_tag="LSL_0277"
FT   CDS_pept        307201..307863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0277"
FT                   /product="DNA packaging, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99091"
FT                   /db_xref="GOA:A0JQE1"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE1"
FT                   /protein_id="ABD99091.1"
FT                   /translation="MARLLYYICEVKFIVINKTLKLLIAVITVVGYTLMVVNKVNIGYM
FT                   IIGLLVIVLISFLLVPEIKQISTKYFSLSKKVNEAMVQYKEFKETVYPILQIELANISS
FT                   VGYMDAGPKSNELVEFLEKIKKIKINDDRINNLIVVAKSQVLLAFKTELAYYNSKAKGF
FT                   ISTGLKPYYSDDYIDKDSIFVDFKGLENLIDEIEDIKTKGKYQTKLHKLKQFYNENF"
FT   gene            307904..308056
FT                   /locus_tag="LSL_0278"
FT   CDS_pept        307904..308056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0278"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99092"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE2"
FT                   /protein_id="ABD99092.1"
FT                   /translation="MKDSKDFGKVQTYEELRMLRELEKHYKKHPVKRKRKYSRDISKIK
FT                   LKGGG"
FT   gene            308058..308588
FT                   /gene="mcrA"
FT                   /locus_tag="LSL_0279"
FT   CDS_pept        308058..308588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="LSL_0279"
FT                   /product="Phage endonuclease"
FT                   /note="COG1403 [V] Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99093"
FT                   /db_xref="GOA:A0JQE3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE3"
FT                   /protein_id="ABD99093.1"
FT                   /translation="MPRVRRCRYKDCHAMVELPDHYCQQHYSCEADYLANRQKWARSRS
FT                   RSYQHRYNTVTRNRNSNKSEQYNFYRSKQWVNLRQLVLNRDYYLCQYCKVINKITSAKT
FT                   VDHIVPIEYYTDLRADTGNLATICSKCHRLKTDWERWYYGTGKDNQLKQVPKITNISEI
FT                   VLEMNRLAKTSLK"
FT   gene            308767..309240
FT                   /locus_tag="LSL_0280"
FT   CDS_pept        308767..309240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0280"
FT                   /product="Phage Terminase Small Subunit"
FT                   /note="COG3728 [L] Phage terminase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99094"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE4"
FT                   /protein_id="ABD99094.1"
FT                   /translation="MVKKVFYQQNDGSLSGTPPKHLGTVAKACWRKIVPFLESTERVKR
FT                   IDTALVELYCSQYEIYRQAYDDVLENGIQTKIFKSLQDASGSIVGKDFVGYRKNPAVAT
FT                   MKDASVQITSIGSQLGLSPKARAELMQLADSKGKEDSKEDSTEKLAKIFGGES"
FT   gene            309240..311123
FT                   /locus_tag="LSL_0281"
FT   CDS_pept        309240..311123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0281"
FT                   /product="Terminase large subunit"
FT                   /note="COG4626 [R] Phage terminase-like protein, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99095"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE5"
FT                   /protein_id="ABD99095.1"
FT                   /translation="MEVDLTQTHDVLGTYHSIDFSDIRKKYQDEGTRYAFKVLDEEIET
FT                   GYLIKLACFRHLRDLQRQNTKDFPYRYSVKQAKRLLLFASMCPNVDTESPTELMDWQKF
FT                   IFCMLFGWRNLEGRKRFSRAMVSVARGQGKTYLMAILMCYSYFIESLGLSNQDYLVSSI
FT                   NFKQTNKIFGYIKTMMKHIVKTDMFKDYAATVGFKAQNDQIVMKEKNNVLRAISHESGQ
FT                   YDSYHFTTAIFDEIGEVKSREKISKIISGQVKVPNHQFIQISTSYPDPSVPFHEDQKMM
FT                   QQAMEQDYKRDADNFLGLIWAQDSLDETFKPETWYKSNPLLYLDGQKQVLMEGLQDKRD
FT                   ADMLSGNVADFQNKNLNLWLAEATNSFLKLSDIERAIQPNFNIEGRTVYIGYDYSMFSD
FT                   NTAIAFVYPYSANHGVPKWRVEQHSFIPWQHACSIEAKEKQDGINYRELAKQGYCTITS
FT                   HPQGLINEEQVYHWLLNYIHDNDLNVIFFGYDDWGATTTIKQLELNTDYPLQGIRQRTS
FT                   ELKDPTKFLQKCFIEGTITRPDDKIMEKALMNAQIYEDKIGIQVDKAKATLKIDVVDAI
FT                   IDAMYQAMYHFEDFGIANDKSRQVELMTTKQVEDWYMSDESGLLGGDFDDF"
FT   gene            311113..311307
FT                   /locus_tag="LSL_0282"
FT   CDS_pept        311113..311307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0282"
FT                   /product="Phage head-tail joining protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99096"
FT                   /db_xref="GOA:A0JQE6"
FT                   /db_xref="InterPro:IPR009406"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE6"
FT                   /protein_id="ABD99096.1"
FT                   /translation="MIFRRIIGYLWQLSDVLLFISAMIVLDYTAFRINATLGWFVISLI
FT                   LFVLGWLVEVISERKRGDS"
FT   gene            311307..312482
FT                   /locus_tag="LSL_0283"
FT   CDS_pept        311307..312482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0283"
FT                   /product="Portal protein"
FT                   /note="COG4672 [S] Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99097"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE7"
FT                   /protein_id="ABD99097.1"
FT                   /translation="MPIFNINNALKTSTMSVPFGFGDEEVFNVLTGKDSDTYISAKEAL
FT                   KNSDIYSAIFQLSGDLASSRIISSKTRYQGIIDNPTLTSNKHAFWQAIFAQLLLGGEAF
FT                   IYRWRNVNGIDNHWEYLRPSQVSAYLLDDGSGLIYNITFDEPKIGVKMNVPQNDVLHFR
FT                   LLSKNGGMTGISPLSALSNELNIKNDSNKLTRAALSQSIMAPGILKITKEGKVNWKIKA
FT                   MRAKEFMRQTQVANNGPVVIDDLEEYSPLEIKSDIAKLLAQADWTGNQIAKVYGIPNSY
FT                   LNGQGDQQSSLDQIKGMYANALSRYMESIVSELNNKLSATIHYNIRPAIDPLQDSYAQV
FT                   LSGLTKDGMLAHNQARYLLQGTGYLPDDLPEPQSALLNPPKGGDANGKDTD"
FT   gene            312463..313182
FT                   /gene="clpP"
FT                   /locus_tag="LSL_0284"
FT   CDS_pept        312463..313182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="LSL_0284"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG0740 [OU] Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99098"
FT                   /db_xref="GOA:A0JQE8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE8"
FT                   /protein_id="ABD99098.1"
FT                   /translation="MVKIPIRGAIVDDDTAMFYDYFGMTCTSPKKVSAILNEEVAEGDD
FT                   IVVDIASNGGDVFVASEIYSMLKNNASNVKVNVTGLAASAASVIAMAGDTVSIAPTAQI
FT                   MIHKAWTNMDGNADDLNHEAGVLNNIDKSIASAYELKTGMKQSDLLQMMSNETWLTAQD
FT                   AVDKGFADEIMFVNEDEQPVMNSMEDIPSKSAINKLMNLILKADKQQNKTTSQFENPSL
FT                   KDKKLAILMGRRKNNEY"
FT   gene            313172..314368
FT                   /locus_tag="LSL_0285"
FT   CDS_pept        313172..314368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0285"
FT                   /product="Major head protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99099"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQE9"
FT                   /protein_id="ABD99099.1"
FT                   /translation="MNINELNNAWIESGQKVADLNMQINAALIDDNYDEEKFANLKAQR
FT                   DKEVTRRDNLKEQLDTARAEEVYNMPDKDKKPLSDSEKNLKDKFVENFVGMMNGNSKIV
FT                   DMVTSSVDDNGDKAGLTIPSDVQTAIHQLVRQFNSLEQYVNREAVSMPTGSRVYEKWTD
FT                   VTPLANLDDETAEIGDNDDPKLTLIKFAIKRYAGITTVTNTLLKDTAENILAWLSAWIA
FT                   KKVVVTRNKAIIDVMSAVPKKPTITDFDGVIDLVNTGVDPAIKTTSFLMTNTSGLNTLS
FT                   KVKDAMGRYLLQHDPTQPDVYMIKGKRVIEIADRWLPDNAGSHPLYYGDLKQAVTLFDR
FT                   ENMSLLSTNIGDGAFKRDLTKVRVIDRFDVVATDSEAWVAGSFKTIKDQEAKLATNNA"
FT   gene            314380..314703
FT                   /locus_tag="LSL_0286"
FT   CDS_pept        314380..314703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0286"
FT                   /product="DNA packaging, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99100"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF0"
FT                   /protein_id="ABD99100.1"
FT                   /translation="MDKEILLDDLKLSLRIDGDDDDRLLNSYINAAEVYIKTAVGGDDG
FT                   FWQQEDVIAVQKIAILALAGAYYDYRVALQDVMTYPINLTLNAIISQLRGKLALYEEGD
FT                   NDA"
FT   gene            314696..315052
FT                   /locus_tag="LSL_0287"
FT   CDS_pept        314696..315052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0287"
FT                   /product="Phage head-tail joining protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99101"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF1"
FT                   /protein_id="ABD99101.1"
FT                   /translation="MPKKLLHSSFNQRIEFQTVSFAANDLTGDTVEKPVSLFKCWCAPQ
FT                   RRTMSQQFQLTGLGLDDTLTVAIRHNDKVQGSTLAKYRNETYEVVSISPDDTNNYMAYD
FT                   YVVIRKKKGSMKNG"
FT   gene            315045..315437
FT                   /locus_tag="LSL_0288"
FT   CDS_pept        315045..315437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0288"
FT                   /product="Phage head-tail joining protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99102"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF2"
FT                   /protein_id="ABD99102.1"
FT                   /translation="MDDFINQLQNYSDNLDSLVPSIEQKQRITQAGAKVLEKNLQEVTP
FT                   VSKLNRKKDKHLKEYVMSQDTNVDGQEDGSSTVGFGKKAYIARFLNDGTVKMPATHFVD
FT                   NAVNESKKEVLLANKAEYDKIMRGGK"
FT   gene            315437..315814
FT                   /locus_tag="LSL_0289"
FT   CDS_pept        315437..315814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0289"
FT                   /product="Phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99103"
FT                   /db_xref="InterPro:IPR008524"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF3"
FT                   /protein_id="ABD99103.1"
FT                   /translation="METPTTIAKKLMKDITWIDELYSGSIPSNVEVNTNKNTVLITEYL
FT                   NEPSQYANMEIKYWLVGVEVQIFYKLDGEDFQNCEIQVARLFNDNRWKIDTSRNRIKDP
FT                   DTKQWTKVFYFSKNLEMEEGI"
FT   gene            315816..316520
FT                   /locus_tag="LSL_0290"
FT   CDS_pept        315816..316520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0290"
FT                   /product="Phage major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99104"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF4"
FT                   /protein_id="ABD99104.1"
FT                   /translation="MAKSSTHGVRYIGLATIDDSGVLLKGQSGLSDNGIYIIDGKGEGT
FT                   ITANITGLEQAGTPVYANNQVKLIQHGKQQPQVALTVLNMNNDVLNKIKGYVSDGKGGY
FT                   VLSSGDKPNVALLLCSEDVDGTLIYEGFSHGEVTETGRNHGTDNNNLTRADATLTFQAL
FT                   EPLKADIFMDDKGVQQPYKVWADDEPGFDLNLMYKEVFGGFSDVQSLRIPKKFKTTTVT
FT                   QTSASPTSVTAQ"
FT   gene            316570..316968
FT                   /locus_tag="LSL_0291"
FT   CDS_pept        316570..316968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0291"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99105"
FT                   /db_xref="InterPro:IPR009681"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF5"
FT                   /protein_id="ABD99105.1"
FT                   /translation="MSIRINTKPLGLKKPIFVEQSVKNVKLANEMMNKMLKLGIEQEKV
FT                   VAINFDELEEKETTEKMLEINTLEASYIDDAFVFLQNILKLSSKEKELAESTLTMEKLG
FT                   EYLNYVVMRVKGIKGKPETISEKDPKKD"
FT   gene            316971..317177
FT                   /locus_tag="LSL_0292"
FT   CDS_pept        316971..317177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0292"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99106"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF6"
FT                   /protein_id="ABD99106.1"
FT                   /translation="MLSDEYYKNKDEQADLLFLQKTLLLESGIPVSVSDKEDFQLLVEV
FT                   INAKAKEDREVSPREMLRRFRGQ"
FT   gene            317225..317638
FT                   /locus_tag="LSL_0293"
FT   CDS_pept        317225..317638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0293"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99107"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF7"
FT                   /protein_id="ABD99107.1"
FT                   /translation="MTKTDVTRKDIRYFIFHKHFRCGNVYFNDKLQKILIVSFFLKNCK
FT                   MYDYSDLKYGRIYLNEQSRKIYHARGLSSVPEEEKYYYNPKMVLEFRDGFTYEEIIRHG
FT                   KTLKESVAGLSLQYKNVDFGSKMTEISEQNGDL"
FT   gene            317693..321418
FT                   /locus_tag="LSL_0294"
FT   CDS_pept        317693..321418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0294"
FT                   /product="phage tail tape mesure"
FT                   /note="COG5283 [S] Phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99108"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF8"
FT                   /protein_id="ABD99108.1"
FT                   /translation="MKVQNEMATKITLDTIEAASSLKSFTSGISALTNGWKASEAAHKA
FT                   VGDSLGALKAKFDGIGNVIEVQKQKIEELKSRQEGLDRTNKSQAETWLKLEKDIQTATR
FT                   QLTSYEAQQEKAKSSMEYYTSGLADLQKGYRNTQALSKSYAERLQAEGKALDAKKVQLS
FT                   GVKNSLTNLSKQYQLQEKELQSIAEKSGMTSEAYMKQQIRLNETATAMAKAKSSIEQLN
FT                   AEMKVLNPGVFTRMKNKANELNGRMGKLKESVLSFKGLVGVNLISNAVTSGFTLLTSQM
FT                   KGIISTGIQVSKTAGAMKKRWENLGASANDIKQLTNTLSDLKTNSNLTAEAVNKMQTNF
FT                   YGITGSVEKTNTLSKGVASLSLQLKLSQDQANNFATGLGKIEASGKVTRSSLQKLEKQA
FT                   PGLTTALQKASGESKEAFDALLDSGKMTSGQFNDILEKASEDYKKNSKAFGETSGGALK
FT                   KMQENWKSTQAKLAEPLVKIQATGLNELNKALDDKETQKGIQQIGKYIAQVAVQSAKFL
FT                   AYLAKHQSTVKSFVKVIGSMVILVKVTGWIKQFVAAAASVAGALGPWGLAITGITLALT
FT                   YLYTHSDKFKKFVNRLVKAAKEAFNSLIKFFKNLPKNISKIWKSITGFFSKGWNNLKKG
FT                   ASKGVKNISKGWDNLKKNAAKANKRMWDDTKKRYSDGWNNLKKNASSAKNNIVKTWDNL
FT                   HNQTLKTAKKFTKDHPKEFKEGYDTVQSYTKTWKDFVSGHWDKLGDDVKNTAKNLKKWV
FT                   KDIFKEMYDWLNEKTGGRLNDMVKTFQDKFGSLKDVIHSAIRGVKQKAADLVNGVIKPF
FT                   NDMLSGLKNGINWVLEKVGAPKITASWAIPTVSYAKGTPNVQGLSGTHQGGLALVNDGV
FT                   GEHYREMFRLPNGKVGIFPNQRNMVVPLPKGSSVLNGEDTYKLTTMLGIPAYANGIGKF
FT                   FKGVWNSAVDLVDEAEDILKKPAEFLKEVFEKHIGNLSAKGLAGDIITNFPNKLASLAV
FT                   GWVKKLFEDFGAGGDGNSPAGRMAKSEFAKIAKHAARLMHQKLSERDIEHLYYQASTES
FT                   SVDPAQNGGYDDHDGTGLPIGLFQYKLGTWRSWAVPGHANIHSALDQIMAVLNDSNWRN
FT                   DFPPIGVKRGWGPSGHRMMAYGGRIDTNQLIEVAENNKPEYIIPTDPAKRPRAWQLMHE
FT                   LTSEFTNQEPQRINVSDNRDLKELNDKFDSLLAMFSQLLGLNNQQIKAIRESGFDKIKQ
FT                   YQQQALDQRLADYQGY"
FT   gene            321431..322258
FT                   /locus_tag="LSL_0295"
FT   CDS_pept        321431..322258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0295"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99109"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQF9"
FT                   /protein_id="ABD99109.1"
FT                   /translation="MENNFYIKYGNNPEFSLKDITSNLTLLKLDENPSISNVYQNNVMQ
FT                   DGEMWNYTTYQPTTVSCTFLLWFSTWQDYLLAKHDIMQAFMQKELFRIRTDIDKHLVRY
FT                   VRTAPFTIAPNEDGSHWATFTVAFENPSGVKYSYLRSDQISQSNGWGYGLNLADVPNLN
FT                   YHFNNQTSFRIFNASDIAVDPYFQKHDLKITIKSANGGLTVKNTTNETSWTFKGSLNSN
FT                   DTVVLDGINTYKNNSYDSMETDFGYIKLEKGWNEITLDKVADITFSFPFIYTF"
FT   gene            322274..324586
FT                   /locus_tag="LSL_0296"
FT   CDS_pept        322274..324586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0296"
FT                   /product="Phage lysin"
FT                   /EC_number="3.2.1.17"
FT                   /note="COG3757 [M] Lyzozyme M1
FT                   (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99110"
FT                   /db_xref="GOA:A0JQG0"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG0"
FT                   /protein_id="ABD99110.1"
FT                   /translation="MNERIVKLKPRNQDKIFILNNILWNSFNIQWAENDTYQLSFTVYD
FT                   DGSDLFKIIAVESSIFFDGQEYIIKTLVVDYAAGVSTIQITATHVSNELANLWKYEVNS
FT                   GEKTYTVNDVLAFYLNENNKGFSYQVIGNFDNQQIMDLGNTNGKDMISKILSTWENAIF
FT                   YPDNRNIRIYNKKDFYQNKGKRLDYLHDTSEVQLNIDSTGIINKIRAIGTEHEVTTTTE
FT                   ITVTDGSSWGWPFPDVGEGKFMGSQLFGVNAGGEFRPNGFHDGLDFGSVDHPGSEVHAV
FT                   HGGKVAIKSYMGGLGNYVVISGGGYNVVYQEAFSSASKITVNVGDTVKTGDIIGYRDTD
FT                   HLHVGVTRQDFNVAVGKSFTNDGTWLNPLDLIKSGGTGPTTHTETEEETHTEKYFDDFM
FT                   VEDKDSIAKWGEHPAADMSDDRFHDKNAMEAYVRSKFQLEPLISGTANESSNIKPDIGE
FT                   IRRLEVKTVKLVTEVMIVGFTWYPFDPTQQTQLTLNNLPYSILRNNTNILQKINEISTS
FT                   VTKTITKLNGGNTRELEETLKKYIDNKLNNNTPTTPDIPKPQHIGKIIDVSEWQGVIDW
FT                   PSVIADDVTLSIIRVQHGSAHQDLKYMENLQKCISAGGKYAVYAYFAATSTSDAQQEAR
FT                   DFYNRTQKVVAGKQQPIFYAIDVESIEMSGDVTQMRAGVEAYMSQLNALGVPDNKIVLY
FT                   IANHLYDKFNLNVARPGAIWIPSYGQNDGTLANSLKPTHPYDLHQFTSKGSVKGISGNV
FT                   DMSAEPSKKFKELMFSA"
FT   gene            324579..324917
FT                   /locus_tag="LSL_0297"
FT   CDS_pept        324579..324917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0297"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99111"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG1"
FT                   /protein_id="ABD99111.1"
FT                   /translation="MLSWNGDIHEFLNVYQKNMTDFQDEVNSHLSWLNDDLYLDNDFRL
FT                   ALIIQKLDASFSRLLYNQICENTRLINILLKKLASLVNESDYQGYDDLGNLITVSYEAY
FT                   LNNKLEFR"
FT   gene            325026..326372
FT                   /locus_tag="LSL_0298"
FT   CDS_pept        325026..326372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0298"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99112"
FT                   /db_xref="InterPro:IPR018913"
FT                   /db_xref="InterPro:IPR041531"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG2"
FT                   /protein_id="ABD99112.1"
FT                   /translation="MAVANNQYINFDLLRYQNEVLDITNKFKGRVGDTQDYIKLFVTSN
FT                   SYPVDLRGMKLLFGGVDPNQVAHRHYLDFRADQKTDNLQHGHCTVYFDENTFNCDGIWK
FT                   QAYFKFIDANGNTVSTVDMVLKVLDDTFYAAVGQTANIAVAEFKKLVEQATDKEKEAEQ
FT                   QMQSLSDNAKAKFQAAYDEYKQAIKEVYDEIFDEKKGLKVNYTRLQEIAQSIQETLRQA
FT                   QFHDRPFQFDTVAIMKNYLELQDGDLAITSGWDSKDDGHGNMWQVRAKKRDETPDEINV
FT                   IALQSGYVAERNLSMISADSLEDIMYGYSIKIVHNQKDYPKPTVFYYENAIGTEVGGLG
FT                   AGSFGETLTKLVPCETEYTNNNSVVVRIPRNFYMNAKPYYKYGDWYLSSGNKTIKISLS
FT                   NVDDSAAKAGDGKGSSYLSHSTGYFNYPTAPSDLRAVYVNDTAERLERK"
FT   gene            326553..326975
FT                   /locus_tag="LSL_0299"
FT   CDS_pept        326553..326975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0299"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99113"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG3"
FT                   /protein_id="ABD99113.1"
FT                   /translation="MAINFEPIFSEMANGPEKIKENFDKVKTIDDGVTALNQKDTANFK
FT                   IGKFIGGGASGSVSLNGVGQGMHIVGLWDQMSDSSWPKSLQNRKSFWGSLIQCGDESGN
FT                   IATQILILANLGSIYFRSYVDHTWKEWTRIDGQRDQ"
FT   gene            326989..327396
FT                   /locus_tag="LSL_0300"
FT   CDS_pept        326989..327396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0300"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99114"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG4"
FT                   /protein_id="ABD99114.1"
FT                   /translation="MLIFIYDKETKRYMYPVSDYPDNYDLPANATTVKPVDSNGVGLYD
FT                   PTWNKNTNSWDSLTENEWKKKYTVPEVKSEPTQGEQAAAQQMLAVADLQGKVVTLTSTV
FT                   DKLSKSNNELNATLAQIMLQNATNAGTNGGK"
FT   gene            327399..327581
FT                   /locus_tag="LSL_0301"
FT   CDS_pept        327399..327581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0301"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99115"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG5"
FT                   /protein_id="ABD99115.1"
FT                   /translation="MRYSYDIVKRFYDLGLFTKENVQLFVRVNYFTQEDYYKMFPEDKP
FT                   AETTTSTQPTVAPTA"
FT   gene            327634..327939
FT                   /locus_tag="LSL_0302"
FT   CDS_pept        327634..327939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0302"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99116"
FT                   /db_xref="GOA:A0JQG6"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG6"
FT                   /protein_id="ABD99116.1"
FT                   /translation="MHSLLGYSWAEIASILAVISVLFSGVYWLIRHGAKVLNNAINIGT
FT                   YPLQQQFKELTNTIKQLNGNFEEEHKNLKRLEHEVEQHDKAIILHEEKIKRLEERK"
FT   gene            327936..328262
FT                   /locus_tag="LSL_0303"
FT   CDS_pept        327936..328262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0303"
FT                   /product="Hypothetical protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99117"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG7"
FT                   /protein_id="ABD99117.1"
FT                   /translation="MKKALFDKDGKLNRKVVTSLVLLLIVLVEQLCAIFGLKFTGDVGQ
FT                   IMNLVNTVLTIGGILGLVDGTTVDVDTVNTIEETANKALKIAKTSNDTPKSLAETIDKD
FT                   GNVK"
FT   gene            328274..329542
FT                   /locus_tag="LSL_0304"
FT   CDS_pept        328274..329542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0304"
FT                   /product="Phage lysin"
FT                   /EC_number="3.2.1.17"
FT                   /note="COG1388 [M] FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99118"
FT                   /db_xref="GOA:A0JQG8"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQG8"
FT                   /protein_id="ABD99118.1"
FT                   /translation="MKKKKILITLATCAALLFSVQLNTPSVQAARGEHGVDAAVFQGAS
FT                   GKWGYARDKFMISQIGGTTTGWNLYDQWTYPTQVSSTIAQGKRAHTYIWWQNVTSNSQA
FT                   DYVLNYFLPKIQTPKGSIVALDVESGYQNTQAIAHAIQRIKDAGYTPMVYGYKNYLVNN
FT                   TNLSYLSTLCQLWLAEYPNYAVTPEPNYNYFPSFNNIGIFQFTSTYVAGGLDGDIDLTG
FT                   ITDNGYKNGNPEKPKTHTPAVDAGIKADNTPKRDITVGYTVKVNYSASRWATGQYMPSF
FT                   IKGNSYKVIQVSGNKVLLDGVMSWINKSDVEILQTTVQVQSNNSSYYTVKYGDTLSGIA
FT                   YKYGVNVYTLARNNGISNINWIYPGQRLKITGNVSNQRTYTVRYGDTLSGIAYRYGVNV
FT                   YTLARNNGISNINWIYPGQRLNI"
FT   gene            complement(330044..331426)
FT                   /gene="argH"
FT                   /locus_tag="LSL_0305"
FT   CDS_pept        complement(330044..331426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="LSL_0305"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG0165 [E] Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99119"
FT                   /db_xref="GOA:Q1WV66"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV66"
FT                   /protein_id="ABD99119.1"
FT                   /translation="MAIKKMWGGRFQEGSSKLVDEFGASISFDKHMAYEDLEGSLAHVK
FT                   MLKHTNILSADDADKIIAGLHILQDKLANGELTFSTELEDIHMNIESLLTQEIGDVAGK
FT                   LHTARSRNDQVATDLHLYLKNRLEIVIDEIKNLQKVIVKKAEENVETVMPGYTHLQHAQ
FT                   PISYGHYLMAYYQMFQRDIERFEFNKKHTNISPLGAAALAGTTFPIDREFTAKELDFDN
FT                   IYANSLDAVSDRDFVLEFLSNASILMMHLSRFCEEIILWCSYEFGYIELSDKYSTGSSI
FT                   MPQKKNPDMAELIRGKSGRVYGHLTALLATMKSLPLAYNKDLQEDKEGVFDAVKTVIPS
FT                   LKIFAGMLDTLTVNKDKMLHATEHDFSNATELADYLATKGIPFRKAHAIVGQLVFEGIE
FT                   NNTTLSDIPLEKYKEINSEIGEDIYQFLQSKVAVQRRHSLGGTGFDQVKLQIKNAKKQL
FT                   NL"
FT   gene            complement(331450..332661)
FT                   /gene="argG"
FT                   /locus_tag="LSL_0306"
FT   CDS_pept        complement(331450..332661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="LSL_0306"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG0137 [E] Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99120"
FT                   /db_xref="GOA:Q1WV65"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV65"
FT                   /protein_id="ABD99120.1"
FT                   /translation="MEKGKVVLAYSGGLDTSVEIAWLKNKGYDVIACCIDVGEGKDLEA
FT                   IKEKGLKVGAVESIVIDAKHEFAEEYVLPALQGHAYYENKYPLVSALSRPLIVKKLVEV
FT                   AKEHGATAIAHGCTGKGNDQVRFEVGIHALVPEMKIEDPIRDLHWSREEEIEYAKENGI
FT                   PVPISKKSPYSIDENLWGRANECGILEDPWQSAPADAYDRTVALEDTPDTPDVIEITFD
FT                   KGVPTKLDGEELPLEELIMKLDKLAGKHGIGRIDHVENRLVGIKSREVYECPAATVLLA
FT                   AHKDMEDLTHERDLAHFKPIIEQKLSELIYNGLWFSPLMDAIQAFLAETQKVVNGVVRV
FT                   KLFKGNVICEGRKSPNSLYSEELATYTSADQFDQEAAAGFIKLWGLPTQVYAEVMQQNE
FT                   KNNK"
FT   gene            333223..334398
FT                   /gene="araT"
FT                   /locus_tag="LSL_0307"
FT   CDS_pept        333223..334398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araT"
FT                   /locus_tag="LSL_0307"
FT                   /product="Aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="COG0436 [E] Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99121"
FT                   /db_xref="GOA:Q1WV64"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV64"
FT                   /protein_id="ABD99121.1"
FT                   /translation="MVDLTKYMKKELELVKPSEILAFAQYSSKIPDITKFTVGEPDFNT
FT                   PEHIKEAAIAGVKANHSHYAPSNGTLGLRKAAANFLKERYGLEYNPENEVIVTNGATEA
FT                   IYTALTSVLNPGDKVVVPTPIFPLYIADALLVGAEPILVDTSKNGFKLSADMLKEVLDE
FT                   HGDDVRVVVLNYPSNPTGVTYSQEELDELADVIRDKPIFALCDEIYSELCYDQEHASLA
FT                   KSLREQAIVLNGVSKSHAMTGYRIGIMTAPAEITKELSKIHQFTITTTTAIAQDAAQEA
FT                   FENGLNDSQEMKKEYQARRDYLYSNLTKLGFECAKPQGAFYIFAKIPAGLEQDDKKFIY
FT                   DLAEKAKVAVTAGSFFGKGGEHYIRLSYATSMEEIKKGVARIAKYVEEESK"
FT   gene            334414..335403
FT                   /gene="ldhA"
FT                   /locus_tag="LSL_0308"
FT   CDS_pept        334414..335403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="LSL_0308"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="COG1052 [CHR] Lactate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99122"
FT                   /db_xref="GOA:Q1WV63"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV63"
FT                   /protein_id="ABD99122.1"
FT                   /translation="MKKILMMSVREDEKEAIENWSERHPDVEVGIDEGELHADTVAKLK
FT                   GFDGVVIQQRSLVEDEVYAELKNLGLKQISTRTAGYDVINVNLAHKNGLKVTNVPAYSP
FT                   RSVAELALAHTMRLIRNLELFDERAEEQDFRWIGLKGKEIHTLTIGIIGAGRIGGTAAK
FT                   LFNALGAKVIAYDIKPNPELNEVLTYKSLNEVLQESDVISLHVDLNETTKGLIGSEELA
FT                   LMKPTAFLINECRGPVVDTDALIAALKNKKLAGAALDTLTGEENFFNFDLRGKELPSEQ
FT                   LKELRAMNNVILTPHVGFYTNVAVQNMVDISLDDVLAIISEKRSDHEI"
FT   gene            335422..336471
FT                   /locus_tag="LSL_0309"
FT   CDS_pept        335422..336471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0309"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG3641 [R] Predicted membrane protein, putative
FT                   toxin regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99123"
FT                   /db_xref="GOA:Q1WV62"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV62"
FT                   /protein_id="ABD99123.1"
FT                   /translation="MNKKISLKTGTMNILNGISMGVVVALIPSALVGQLMKALMGVMPH
FT                   IASQVIDITNFAASLLPAMAGFCVGYLFKMNMIQMSSIAAAATIGSGVVKKAGTTYVLA
FT                   GTGDVINVAVTITFAVIIASVIGNKLKNYTVLLMPVLVLVLGGGLGLMTLPYVKLVTGF
FT                   VGAMIKTFTILQPVLMGTLMGISFAVLIVSPISSVGIATAIEISGIASGSANLGITAGA
FT                   FTLAIMGSSVNSLGTILAHFIGTPKIQMGNMLERPKLFIPVIISSGIMGALGAIFKIQG
FT                   TPMSAGFGFAGLIGPMTAYEQMDPGVGSMILLTTLFVVLPIILGLAMKYIFVGESKFVK
FT                   ANDLLIETE"
FT   gene            336947..340576
FT                   /gene="mbp2"
FT                   /locus_tag="LSL_0311"
FT   CDS_pept        336947..340576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbp2"
FT                   /locus_tag="LSL_0311"
FT                   /product="Mucus binding protein"
FT                   /note="COG3652 [S] Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99124"
FT                   /db_xref="GOA:Q1WV61"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV61"
FT                   /protein_id="ABD99124.1"
FT                   /translation="MSRNNLNRKLKYSIRKKKNGGGAALFIVGSVVLGGLMLGGATTVN
FT                   ADEVTQTGTGTDTSAKSSGSTDISGTEVALSSPSNGKPAASTAAATESTADATTSAKNK
FT                   TQPKTSATSESTPAITAGGATSEGNTDTSATTNDGNNAVTAQPTAAEVAKNVSITNVSL
FT                   NKSVVRESKGTDLTITFDWEAKGLHKGDTMEVPMFEGFDSITKQVDFPVMSDGLKMGTL
FT                   TLDYDARKINVNFTADLDPDKLYRGQMKIGTFVSRDYFKNLNNETAVQITLPDGTTVKQ
FT                   PLTVNFDDAPTYPISYEQATKQVMSDDKTQADVSWAVLINPQGEEMQQPTIYLTTNDIE
FT                   NANADYGQARIWYAASATPSTLDPSSIKLYEAQIYPSLGYTKGKQLTSGVDYEITEGDI
FT                   DGMGRNMKDVWVVKLKGNYLNTHGQFVVEYNTHHDHLDPNASSGDSGAAVKTEVSNNGM
FT                   FVYKDANNRIQVNDDGFFGAKIDLIDSNATVDDTYGSVDVKYVDTEGNILPGGDLKTVK
FT                   DNAPVGEDYTTEKKSFVGYHFVRMDKTSDAANGKVTEGDKHVVYVYEKDETPEVKKGSV
FT                   DVKYVTTDGKVLEDVTSVKENAPVGEDYTTEEKTFDGYHFVGMDKTSDSANGKVTEGDK
FT                   HVVYVYEKDVTPEVKKGSVDVKYVTTDGKVLEDVTKVKDNAPVGEAYTTEEKSFDDYHF
FT                   VGMDKTSDAANGKVTEGDKHVVYVYEKDVTPEVKKGSVDVKYVTTDGKVLEDVTKVKDN
FT                   APVGEAYTTEEKSFDGYHFVGMDKISDSANGKVTEGDKHVVYVYEKDETPEVKKGSVDV
FT                   KYVTTDGKVLEDVTKVKDNAPVGEAYTTEEKSFDGYHFVGMDKTSDAANGKVTEGDKHV
FT                   VYVYEKDVTPEVKKGSVDVKYVTTDGKVLEDVTKVKDNAPVGEAYATEEKSFDGYHFVG
FT                   MDKTSDSANGKVTEGDKHVVYVYEKDVTPEVKKGSVDVKYVTTDGKVLEDVTKVKDNAP
FT                   VGEAYTTEEKSFDGYHFVGMDKTSDSANGKVTEGDKHIVYVYEKDPEVPTTPVEKKGSV
FT                   YVKYVDENGNELPGGEKITVVKDGKVGSYYFTTEKDFDGYTFSHMAEGSSDPTGKVVEG
FT                   DQQVVYVYTKNNTPQPEPNKPEVPTTSETPAVPQEEKTTTDTPVKTSTSKVNAEKVTVN
FT                   KATVLPQTGDKKENNSSVMGLVSLGLAGLLGLGIKRKEEKDNH"
FT   gene            complement(340699..341988)
FT                   /locus_tag="LSL_0312"
FT   CDS_pept        complement(340699..341988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0312"
FT                   /product="Transposase ISLasa4c, ISL3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99125"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WR17"
FT                   /protein_id="ABD99125.1"
FT                   /translation="MDNNIKLLLGITDPNLTIDPKYQYTSYIEEKIIKNSKTLLCHLYL
FT                   SYPMYCPNCKALMLHNGTKVANNVHLSSAGKKLVLSIRKQKYLCPECKKTATAKFKDTN
FT                   YHDHFSNAVKAKLVRDLSLSRPMCEIAADSFTSSNTIIRSLESVENNFKVNRNWLPSHL
FT                   SLDDFKSGKRFSSSGMSMCLINAVNHRIIDIIPERNNKFLRNYFIQYSYKARLSVMTIT
FT                   VDLYAPYRSLIKKLFPNAFIIADKFHVVAQAYTAMNKIRTRVMKEYGAGTHEYRALKRF
FT                   WKLLLKNQDNVDYHRYYPRINFKYAELSDSEVLDRLSDMSSELKTAYEYYQLLLQMYRK
FT                   NSCQSLNLLIDTSSWNLPPEMRQALKTIKKHKAEIENSFVLPRLTNGPIEGINNHIKVI
FT                   KRIAYGYNNFKHFRLRILLSLKNNVIFFST"
FT   gene            complement(342157..343248)
FT                   /gene="asd"
FT                   /locus_tag="LSL_0313"
FT   CDS_pept        complement(342157..343248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="LSL_0313"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COG0136 [E] Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99126"
FT                   /db_xref="GOA:Q1WV59"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV59"
FT                   /protein_id="ABD99126.1"
FT                   /translation="MSQKLKVAVIGATGMVGQRFIAILDNHPWFEVTELAASPRSAGKT
FT                   YEEALNGRWRMETPIPERVKDMVVLDANDVEKVTSNVDFVFSAVSMSKDEIKALEERYA
FT                   KTETPVVSNNSAHRWTPDVPMIIPEINPEHTEVIKYQRERLGTKRGFIAVKPNCSIQSY
FT                   TPALSAWKKFEPYEVVATTYQAISGAGKTFKEWPEMEGNIIPFISGEEEKSEKEPLRIW
FT                   GHVDAESKSIVPADDTVITTQCVRVPVLYGHTAAAFVKFRKPATKEELIKALEDYRGVP
FT                   QELELPSAPKQFIRYMTEDDRPQVALDVNYENGMGVSIGRLREDKVYDWKFIGLSHNTA
FT                   RGAAGGAVECAELLKAQGYITKK"
FT   gene            343478..343876
FT                   /locus_tag="LSL_0314"
FT   CDS_pept        343478..343876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0314"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /note="COG0640 [K] Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99127"
FT                   /db_xref="GOA:Q1WV58"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV58"
FT                   /protein_id="ABD99127.1"
FT                   /translation="MNLTITQVSEKYNITPDTLRYYERIGLLPKVPRQSNGNRYYNDSV
FT                   QEWIEMIVCLRHSGVPVEKLIDYAEMIQKGDSTLQAREDLLKEQLANLKEKQHNLNRSI
FT                   ARLEHKIRLYESGEIKQHKRYFTEYNGR"
FT   gene            344198..345037
FT                   /gene="purR"
FT                   /locus_tag="LSL_0315"
FT   CDS_pept        344198..345037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LSL_0315"
FT                   /product="Pur operon repressor"
FT                   /note="COG0503 [F] Adenine/guanine
FT                   phosphoribosyltransferases and related PRPP-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99128"
FT                   /db_xref="GOA:Q1WV57"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV57"
FT                   /protein_id="ABD99128.1"
FT                   /translation="MKTRRSDRLIDMTRYFMERPHTLVSLTFFAERYESAKSSISEDLA
FT                   IIKRTVKLRGIGILETIPGATGGAIFIPSIDEDEARAFIEDMTEQLSHQDRLLPGGYVY
FT                   LSDLLGRPDVLRHVGRVIARQYIDKQIDAVMTVATKGVPIAQSVASYLNVPFVIVRRDS
FT                   KITEGSTVSVNYVSGSSERIEKMELSKRSLKRGSHVLVVDDFMKGGGTVNGMKSMIEEF
FT                   ESELVGITVFAEGAFDGRRMVEDYTSLLKVDSVNTIDKTIHVSPGNYLEKVFGKKED"
FT   gene            345168..346385
FT                   /locus_tag="LSL_0316"
FT   CDS_pept        345168..346385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0316"
FT                   /product="Macrolide-efflux protein"
FT                   /note="COG0477 [GEPR] Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99129"
FT                   /db_xref="GOA:Q1WV56"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV56"
FT                   /protein_id="ABD99129.1"
FT                   /translation="MGDKRSNLFQLLKAGTTTIINALGAAIFTYALSLKLLEITGSALG
FT                   YGVNIFIGPIIGLILSPVISKVVDKYPRKNVAIVAEIALVICLTIFLIIYPLAVKTNLL
FT                   VVSVVFVSISNICARFFSISYLSSTPDIVSKDYLQKLNAIQTTGVAIAGIAALPLAGYI
FT                   YGKIAFEYIILIEIITEILTIFLTVITKFKAHRNEEKAHETGKKLIEILRGNMELTRLT
FT                   MIAMLLNLAVTSLTIGVPYVVIHVLKYSSVVSGDIQSLYSIGVVLGGAVIAAINIKNIT
FT                   RFIIRLYSSFAVALLILGISLSFFKHETLIIFIVFELILGISTALSDPPLFTYVQEVIP
FT                   KENLGKVMTFLYTLAQLLTPVGVLIYSTLFAKIDYPTVFLISGIVVNIIVIVVLLFLGK
FT                   KSKNLA"
FT   gene            346528..347937
FT                   /gene="glmU"
FT                   /locus_tag="LSL_0317"
FT   CDS_pept        346528..347937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="LSL_0317"
FT                   /product="Glucosamine-1-phosphate acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.-"
FT                   /EC_number="2.7.7.23"
FT                   /note="COG1207 [M] N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99130"
FT                   /db_xref="GOA:Q1WV55"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV55"
FT                   /protein_id="ABD99130.1"
FT                   /translation="MTSKYAIILAAGQGTRMKSKLYKVLHPVCGKPMVDHVLTEIEKNN
FT                   MDEIVTVVGHGAEMVEKTLGDRTKYALQAEQLGTGHAVLQAEKLLGDKDGMTLIACGDT
FT                   PLFTAKTFEELFEYHKSKGAVATVLTAHAENPFGYGRIIRNEIGIVEKIVEQKDATVEE
FT                   ATVKEINTGVYCFDNKELFAALHQIKNDNAQGEYYLPDVMEIFQKQGKVVAAYQMKNFE
FT                   ESMGVNDRIALSNATKVMRRRINENLMRQGVTLIDPDTTYIDIDVKVGSDTVIEPGVQL
FT                   KGKTEIGADCYIGAHSEIIDSVIEDGVKVTSSYIEDAVMHKNSNIGPYSHLRPKAEIGE
FT                   NAHIGNFVEVKKATIGKNTKVGHLTYVGDATLGRDINVGCGTVFVNYDGINKHHTTVGD
FT                   YSFIGSASNIIAPVNIADHAYVAAGSTITDDIDAHDMGIARGRQVNKKGYFDRYPVAEA
FT                   ARIAEEKAKEE"
FT   gene            348028..349005
FT                   /gene="prsA"
FT                   /locus_tag="LSL_0318"
FT   CDS_pept        348028..349005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="LSL_0318"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG0462 [FE] Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99131"
FT                   /db_xref="GOA:Q1WV54"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV54"
FT                   /protein_id="ABD99131.1"
FT                   /translation="MSGQYSDPKLKIFALNSNKPLAEKIAEAVGVPLGKISVDRFSDGE
FT                   IRINIEESIRGDEVFIVQSTSAPVNDNLMELLIMIDALRRASAATINVVIPYYGYARQD
FT                   RKVRSREPITAKLVADMLEKAGATRVVALDLHAAQIQGFFDIPVDHLMGAPLLADYFLT
FT                   NGLEKDAVVVSPDHGGVTRARKLAEFLKAPIAIIDKRRPKANVAEVMNIIGSVDGKRCI
FT                   LIDDMIDTAGTITLAAQALKDAGAVEVYVCATHPVFSGPAIERIEKSPIKEMVITDSIN
FT                   LPEDKKIDKVVQVSVGPLIGDVIKRIHEHKPVSPLFKNRFHKED"
FT   gene            349079..349603
FT                   /gene="rimL"
FT                   /locus_tag="LSL_0319"
FT   CDS_pept        349079..349603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimL"
FT                   /locus_tag="LSL_0319"
FT                   /product="Ribosomal-protein-serine acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1670 [J] Acetyltransferases, including
FT                   N-acetylases of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99132"
FT                   /db_xref="GOA:Q1WV53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV53"
FT                   /protein_id="ABD99132.1"
FT                   /translation="MDNVRIRLITEADSGELYQLIVDNRNNLEKWIEWIRDIHNEDEMH
FT                   TYIQKIIHTERKEATITFVILLNEKVIGMADISDISPDGKMGEVGLWLSEEYQGKGIAG
FT                   AVISEIEKYSKSKTKINTLKMLIKANNVNSLKMAHKLGYQEVEKLTSWKNGEVKWIVLC
FT                   KKILKKSKYQI"
FT   gene            complement(349754..350593)
FT                   /locus_tag="LSL_0320"
FT   CDS_pept        complement(349754..350593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0320"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="COG0656 [R] Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99133"
FT                   /db_xref="GOA:Q1WV52"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV52"
FT                   /protein_id="ABD99133.1"
FT                   /translation="MAKIPNYTLNDGNQIPVLGFGTYKLNGATGVNAINSALNNGYSLL
FT                   DSAFNYENEGAVGEAIRRSSLKREDIFVTSKLPGRHQVYEEAIPTIQESLYRAGLDYYD
FT                   LYLIHWPNPKEDHYVEAWQALIDAQKFGLVRSIGVCNFLPEHLDRLANETGVMPAVNQI
FT                   ELHPYWSQAVQREYDKEHGIFTQAWSPLGRANSVLQDPVIVEIAKKHHKSVAQVILRWE
FT                   FQLGVGIIPKANSTKHQLSNLDIFDFELSADEVAAITNLDKPNGRTKNQDPAVYQEF"
FT   gene            complement(350599..350835)
FT                   /locus_tag="LSL_0321"
FT   CDS_pept        complement(350599..350835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99134"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV51"
FT                   /protein_id="ABD99134.1"
FT                   /translation="MSENVFFNPGQSISSSYDFDKAYTAAKIYHMKADNSVLIVQEKDG
FT                   QPYVIFDEAKALQQEAAEGKKYSVIKRVSHDKE"
FT   gene            350978..351748
FT                   /gene="udp"
FT                   /locus_tag="LSL_0322"
FT   CDS_pept        350978..351748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="LSL_0322"
FT                   /product="Phosphorylase, Pnp/Udp family"
FT                   /note="COG2820 [F] Uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99135"
FT                   /db_xref="GOA:Q1WV50"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV50"
FT                   /protein_id="ABD99135.1"
FT                   /translation="MDYQKLPLFIHDYPQDAVINPDHESLNYKLPKKLIYAFVTKENID
FT                   KFLARYSYRIVGSMETISFNPNVYEIDYEGQKIGLCQAPLGAPAATQLLDWLIGYGVKQ
FT                   VLAVGSCGSLEDFEENEFVIPTKAIRDEGTSLHYLPASESIELNSKFVQRVEQILQDFN
FT                   YRIREVTTWTTDGFYRETVELVNHYRKLGVATVEMECAALAACAQFRNVDFAQILFTAD
FT                   SLKDVDNYDERDFGINSHLKVLKIATKVMAKLKN"
FT   gene            351823..353445
FT                   /locus_tag="LSL_0323"
FT   CDS_pept        351823..353445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0323"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG0488 [R] ATPase components of ABC transporters
FT                   with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99136"
FT                   /db_xref="GOA:Q1WV49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV49"
FT                   /protein_id="ABD99136.1"
FT                   /translation="MITVSDLSLNFSGRLLYDDVNLKFTPGNCYGIIGANGAGKSTFLK
FT                   LLEGKLEPTTGNISIGSNERISSLNQDHFGFEEFTVMETVIQGHKKLYQIMKEKDAIYA
FT                   KPDFSEEDGIKAAELEAEFAEMDGWNAEAEASQLLQSLGIPESLHDAKMSELPESDKVK
FT                   VLLAQALFGEPDILLLDEPTNGLDVHTISWLEDFLADYQNIVIVVSHDRHFLNQVCTHM
FT                   CDVDYGKIKLYVGNYDFWLESSQLAAKLQANANAKKEEKIKELQEFIARFSANASKSKQ
FT                   ATSRKKQLEKITLDDIKPSSRKYPFIKFEMERELGNDLVKVENVSHTIDGEKILDNVSF
FT                   IIRPGEKVALLSRNDLATTTLMQILAGEIEPDEGTVTWGQTTSQSYMSKDLNASFDNDE
FT                   LSILDWLRQFATKEQNDNTFLRGFLGKMLFSGDDIDKQIKVLSGGEKVRCILAKMMLER
FT                   ANVLLMDDPTNHLDLESITSLNDSMIDFKGSIIFTSHDHEYIQTIANHIIEVGPKGIVD
FT                   RFDTTYDEFLALDSVQEQVEKLY"
FT   gene            353519..354178
FT                   /locus_tag="LSL_0324"
FT   CDS_pept        353519..354178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0324"
FT                   /product="Metallo-beta-lactamase family protein"
FT                   /note="COG2220 [R] Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99137"
FT                   /db_xref="GOA:Q1WV48"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV48"
FT                   /protein_id="ABD99137.1"
FT                   /translation="MKITWHGHAFIEIQVAGKQILIDPFITGNPFTKTKPEDLNPDYIL
FT                   LTHSHRDHVGDTEELAKKSGATIVTEMDMVNDYAQKGFKVEGPNYGGTVHFDWGDVKII
FT                   PAWHTTANVPLGMATGLALTIEGKLIYIAGDTGLFSDMKLVGRKQQIDLAFLPIGDYYT
FT                   MGPDDAAYAASLIEAKKVIPDHFNTFPPIKQDVNDFWKDVPENMKFTAEIDKPFEL"
FT   gene            complement(354228..355193)
FT                   /gene="birA"
FT                   /locus_tag="LSL_0325"
FT   CDS_pept        complement(354228..355193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="LSL_0325"
FT                   /product="Biotin operon repressor /
FT                   Biotin--[acetyl-CoA-carboxylase] synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /note="COG0340 [H] Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99138"
FT                   /db_xref="GOA:Q1WV47"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV47"
FT                   /protein_id="ABD99138.1"
FT                   /translation="MNTEKAVLNYFIQNLGNYTSGEELSNQLNISRTAVWKAVKQLKEQ
FT                   GYEISSKTRKGYCLVDNGVLNTAFINKYLHTDNLDLHVYETIGSTNSEAKNISSQRHST
FT                   EPLVIISDQQTAGYGRYGRKFESPKNTGIYMSILLENQHQNDLNPGLLTTAVAIAVSRT
FT                   IKKLFHKDTEIKWVNDVLLDGKKICGILTEGVANLETQSISQVIIGIGINYTTPLELFP
FT                   AELRERVGSLKELAEKYHVSRNMFIACCLDEFFAIYRNYTSADFMDEYRELSVVIGKEV
FT                   RIKQGNKIITGVVSTIDDLGRIVLTDGQIFSSGEVTKIRY"
FT   gene            355319..356422
FT                   /locus_tag="LSL_0326"
FT   CDS_pept        355319..356422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0326"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG5438 [S] Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99139"
FT                   /db_xref="GOA:Q1WV46"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV46"
FT                   /protein_id="ABD99139.1"
FT                   /translation="MMRVKKKYLIEWLLIILSGILIYFFVDNDSFLYKDPVAQIVSVTN
FT                   SKATKTEDTYKNKDMTTEQTLKVKVLNGHRKGEVLTAKNTFSKSGGYDQRFYRGQKVFI
FT                   KFEKSDGKLMAMINNYKRDVYLIMLCWAVVVLLFLVTQIRGFTSLISVILNFIIFLLCV
FT                   QLDVKWNINNFFWIFATVAVIFLALSLVLVIGFNWQCLVTFSSIFIGTTLAMIIGVVAM
FT                   QVTNDKGVHYEALDFATQSPKQLFLAATVIGLLGAVMDAATDIVSTLFEMKRTQPGISR
FT                   KQLFISGQNVGKSIMGPLVNVLLLIFFAETVTMAVLFFRTGNSIAYTFEWTMSLGIIQS
FT                   LISGIGITLVIPSASLLSSLVLGGDNK"
FT   gene            356419..357168
FT                   /locus_tag="LSL_0327"
FT   CDS_pept        356419..357168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0327"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG5438 [S] Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99140"
FT                   /db_xref="GOA:Q1WV45"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV45"
FT                   /protein_id="ABD99140.1"
FT                   /translation="MSTITLLTIILFILMWIVGGKRGLASFSSVALNFILLFLTVIFIS
FT                   IGVPALWTTIFAGIAILAVTIYMGNSDEKTTNIAFEATLISLAIVVVVMVPFIKLVGIQ
FT                   GFSPEQSEEIEAFNLLIGVNFESIVISTMILSTLGAIAEAAIAIASGLDEIIEQQPDIT
FT                   LPALYTSGRNIGLQIMGMTFNTLFFGMFGGDLALFILLYKLNATFGYYLNSKIFVAESM
FT                   EVLFSSISIILVIWITTYMMGKKVSRT"
FT   gene            357379..358413
FT                   /locus_tag="LSL_0328"
FT   CDS_pept        357379..358413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0328"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV44"
FT                   /protein_id="ABD99141.1"
FT                   /translation="MIIMAYSTIVTKDEGAVIIVDNIDTKRNKAEHKIIQLNKEAKIYL
FT                   VSFGKYELDGLVWDSLIKGFQMRVNQPIATFKECILRFEEYLRSLKDNYRKDIYIQRII
FT                   WTTLNNLTLNGGIKSLVENINRIYGTLSIDKQVNEESTPILINELVNFLNQNQISIDQE
FT                   SFNKLVEIVKDAYLYPRKNLQDYMGICLVGVGSDETSISATSYRLYGVTENNKLLASVQ
FT                   QIGKGIINLEKSEATEIMIGGISQTFMDDFYWNLNNSNNPNLLQATSSLSEIAQNEYNI
FT                   SQEILRNKSLDDISDFLFNVYGIHRQLEIAQVGEDLQANKVKLVKFSLLDEPTVIEKEL
FT                   GVNN"
FT   gene            358413..360020
FT                   /gene="spoVK"
FT                   /locus_tag="LSL_0329"
FT   CDS_pept        358413..360020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVK"
FT                   /locus_tag="LSL_0329"
FT                   /product="ATPases of the AAA+ class"
FT                   /note="COG0464 [O] ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99142"
FT                   /db_xref="GOA:Q1WV43"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV43"
FT                   /protein_id="ABD99142.1"
FT                   /translation="MEKMTEKQRIFCSIYPYTTKYIEAFNNEYSDNNLRDEVIDYLNKV
FT                   IHKFSNSSVSQSIDINICLVSNGKEQSEVFLDILYKLIKVLNPSFGDKIYIMPDQYEYL
FT                   ESVENNAFIIIQDAKSAFGGDLPEDRRGYKIDYKNYIMEILERADSQKIILLEDTEENI
FT                   SYINSLEGVKNNLTNYFVIRDLTIEEAINYGKSLLYNQSLSLEDDILYGNVLKSYVQKS
FT                   KHLTKLVVERFNKKILNSFAKNSRMSNVIDKKSILDATSVYNPKLVKQILDELDSLQGL
FT                   DNVKQQIHEICEAVEVSQANIGNMELSRRHHMIFEGPPGTGKTTVARIVARLFYALGIL
FT                   ENTTVIETKRNELEGKWVGDLSGKINEKVDSALGGVLFIDEAHQLYNKEDPYDKGKQVI
FT                   QAFVPRLENDGEKFIAIIAGYTKEMEEFLKFDPGLASRFQHKIIFESYEPQVVAQIVVN
FT                   ILKKNKIEFNEKYVKAVAINLYDQIPDDKKSNARWARNYAQKLIEKQLSYCAKHPQFPR
FT                   NRLFNEVLRDSVNWQIGG"
FT   gene            360024..360908
FT                   /locus_tag="LSL_0330"
FT   CDS_pept        360024..360908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0330"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV42"
FT                   /protein_id="ABD99143.1"
FT                   /translation="MTAELGITNGYGVVLAADSSLTMQDYSSRKYYITGQKIFKLSSKH
FT                   SVAIMFYGNATINGQKIQSIVEGFNQYLSEEPLDKFTEYVQLFKEYLIKSASRKYEQYI
FT                   KQKLEDILNNLHSTYKTQDLLGNLIEVKKEIQEEKIPYTFQEFQKFMNQDRMSQFLISE
FT                   DNKYTTEELEYAYYMLVSQTVSNFYTTGIVLAGKGKEENYCSLWNSELYGVLDSKIFSI
FT                   KEISSSPNYSNLYKFAQSDGADALLLGVDRKVSDAFYDKLYMKYQGTDTIEITKAFQRT
FT                   VDDYYNKFYRAYI"
FT   gene            360871..361320
FT                   /locus_tag="LSL_0331"
FT   CDS_pept        360871..361320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV41"
FT                   /protein_id="ABD99144.1"
FT                   /translation="MITITNFIEHTFNGLTLDKVANFAKQLVLATMIRRNFFDNNQTVG
FT                   GSIDVLTIASNGKVSWMQKGKNVRDIELKVTSEERTGHNLKKPRISDEPELTFDEWIEK
FT                   QISLAEKVVNREEKQDDEDSKDEISFKEWINQQIKSAEEIVKRNE"
FT   gene            361325..363325
FT                   /locus_tag="LSL_0332"
FT   CDS_pept        361325..363325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0332"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99145"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV40"
FT                   /protein_id="ABD99145.1"
FT                   /translation="MDNEKFEKEALQVVENFLKSNTQVLIVSGRAGSGKSTLAGKIYEL
FT                   ANKNNGSEYSQAQILSPTGQSVGLIKQKFPQIPEQDCQTIYRKIYRRATKKIDDGDNLI
FT                   FDFKLNKQEDKNIFIIDDASYISDEESNKGNLHFGSGKLLTDLLTSTQIFEKGNVKIIF
FT                   IGDEYRLLPIRDTSAKALKQTYFEELGLNTMKYELKTQYRMHGELARGIDKYAELITSV
FT                   ENHQKIIPYEFKNTGNVRNIDEADWSKEEKKQKIAGQFNRDNKRNKVVVTYSTRAAQEY
FT                   NKLIRRKLQNMEDAPISSGDLVVFSKNQYDLLVMDAAGNEFNEDFFTGDIAEIIATYDR
FT                   KSSNVRVNNQDVTLSYVKVKYRLERTGKEYVSYLLENVLNSDDSQLSSDERTALFYDAE
FT                   ERIGITETPEEHRRHIKSNNEYWEAAVKKLANIGESGLSVSDKDRIRELLRKHPICDPK
FT                   NECERYQLLDKIYQDKFYNSIQVKYAYAMTGHKVQGNEWNDVYVDFTDRNGLDESSLRW
FT                   TYTALSRAIKNVLVFNATSLFGNFDISNEFIGKKKNLEKEREMATKIEEYKFNDEKIVR
FT                   LVDKVEEISENNGLVVTNIDDRNFEKQYFVLIYLSDVENNNYVMQAYYNSRKFWTKATL
FT                   RSKVEIAEKLESIGAEFKKINPNFRGSADNE"
FT   gene            363318..365933
FT                   /locus_tag="LSL_0333"
FT   CDS_pept        363318..365933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0333"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99146"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV39"
FT                   /protein_id="ABD99146.1"
FT                   /translation="MNDVEKMIAVRDVDGLNDAISFLRKDGRLAEASHVCKLAQQNNQD
FT                   VTASAAWVLYDFLKTDNEFTKYMRIVQENYEIQKTMFSDDYEIGYFSLYIKLTQAQIIR
FT                   KAWELSKQEKWDELHKLVTTSFTFFVNQEFNLSDWDSELTSTDNYYSGKNQMLGISGFL
FT                   GDLISCYVRSEHFLHADIQTIMNEVLNFYSKYKDNYVYMGKVLGIMLTAVIWEKYKSKD
FT                   YAAIDRCCKLVVREIDREHLSETPFELILVLSQIKYYQLGNNKAEITKRENGYIYLVEK
FT                   VLDFSKIPDDYLSPTKNVMEDKEYSSKIIQIMQGYAKSLCNRADSVERYLKVVLEIFAL
FT                   EKTKRLREYRGHYGKNLINDFIRVYGYVEYEQDKKHLIQEYGSFLKKKEQLSYNDDLIR
FT                   ESIGENIIYLVYKTTPKELENLTDTLIAELPVTIFENKVTEFNKALVITKFNISNPKEY
FT                   LRLMTWVLSNDESFVAENFKEVENPDDPSHPYPSDFAKLLSSYYVAVSRTNTDVLASLD
FT                   LWLEKLSEVKKVYTSNKAVGEFLRIFLKLAKEKSVSLTQQQVQVIIDKLGSVVFENYKG
FT                   NKWIGYYYCKILLDHGFDEEADKAFDKFLVTDRGNSWLWKAYADFVKDDNELRIAALFE
FT                   FLKTKGDSDEVRKEVIEYLIAAKNPEYYGPIKFELSKIKDKEYKAKFENLPWYVETQLP
FT                   ENNQEIYRKFTKMIEQKFNEKIEKRNFYVVGSDGKKFIDIVVLDKNGEKVEGIIIDEEL
FT                   LKKINLYECYFARLVPKKVKKAGMKPRFELVGDVEKTTDYTFKVKFIQNYEGVYKQGLD
FT                   PWDNRAIIVTDYENKRIPAWMVEEYHLQNDDKVKVTQKIKQKKNKLLWQIVDIKKLETE
FT                   "
FT   gene            365987..367081
FT                   /locus_tag="LSL_0334"
FT   CDS_pept        365987..367081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0334"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99147"
FT                   /db_xref="InterPro:IPR031927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV38"
FT                   /protein_id="ABD99147.1"
FT                   /translation="MKKLTIISSVILSSLLILTGCGSNSSKKSNVTSKVKVVKQSSSKK
FT                   SQKGVAKKKSGSLWNNDKDSHLEDFMKQWGEVMNQTYTKYDGTNNIQTASGMNYPQDFN
FT                   SATVNGQNVSMAWDKKGTGKNDYNVVAIYNYNKSSSSSITYAFTLADGEPIVLVNEGSG
FT                   NNWSETKNKSLKENFVNIFDGKATHVEKPKVSSSSSTKSSSSTKATEDLGEGRGGYVTT
FT                   PEAMRGTWYSKCESGMTKLVISEHEIAYTDSNGQSGRTILYKKTIPTPTQVSEKEIDAK
FT                   REWGDARYANIRGLQYINILGWYQSAGAGAYYAAHTEEIDGSRVPIIVEGGGAEAWTSA
FT                   VYYPSEDLANQQGDTKFEDLHYYQ"
FT   gene            367099..367794
FT                   /locus_tag="LSL_0335"
FT   CDS_pept        367099..367794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0335"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99148"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV37"
FT                   /protein_id="ABD99148.1"
FT                   /translation="MKKTIWVILAALSTLLILTGCSSNSSEHKSSASSKAELVKSSSSK
FT                   KKHSEKKKESSSEKESSSSSLSSEVSSSSSTQSSENMGEDRGGYVTTPEAMRGTWYSKD
FT                   ENGMRKLVISDHEITFISPDGETNHAILYKRTNDIPSDVSESERQSKEEWKSAGNIGTN
FT                   GISMRGWYQQQGGGEHFFTHEEEINGQNVPLVLFGFGANDLTDYVYYPSEDLANQQSDA
FT                   KYDDINYKF"
FT   gene            complement(367852..368319)
FT                   /locus_tag="LSL_0336"
FT   CDS_pept        complement(367852..368319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0336"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99149"
FT                   /db_xref="GOA:Q1WV36"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV36"
FT                   /protein_id="ABD99149.1"
FT                   /translation="MLLLALIPVFMGSGLAIQTAINSRLGSVSGSSFLASMVSFVVGAI
FT                   FLNVLLILTGTSPLVNMTTITSNPWWIWLGGVLGVIGLTTNILLFPKLGSVQTAVLPIF
FT                   GQIVMGQIIDQFGLFKSPISKFTIIKLVGLVLVAGGMLLATGAFMPKDKIF"
FT   gene            complement(368383..369204)
FT                   /locus_tag="LSL_0337"
FT   CDS_pept        complement(368383..369204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0337"
FT                   /product="Hydrolase, HAD superfamily"
FT                   /note="COG0561 [R] Predicted hydrolases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99150"
FT                   /db_xref="GOA:Q1WV35"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV35"
FT                   /protein_id="ABD99150.1"
FT                   /translation="MSKIKMIATDIDGTLVDDAKNLSPKTIEVLKKARANGIYVVLCTG
FT                   RPLSGVANLLTQLGLDNDDNFVITHNGAQAVSAKSGKAIFKHLLDFSDFKRLDAISKEL
FT                   KVNMQTITTDSQLFVTSPDINYYSVLDTFYTHMQLRYRPVTEVPEDIEIAKIMWADYPE
FT                   NIDNALPNLPKDLLDKFDCIRSEKWFFEFMNPLATKGNAAIELGKHLGIDASEILTAGD
FT                   QNNDLSMIEKGGFSIAMGNAIDTIKEKADYVTDTNNNDGLAKAIEKFVFED"
FT   gene            complement(369220..370575)
FT                   /locus_tag="LSL_0338"
FT   CDS_pept        complement(369220..370575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0338"
FT                   /product="Hydrolase"
FT                   /note="COG1078 [R] HD superfamily phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99151"
FT                   /db_xref="GOA:Q1WV34"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV34"
FT                   /protein_id="ABD99151.1"
FT                   /translation="MISDYKHQMLPMEKVLRDPIHNYIYIQHQVILDLINTREFQRLRR
FT                   IRQLGVANYVFHGAEHSRFTHSVGVYEITRKICDLFQRNYPSKEKGDGLWNDDERLVAL
FT                   CAALLHDVGHGAYSHTFEHIFHTNHEKMTTEIITSSHSEVNAVLRKVAPDFPEKVASVI
FT                   EKSYPNPQVVQMISSQIDADRMDYLLRDSYFTGTNYGTFDLTRILRVMKPYSDGISFDM
FT                   SGMHAVEDYIVSRFQMYQQVYFHPVSRSIEVILSHLLKRAKYLYKNGKTNCLGPTNLLF
FT                   PFFEGDFSLSDYLKLDDGVLNSYFSLWQDSDDKILSDLADRFLNRKPFKSVRVSEDTRY
FT                   LLPTLRKLVADAGFDSEYYTATNDSFDLPYDTYSPSQNKHRTQIELMQKDGLLVELSQV
FT                   SNLVAAISGKVSGDERFFFPKEMKSSEQQLELFGPIYSEFQSYLKNDTLIKK"
FT   gene            370767..371435
FT                   /gene="guaA"
FT                   /locus_tag="LSL_0339"
FT   CDS_pept        370767..371435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="LSL_0339"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG0518 [F] GMP synthase - Glutamine
FT                   amidotransferase domain; glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99152"
FT                   /db_xref="GOA:Q1WV33"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV33"
FT                   /protein_id="ABD99152.1"
FT                   /translation="MKITVLQHTPNEGLGMIRDYAHLHKHELYVYHPYQFGILPQANEI
FT                   DFLIILGGPMSPNDDLDWIVQERKIIAELLARKKPIIGFCYGAQQIAKTLGYKVTKSPY
FT                   KEVGWAKVYRQCDIKLELPDSFTAFHWHEEMFEVPQEAKLLFSSDLVKNQGFILGDNVV
FT                   GLQFHFEQDEDSVREVALNDGNYALQNNALHQTPEDIIKHGVPKENKEILFKLLDYLLV
FT                   "
FT   gene            371538..371975
FT                   /locus_tag="LSL_0340"
FT   CDS_pept        371538..371975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0340"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99153"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV32"
FT                   /protein_id="ABD99153.1"
FT                   /translation="MELKNGTPIVVKVETIRKQDGEVSKYTENFNGQYVKMGSNIYLRY
FT                   QEKHDQHEDATVTFKITDDGEVQLNRQQGEMKMRLYFASQKRVSTTYKTPYGVIPIETL
FT                   TNKINISKKDMPISAKVEVDYLLYSQEKIVGEYKIRLQFTA"
FT   gene            372021..372611
FT                   /gene="rpoE"
FT                   /locus_tag="LSL_0341"
FT   CDS_pept        372021..372611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="LSL_0341"
FT                   /product="DNA-directed RNA polymerase delta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG3343 [K] DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99154"
FT                   /db_xref="GOA:Q1WV31"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV31"
FT                   /protein_id="ABD99154.1"
FT                   /translation="MELEKFKDANKDELSMIEVAHEILHQRGETMAFADLTNEIQVYLG
FT                   KSDEEIRDRLAQFYTDLNIDGSFISLGDNVWGLRSWYPYDSIDEALVHGEDEEDEERPR
FT                   KKRKKVNAFLADVSDDDDVIDYDDDDPEDEDLDNDYDDEDDDDDEGSHELKQYTKDLDD
FT                   IDDGDDPEDELADGIEGQLTEFSDADLDEENQD"
FT   gene            372786..374384
FT                   /gene="pyrG"
FT                   /locus_tag="LSL_0342"
FT   CDS_pept        372786..374384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="LSL_0342"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="COG0504 [F] CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99155"
FT                   /db_xref="GOA:Q1WV30"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV30"
FT                   /protein_id="ABD99155.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERR
FT                   GDYLGATVQVIPHITNMIKEKIMRAGTITDADVVITEVGGTVGDIESLPFLEALRQMKS
FT                   EVGSENVVYIHTTLVPYLHAAGEMKTKPTQHSVKELRGLGIQPNILVVRTEKPISQSMR
FT                   NKIANFCDVEPEAVIESMDVDTLYSIPLNLQAQNMDEIVCKKLHLDTPAADMTEWAALR
FT                   DKVKNLSGEVKIALVGKYVQLPDAYISVNEALKHAGYTIDANVKIDYFDSEKLTAENVA
FT                   DELKGYDGVIVPGGFGDRGLEGMIQAIRYARENDVPYLGICLGMQMACIEFARDVAGIE
FT                   DATTGEVNPKAANKIIDLMADQEDVENMGGTQRLGLYPCKLKAGSVASAAYGNQDVIQE
FT                   RHRHRYEFNNKYRDELAAKGLVFSGTSPDNRLVEVVEIPENKFFVAAQYHPEFLSRPQR
FT                   PEGLFQAFINASAGK"
FT   gene            374455..374655
FT                   /locus_tag="LSL_0343"
FT   CDS_pept        374455..374655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0343"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV29"
FT                   /protein_id="ABD99156.1"
FT                   /translation="MVARELSPFAKSIIEYQEKNHLTDADFSLESHRSVERIHALKTME
FT                   AEPTNDEYRKITAVINGQKLD"
FT   gene            374722..375282
FT                   /locus_tag="LSL_0344"
FT   CDS_pept        374722..375282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0344"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV28"
FT                   /protein_id="ABD99157.1"
FT                   /translation="MRLKNMTDYIAKAEFKLTAKIEREKLKEIIILLDLQKEELSKQKV
FT                   IIDYRSGQYIKTKQQILPLGPKYEVIDSQGIKLSLKDIHAFYSVCKADDFEKERNLLNN
FT                   ATIVGYLDEYILEYQLFFDSSISSMKGIISSLHVASQRSAVERLYCYLLGHYFDLELNL
FT                   HEFEKNSDAYWAGVCPVIFNKES"
FT   gene            375503..376774
FT                   /gene="murA"
FT                   /locus_tag="LSL_0345"
FT   CDS_pept        375503..376774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="LSL_0345"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 [M] UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99158"
FT                   /db_xref="GOA:Q1WV27"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV27"
FT                   /protein_id="ABD99158.1"
FT                   /translation="MKKMIVKGKQTLSGEVTVGGAKNSTVALIPAAILADTVVRFDSVP
FT                   DILDVHNLMIILKSMNVSSHFGHGELMIDPTEIKKAPLPGKAIRSLRASYYFMGALLGR
FT                   FGEAIVDFPGGDNIGPRPIDQHIKGFEALGAKVVEEKDKVYIKTGPEGLKGARIFFDLV
FT                   SVGATVNVLLAAVKAKGTTIIENAAKEPEIVDLATFLNNMGARIRGAGTDVIRIEGVDE
FT                   LRATNTHTIIPDRIEAGTYLAFAAANGNGVLVKNVITEHLDPFIAKLQEMGVRLEIHED
FT                   SIYVPGGDLLVPVTVKTAPFPGFATDLQQPLTPLLLKAQGSSRIIDTLYPERVKHIPEM
FT                   RKMGAKISSKDGIITVKRSKDLLGTTVEASEIRAGVSLLGLALMAEGTTVITKADNILR
FT                   GYDRIVDKLKGLSVKVEIITDNRE"
FT   gene            376785..378068
FT                   /gene="rho"
FT                   /locus_tag="LSL_0346"
FT   CDS_pept        376785..378068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="LSL_0346"
FT                   /product="Transcription termination factor"
FT                   /note="COG0781 [K] Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99159"
FT                   /db_xref="GOA:Q1WV26"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV26"
FT                   /protein_id="ABD99159.1"
FT                   /translation="MATSENKDIKELTIAELENMTLKEIYNYARIYKIPYYSKMNKKEL
FT                   SLAVIRAQANKNGFYMKGILEIVPNQDGYGFLRPINYGPSQEDIYISASQIRRFGLRNG
FT                   DEVAGTARPPRQGEKFYGILHVDSVNNKDPEEAKKRDHFPALTPIYPDKQIELETIKGQ
FT                   LSTRVIDLFAPIGFGQRGLIVAPPKAGKTSLLKAIAKGISANYPDAKLLLLLIDERPEE
FT                   VTDLERTVNGEVVYSTFDQRPENHVRVAELLLERAMRLVEDKQDVIILLDSLTRLARAY
FT                   NLVVPPSGRTLSGGIDPAALYKPKKFFGAARNIEEGGSLTILATALVDTGSRMDDVIYE
FT                   EFKGTGNQELHLSRELAERRVFPAVDIKRSGTRKEELLLSQEKLDALWKLRKNLSNDLV
FT                   SDTEQVLQLLRNSQDNAEFCGKIEKMMK"
FT   gene            378175..378423
FT                   /gene="rpmE"
FT                   /locus_tag="LSL_0347"
FT   CDS_pept        378175..378423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="LSL_0347"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="COG0254 [J] Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99160"
FT                   /db_xref="GOA:Q1WV25"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV25"
FT                   /protein_id="ABD99160.1"
FT                   /translation="MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPL
FT                   IRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGFTN"
FT   gene            378509..379165
FT                   /locus_tag="LSL_0348"
FT   CDS_pept        378509..379165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0348"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99161"
FT                   /db_xref="GOA:Q1WV24"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV24"
FT                   /protein_id="ABD99161.1"
FT                   /translation="MKKFNWSFDIIMLIFIEISMLVSLVSSFIEHKSMLYIAETIAGIL
FT                   LALAPVIASSLFRFNLPKFLNAFYLLFIYGSVYLGTLLHFYSVPYWDKGLHLISGALLA
FT                   SFGFSLYGMIVPKHLREHMPAGFLVLYALSFAIFCGVCWEFYEFTCDGLFGMNLQRYAS
FT                   SAGKAFVGRAALMDTMGDLIADTIGAGLLCIYAYFNIKRSSRWLQGFYFHKSFRF"
FT   gene            complement(379190..381556)
FT                   /gene="srmB"
FT                   /locus_tag="LSL_0349"
FT   CDS_pept        complement(379190..381556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="LSL_0349"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /note="COG1199 [KL] Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99162"
FT                   /db_xref="GOA:Q1WV23"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV23"
FT                   /protein_id="ABD99162.1"
FT                   /translation="MSTSIGVRKLVEFILKKGNLTSNTNSQNTALDGISIHQRLQKKFS
FT                   NDTKSEIALKKELDIDGETWIIHGRADGIKYIDDRPQQVIEIKTSSPEFSELAPNTLEL
FT                   YWAQAKIYAHIIMEQEQLPELSLKLIYVQTTDNTISEETQVISQTDAQNFFDNIIAEFT
FT                   NWIKLQHQLQKERDHSINKLDFPFSSYRKNQHEFAAAVYKTIALNKKLLVEAPTGTGKT
FT                   ISTIFPAVKALGTKKCQKIFYLTAKQSTRKVAEETLQLLVKHGLSITAITLTSKEQITF
FT                   PEELDLADDENPYYLGYYDRLRPALIDILTNEKVITRKIVENYAKKHMLDPFEFSLDIS
FT                   NSCDVVICDYNYLFDPLVKLQRFFTERNYDYTFLLDEAHNLVSRSRDMYTKEISSQQIK
FT                   DLLDKLQTLPHPPQKIVDKLNTLLNDFDLIKEPLVNYQQADVIIEEKLASLTKKIMYFC
FT                   DFTTDWLAENPHFSLKDDLLEFFFAAYAFVKISDYYNNSFRTHLFITENSELLIRVFCL
FT                   DFSELIANSLNLGGSAVLFSATLSPLNYYQEMFGLIDNSLLYQLSSPFDESNLNLLITS
FT                   YIPVTYQQRQQSLGKIIDAIHTMIATKQGNYLIFLPSYTFLKQVVVAFNQAYPHIDTVI
FT                   QENDMTREQQEDFLNYFVENPTKILVGFAVLGGSFSEGIDLKGNRLSGVAIVSVGLPKL
FT                   SKETNELQSYFNNKQKDGFQYAYQLPGLNNIFQAAGRVIRSSTDVGVVLLIDNRFATSR
FT                   YAKFFPPHWKYAQIIHNQYELEQNLSTFWNKNKDS"
FT   gene            381839..382477
FT                   /locus_tag="LSL_0350"
FT   CDS_pept        381839..382477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0350"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99163"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV22"
FT                   /protein_id="ABD99163.1"
FT                   /translation="MKLFSKLNLLILALGGVLVLSVPAVKADTTADTNNQQSTATLNIQ
FT                   DESSDITAKLSLDAVPSFPFGTVKTNTIFSGGTTESKLSDNNTVVVNDTRLSSVGWNLA
FT                   VTNTTAFTNGNSKINGTINFTPSAFQFGDGVAAEGWTWSKAQTSLELPSSVSNQVATST
FT                   GAKKGTATSKIGNASLTFNGHDAIVPGSYTANLTWNLTAATKDSLIKSE"
FT   gene            382495..383532
FT                   /locus_tag="LSL_0351"
FT   CDS_pept        382495..383532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0351"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99164"
FT                   /db_xref="GOA:Q1WV21"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV21"
FT                   /protein_id="ABD99164.1"
FT                   /translation="MVRLKTNSIVKLFLCIVLCICFLQLPHVNADNISNNAAEFTISPV
FT                   YPHEQKEDDAGYFDLNVKKLITVPVKVKISNLNKNQDIEYLIKVGNATTNDNGTINYTN
FT                   FKNKKDTTAKYQLTDFISKTELKQKVTVKAGSSSEVTVNLKVPKQKFPGTIAGGIYVER
FT                   LTNAYVNEKSGMNTRNHFSMTLPIILTEQAKVKRIAKMELDKVTVKNGPEITAKLHNVK
FT                   PVMFGKLSIDSKITKKNHTKTLVHKSVNNYQVAPNSSFNFLSSDSSNQLGAGKYTIDMH
FT                   LQSGKRKWHLVKDFTITAQQCVPLTKRTGWFGVSMLLWIIVVVLILIIAALIVVVVRQR
FT                   KNLKR"
FT   gene            383543..385324
FT                   /locus_tag="LSL_0352"
FT   CDS_pept        383543..385324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0352"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV20"
FT                   /protein_id="ABD99165.1"
FT                   /translation="MSVKKNLLLLILSLSVTILFLGNINLISADTTSSAVSTSSSIAST
FT                   ATSSSSTTSSASASSSSSSSTTVFSSGIKWPTTSFAIWTQGTKEAGGLTRNKYGFMVNK
FT                   DEGYYMEEYKDSNNIHVMIPMIAYKSWNKSTKTKYYVVMQSGSTFSGQEISSSNVIRTK
FT                   IEDYSRTALWMLDVTVGNIKADKIQICIYDDDGSYGFWRTNGVADDGTYPFVMSTPVLG
FT                   WNNVTNFNQSLKDGIFYVGRNTTLTMNAPKLQDSNVGKFDNSILNNAGESHFFGQNVVN
FT                   NEIRTTYEITTDVTKLDGIVDGLASSDTNKYGLDTVLTYEIPSDNLKIPLSYGGLKAIS
FT                   LSAEALDNASINTKDYLESSFVDKVTGDLGTGHTLTYSWFYSTSDNINDLKKVSTEFTN
FT                   NKDRKADGTLGTDWMTLSAKDDFTQYLEKQALAGKKIYLMMKVYVDGKLSTLTNPILVQ
FT                   IQVPTLKVPDKIDFGTISVKNIYNGGSFESLTKDSDKLSLSIPDTSRSTWKVTSSIKEN
FT                   DDNSITKINGQLNILGKNLSATPVEVASISKHGLVDLPLNAKVSFRGYHNPLTPRTNFT
FT                   EDINWNLSPETPIMASN"
FT   gene            385489..386802
FT                   /locus_tag="LSL_0353"
FT   CDS_pept        385489..386802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0353"
FT                   /product="Guanine-hypoxanthine permease"
FT                   /note="COG2252 [R] Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99166"
FT                   /db_xref="GOA:Q1WV19"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV19"
FT                   /protein_id="ABD99166.1"
FT                   /translation="MKDKVISYFGIDKHGSTIKREILAGFTTFISMAYILFVNPTVLGA
FT                   AHMDKGAVFTATALASAFGCLMMGLYAKYPIATAPGLGVNAFFAYSVVIGMGIPWQTAL
FT                   AGVFVAAIIFLLITVFKLREMIIDSIPQDLKYAISAGIGLFIAFIGMKSAGIIVANKST
FT                   LVGLGTFQGQTWLSIIGFVLMAVLMLLNVPGAIFIAMLVAAIIGMVTGLIPAPHQFISS
FT                   APSLAPTFGQAIKHVTDINTMQLVVVVITFLLVTFFDTAGTLVGLAQQAGFMKDNKMPR
FT                   VGKALLSDSSAMLVGSVLGTSPIGAYVESSAGIAVGGRTGLTAVTTGVLFILGMFFSPL
FT                   LTVVTSYVTAPALIMVGVLMAGNMARISWDKLEIAIPSFVILATMPLTYSIADGIALGV
FT                   IFYPITMITAKRGKEVPPLMYVLFFVFLIFLWILQTGE"
FT   gene            386949..387719
FT                   /locus_tag="LSL_0354"
FT   CDS_pept        386949..387719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0354"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99167"
FT                   /db_xref="InterPro:IPR012664"
FT                   /db_xref="InterPro:IPR019261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV18"
FT                   /protein_id="ABD99167.1"
FT                   /translation="MNKERLQLLAHKTMNIYQVEMRQLPQSSELITELPVETETLNQYE
FT                   TKIVVKDENLLYRIFKVPEDKKLGVMSFASPVSIGGNFQYGVNAQEQTICRNSFLYPEL
FT                   KKYRRTYYYHNIQNPNDFLFSPYLIYASDIKFIRDEKEDQILKGKFADVVSVAAPDVTS
FT                   MRENNKVLPAEKIAEDIYNKVLATLRVFKNHETKVLILGAFGCGAFGNDPQMVAKIFKQ
FT                   VLDRSEFKGVFEEIYFDIMKNPQVLKIFENTLKD"
FT   gene            387857..389227
FT                   /gene="murF"
FT                   /locus_tag="LSL_0355"
FT   CDS_pept        387857..389227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="LSL_0355"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="COG0770 [M] UDP-N-acetylmuramyl pentapeptide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99168"
FT                   /db_xref="GOA:Q1WV17"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV17"
FT                   /protein_id="ABD99168.1"
FT                   /translation="MKMQLAEVARALNIEAKEEWEDISITSVCFDSRKIESGALFIPLV
FT                   AENDGHKYVEAAINGGAVATLWQEDHSENIPDSIAVLPVSDTLVALQQLGKHYLMKINP
FT                   KVVAITGSNGKTTTKDMTAAVLATQFNVHKTFANFNNEIGVPMTILSMEPNTEVLVVEM
FT                   GMDRYGQLDFLSKLAEPDVAVITMIGEAHIEFFGTRDHIADAKMEITHGLKEDGELVIN
FT                   GDEPLLTTKAKEVSQEVLTFGSLDNNDMCAMDIVSDATKTSFKVATWPEVDFTINMIGA
FT                   YNVFNALAALSVGNIYHIPVDKMQKALASFDLTANRTEWLEAKNGAKILSDVYNSNPTA
FT                   VKEVLYAFEQVPTEGKRIIVLGDMLELGEKAAEMHSNLAQAINPDRIDSVYLCGELMGH
FT                   LAEKLREKFDETQIHHYQKDDLLTLTSDLKNELMSDDIVLLKASHGIHLENVVSELI"
FT   gene            389363..390841
FT                   /gene="srmB"
FT                   /locus_tag="LSL_0356"
FT   CDS_pept        389363..390841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="LSL_0356"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="COG0513 [LKJ] Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99169"
FT                   /db_xref="GOA:Q1WV16"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV16"
FT                   /protein_id="ABD99169.1"
FT                   /translation="MKFGELGLDKSLLKAVKRSGFEEATPIQAETIPLVLAGNDVIGQA
FT                   QTGTGKTAAFGLPVLQQLDLDLRQIQAVIISPTRELAIQTQEELFHLGKEKRAKVQVVY
FT                   GGADIRRQIKQLEQHTPHILVGTPGRLLDHIQRGTINLAHVKHLILDEADEMLDMGFLD
FT                   DIEKIIQAVPAERQTLLFSATMPKEILKIGEKFMVNPQIVKIKAKELTTDLVDQYFVKT
FT                   KEFEKFDIMTRLIDVQAPELTIVFGRTKRRVDELSRGLEARGYNAAGIHGDLTQQRRMN
FT                   VLRKFKNGDLDILVATDVAARGLDISGVTHVYNYDIPQDPESYVHRIGRTGRAGHHGTS
FT                   VTFVTPNEMDYLRVIEKLTKKRMDPLKPPTQDEAFIGQVSSALDDIKDLIADTDTERYE
FT                   AQAQALLEQYDAVEVVAAFLNNMTKKDASDVPVKITPEKPLPRRKKGRRNGNYRRGNDN
FT                   FKRSKRFNKHDRKNRDNKRRSGKKNRFTIRTKKA"
FT   gene            390971..391378
FT                   /gene="acpS"
FT                   /locus_tag="LSL_0357"
FT   CDS_pept        390971..391378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="LSL_0357"
FT                   /product="Holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="COG0736 [I] Phosphopantetheinyl transferase
FT                   (holo-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99170"
FT                   /db_xref="GOA:Q1WV15"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV15"
FT                   /protein_id="ABD99170.1"
FT                   /translation="MIYGNGIDIQEIRKIQKAQEKRESFAKRILTVNELAIFEKYKGNR
FT                   KYEFLAGRFSAKEAFSKAYGTGIGKKVGFQDIEILNDNQTGRPEIVKFPGDNKLQAKIS
FT                   ISHSGEYVVTEVILEKLTWQTKMKKFLIKQK"
FT   gene            391397..392512
FT                   /gene="alr"
FT                   /locus_tag="LSL_0358"
FT   CDS_pept        391397..392512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="LSL_0358"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COG0787 [M] Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99171"
FT                   /db_xref="GOA:Q1WV14"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV14"
FT                   /protein_id="ABD99171.1"
FT                   /translation="MVIGRHRNTRAIISLEAIKHNVATQISKLKDGQSLFAVVKANAYG
FT                   HGMIPVAKAAKEAGANGFCVAIIDEGIALRESGIKDPILILGVNPASEAVCMAKHDLSV
FT                   AVGTLEFLTEAQKLLQEEKQRLKIHLALDTGMGRIGFRNTEDLKEAVDFIEKHSDQLKC
FT                   EGVFTHFSTADSKDPAYFEKQSQKFDELVGVLKKKPKYIHQANSATALWHPNFEGNLVR
FT                   MGISMYGLNPSGDMIDETWNLEPALSLESELVAVKEVEAGSSIGYGATYTSSQSEWIGT
FT                   VPIGYADGWLRRMQGFKVLIDGQYCEIVGRVCMDQFMVRLPKKYDLGTKVTLIGENNGK
FT                   VITAQDVANYADTIHYEIMCNITERVPRIYK"
FT   gene            392559..392807
FT                   /locus_tag="LSL_0359"
FT   CDS_pept        392559..392807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0359"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99172"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV13"
FT                   /protein_id="ABD99172.1"
FT                   /translation="MIKKSVKAIIKDKNFVEYCSFYSVDSNEVVNDDSLMNHIQENQTS
FT                   LEQLIAGYMEMGALNQEICGEFWNCECSSDHADELKE"
FT   gene            392823..393191
FT                   /locus_tag="LSL_0360"
FT   CDS_pept        392823..393191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0360"
FT                   /product="Transcriptional regulator, PemK family"
FT                   /note="COG2337 [T] Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99173"
FT                   /db_xref="GOA:Q1WV12"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV12"
FT                   /protein_id="ABD99173.1"
FT                   /translation="MSDFEVKRGDIFFADLSPVVGSEQGGVRPVLIIQNNIGNKFSPTV
FT                   IIAAITSKISKPKMPTHIGLVAKEVGLEKDSVVLLEQLRTIDKQRLKDKVTHIDEKLMQ
FT                   RVNNALKISVGLASIHKK"
FT   gene            complement(393233..394069)
FT                   /locus_tag="LSL_0361"
FT   CDS_pept        complement(393233..394069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0361"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99174"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV11"
FT                   /protein_id="ABD99174.1"
FT                   /translation="MITLGLTTWNEHPALIHNEDRRVTLSEYSAYFPTVELDTFFYGIP
FT                   RIFTVENWQAQVPESFQFVVKANKVLTLHEQSDIQHINLTFHNFLESLQPLIDKNQLKT
FT                   VLFQFPPYFTLNKKSTNYLRYLRQKLPNISISLEFRHKSWYNDTKKLVNFCRELGFTLV
FT                   IADEPSRLDSSVPFLPVITNPDLTFFRLHGRNIEGWENPGKNWRAKRTLYRYSDDELLE
FT                   LKQVIQKLQSDTKEICIIFNNNSGKDAAPNALKLQEFLNITFDNLGPKPPEQLNFF"
FT   gene            complement(394087..395178)
FT                   /locus_tag="LSL_0362"
FT   CDS_pept        complement(394087..395178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0362"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /note="COG2404 [R] Predicted phosphohydrolase (DHH
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99175"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV10"
FT                   /protein_id="ABD99175.1"
FT                   /translation="MANKQHIKIFSHNDLDGFGAPVLLKTLQPYLFKNATFDLTTCSAG
FT                   NLDRELSYWFRQPSLHQYTDVFIADMTPDSDYSFQQLEQHFPNHWLIFDHHESEEKLRQ
FT                   KYRQNCITPTNTDINPSATSLVWDWVSQNVNFSNIPSKRQNDLHYLVELIRAYDTWDWK
FT                   NDPNMDSATRLAADELNQLFWFYPLSRSEMFVTEVFGTSWEQYRQNNSLLINTLNGRRQ
FT                   RYLDKHLKSVLTFELDGHSFGIVYASDYKSEIAHALLKNHPVDAALVIDNRSISLRSNG
FT                   KLDVASFSEKYFNGGGHSDSAGGTLEFNPVETGEQAVIDALKHQFEINKKLEKQEKEES
FT                   SSTFADNLDPEIAAKLASLFNNN"
FT   gene            complement(395291..395602)
FT                   /gene="def"
FT                   /locus_tag="LSL_0363"
FT   CDS_pept        complement(395291..395602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="LSL_0363"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 [J] N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99176"
FT                   /db_xref="GOA:Q1WV09"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV09"
FT                   /protein_id="ABD99176.1"
FT                   /translation="MIRDINHDVKILSKKSTPASKNDIAIVQDLVDTLNYHRDHCVGMA
FT                   ANMIGKNKCIIACQFGPLIVAMINPVITKKSQKYSTSEGCLSLTGERETTRFNKIEVS"
FT   gene            395701..396417
FT                   /locus_tag="LSL_0364"
FT   CDS_pept        395701..396417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0364"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99177"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV08"
FT                   /protein_id="ABD99177.1"
FT                   /translation="MEEEYIQNLKNYLVEFDKLPIAKKKITALLEADNCYKKGKIPIKS
FT                   LPNLEFTETEILEHLTEFPNIMELESHLLDFREYIIEEYGIWHIYSQEWLQDLKAFLAN
FT                   EQTLMIMAGNAVLGKFLKNIICTDNLDWRHQDNERPNPWTDVEQLDALEAVKKYLNNVS
FT                   NIIIEWCPDSTDTDIKVLHYLRQKKWKGNLIVLGEKQGATNSKAFWKEAHLERPVNLNQ
FT                   HHKPFDFIKDHVYLAK"
FT   gene            complement(396466..397395)
FT                   /locus_tag="LSL_0365"
FT   CDS_pept        complement(396466..397395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0365"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1597 [IR] Sphingosine kinase and enzymes related
FT                   to eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99178"
FT                   /db_xref="GOA:Q1WV07"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV07"
FT                   /protein_id="ABD99178.1"
FT                   /translation="MIEKKYFFIINPIAGNGRGLAAWKKIRKTLQEQGISYTHKYTFPN
FT                   QESNQEMILNTVDENHIIVVLGGDGTINEILNILIDCHLQNPLSYIACGSGNDFARAIS
FT                   LPSNPLKAWKYIHHQATIKKICVGKVKINDTERYFLNNVGIGFDARIVYSANHSKLKML
FT                   LNKIHLGALVYASFFLKALIIQKFFPTLFKNDGTSVQKYKKTFLCTITNHPFFGGGVKL
FT                   VPEASVFNQSIDAIILEKSTKLGFLINFLRTILPLKNPSNSKNWHHQYGKEFKITINSH
FT                   QPIHIDGEASIIDLDTVSFDTITFPFLA"
FT   gene            397556..397783
FT                   /locus_tag="LSL_0366"
FT   CDS_pept        397556..397783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0366"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG4892 [R] Predicted heme/steroid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99179"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV06"
FT                   /protein_id="ABD99179.1"
FT                   /translation="MAEKIFTLDELKNYDGKEGRKAYIAVDGVVYDVTNVAAWQGGTHH
FT                   GNNAGNDVSDRIVKAPHGKSTLEKLEVVEN"
FT   gene            complement(397841..398419)
FT                   /locus_tag="LSL_0367"
FT   CDS_pept        complement(397841..398419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0367"
FT                   /product="Sigma-70 factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99180"
FT                   /db_xref="GOA:Q1WV05"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV05"
FT                   /protein_id="ABD99180.1"
FT                   /translation="MNLNLDNILLENFKEQPSDDNFNKLFQKYTPLVFKLINSYHFTFY
FT                   ERDDLIQEAKIVCYSSALRYRLPSNITFGYYFQINLRNKYNSLYRLEHAYKRKSEREST
FT                   SYEQMSSNLKEVVIGSDYKNHAPDKNILVKEAIQAFLHSLDEKNCRLFRDIISGKVQKE
FT                   DILQDSKLRYRYYKLKNQYKNNVFDIFFK"
FT   gene            complement(398488..399291)
FT                   /locus_tag="LSL_0368"
FT   CDS_pept        complement(398488..399291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0368"
FT                   /product="Regulatory protein recX"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99181"
FT                   /db_xref="GOA:Q1WV04"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:3E3V"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV04"
FT                   /protein_id="ABD99181.1"
FT                   /translation="MVKKITMIQTQKKVGRFNIYINNKYAFPVSESILIKYRLHKGQEL
FT                   DENLIEEIKLADDISKGYNAALNYLSYQLRTRKEVEDKLRSLDIHEDYISEIINKLIDL
FT                   DLINDKNYAESYVRTMMNTSDKGPKVIKLNLSKKGIDDNIAEDALILYTDKLQVEKGVT
FT                   LAEKLANRYSHDSYRNKQNKIKQSLLTKGFSYDIIDTIIQELDLIFDDDTEREILLEKA
FT                   NKLWSRYDNLDIKKRKFKIQQALFKQGFSFSNITSALDEIEDTNI"
FT   gene            399377..400756
FT                   /gene="trmA"
FT                   /locus_tag="LSL_0369"
FT   CDS_pept        399377..400756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="LSL_0369"
FT                   /product="tRNA (Uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="COG2265 [J] SAM-dependent methyltransferases related
FT                   to tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99182"
FT                   /db_xref="GOA:Q1WV03"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV03"
FT                   /protein_id="ABD99182.1"
FT                   /translation="MQKVKNDIKIKVGQKFPLTIKRLGINGEGIGYFKRKITFVPQALP
FT                   GEVILAEVTKVHPKYLNAKIKKIRKASPDRVEPVDNYDVGGIELEHLAYSKQLEFKTDV
FT                   IRQSLEKFKPTNYENMELRPTLGMEVPYEYRNKAQFQVRKVKGNKVIAGLYKPNSHILV
FT                   DLPTFKTQMPLTMEIMRKIVKLLEKWNISIYDERRNSGILKTVVIRQTLKTEQVQIVFV
FT                   TARNNCANLNQVVNEIMAAYPQIVSVMQNINPSRSSLVWGEETFKLAGTDRLLEQLGDI
FT                   KFELSARSFFQLNPSQTEVLYTEVKKALDLKEDETLVDAYCGVGTIGLFVSPDAKEVRG
FT                   MDIIPEAIEDAKKNAELSGRKNIHYEVGKAEDLFAKWTKNDFVPDALVVDPPRTGLDDK
FT                   MIETILKYRPNKFVYVSCNPSTLARDLVKLVKIYNVEYIQSVDMFPQTARVEAVVKLSK
FT                   K"
FT   gene            400884..401429
FT                   /locus_tag="LSL_0370"
FT   CDS_pept        400884..401429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0370"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3557 [J] Uncharacterized domain/protein
FT                   associated with RNAses G and E"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99183"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV02"
FT                   /protein_id="ABD99183.1"
FT                   /translation="MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCN
FT                   DHTLVTESDGRRWITREPALVYFHKHYWFNIVTMIRENGVSYYCNLASPAVLDKEALKY
FT                   IDYDLDVKVFPNGEKRLLDVDEYEDHGNKWHYSADIDKILKHNVRVLVDWINNGKGPFS
FT                   KEYVEIWYNRYLELSRQQ"
FT   gene            401530..402660
FT                   /locus_tag="LSL_0371"
FT   CDS_pept        401530..402660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0371"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0628 [R] Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99184"
FT                   /db_xref="GOA:Q1WV01"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WV01"
FT                   /protein_id="ABD99184.1"
FT                   /translation="MPNKKNLMFWSLEILIVATLIWVCMKINFVFQPVAAFFSTLFIPV
FT                   IISGFLYYMLLPLVKLLMKVKIGKFKINRTGAVAIVFIAVFAIIAMSIAFLLPKIIVQV
FT                   ENLITKSPTYVSQLEKNFQHFLKYDSRSSWLKDIDLQSYLNRFEGSGSEMIAKFMKSLT
FT                   NSLGSIISAITNITVTVLTVPFMLFYMLKDGYKLMPSILKFVPRKRTAQVEAMLQDMSN
FT                   TLSKYISGQAIECIFVGICTAIGYGLAGVPYALLTGIFAGATNIIPYIGPYIGLVPALI
FT                   LSLTDSFNTAVMAIIVCIIVQQIDGNLIYPNVIGKSVDIHPLTIILLLLVAGKIAGLLG
FT                   IILCIPFYAIIKVIVKHVREVIILENESSDEAKIEK"
FT   gene            402745..403761
FT                   /gene="gpsA"
FT                   /locus_tag="LSL_0372"
FT   CDS_pept        402745..403761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="LSL_0372"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="COG0240 [C] Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99185"
FT                   /db_xref="GOA:Q1WV00"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WV00"
FT                   /protein_id="ABD99185.1"
FT                   /translation="MTEKIAVLGAGSWGSILAGVLDENKNEVWLWTNKESQAKELNENH
FT                   TNEHYIPGHKYSETIKATTNLKEAVDGASAVLFVVPTKVIRLVAQQLVEVLKELGQKPL
FT                   IIHASKGLELGSHKRISEVIEEEIPSEYRKDVVVLSGPSHAEEVARKDITLITAACENL
FT                   DSAKKVQSLFMNDYLRIYTNKDVIGVETGAAFKNVIAIGVGALHGLGYGDDAKAALMTR
FT                   GLAEISRLGVAFGADPLTFIGLSGVGDLIVTCTSVHSRNWRAGNQLGKGKALDEVIQDM
FT                   GMVIEGINTCKAAYELAQQKNIEMPITEAIYNVLYNGKDIKDEISLLMQREGKEEIK"
FT   gene            403895..405337
FT                   /gene="tagH"
FT                   /locus_tag="LSL_0373"
FT   CDS_pept        403895..405337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagH"
FT                   /locus_tag="LSL_0373"
FT                   /product="Teichoic acid translocation ATP-binding protein"
FT                   /note="COG1134 [GM] ABC-type polysaccharide/polyol
FT                   phosphate transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99186"
FT                   /db_xref="GOA:Q1WUZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ9"
FT                   /protein_id="ABD99186.1"
FT                   /translation="MEKISIKYLTKKSPLLSDKNKKSENNFWSLRGITFSVTEGEAIGL
FT                   IGRNGSGKALLLKILAGLEEPTTGFISTKSHIYLASMTNSINFQLTGLENIKKQVDQAY
FT                   DDEIEADHVVKAIIDFTEIGQWVYRPVSEYSTGMLSRLALSIALFNKPEVVLLDEVFAS
FT                   LERAFFEKVIRKIQDLKDHGVSFIITATTGLVLETLCERSMWLDFGEVKELGPTQIVMS
FT                   KFQYQNDWYNGLTLPEKNKYLKEKQIEQENFDITKVYNEFKVEQFEHGYTRRDEPRMKK
FT                   AFYHNHRQDPVISEAEKEVKNNNLNKNVKGHKKKKGNKGLVRVVGVVLVLILLLGAGKV
FT                   LHSHHETKNRQVESSKKVEAKKRYSKSVSISKAEEASKQSKIESSKKEQSLAESKRASE
FT                   ASASSAAAASESARKASESAASESKASMLSNSQEVTVNDGDTLATIASQYGTTAQAIQD
FT                   LNDMGTSNSLTAGQTIRVPNSN"
FT   gene            405426..407003
FT                   /locus_tag="LSL_0374"
FT   CDS_pept        405426..407003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0374"
FT                   /product="Bacterial Peptide Chain Release Factor 3"
FT                   /note="COG4108 [J] Peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99187"
FT                   /db_xref="GOA:Q1WUZ8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUZ8"
FT                   /protein_id="ABD99187.1"
FT                   /translation="MDKKQLEESVNNRRTFAIISHPDAGKTTITEQLLLFGGVVRKAGT
FT                   VKAKKSGNFAKSDWMEIEKKRGISVTSSVMQFDYAGKRVNILDTPGHEDFSEDTYRTLM
FT                   AVDSAVMVIDSAKGIEPQTKKLFQVCRMRGIPIFTFINKLDRDGREPLDLTAELEDVLG
FT                   IESYAMNWPIGMGKGLKGLYDIYNHRIELYRSEDEGQAFLELDDNGEIKGDNPLKDESI
FT                   YKQVLEEIELIEGAGSEFDEEKIAKGELTPVFFGSALTNFGVKTFLDAYLKYAPKPAAH
FT                   KTEDGSEVEPDRKDFSGFIFKIQANMNPNHRDRIAFVRICSGEFDRGMDVFLERTGKKL
FT                   RLSNSTQFMADTRETLETAVAGDIIGLYDTGNFQIGDSIYTGKKAVKFEKLPQFTPELF
FT                   MRVTAKNVMKQKSFHKGIQQLVQEGAVQLYQSYSTGDYILGAVGQLQFEVFQFRMANEY
FT                   NSEVVMTPMGHKIARWIDPEQLDEKMSSSRNLLVKDRAGMPLFLFENEFAERWFMDKYP
FT                   DVKLTAKL"
FT   gene            407319..408092
FT                   /locus_tag="LSL_0375"
FT   CDS_pept        407319..408092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0375"
FT                   /product="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ7"
FT                   /protein_id="ABD99188.1"
FT                   /translation="MRSKILKSLAVITCFAMTILVLVGCSKADKDGYYDNAFMTALEKG
FT                   LVARWKISDKEDSKSSYKKAVQAELDSVEEYQDKKFKNTQLKAAALDYINGLKEQKSVL
FT                   KYWGADDFDERWSAAYDKRTAALVAINKIHKIKVSEKQDNLSELLGNGKSVNEKENLKK
FT                   KIDAMLAKAKVERDDSEDLDGEYVNIIIKNNTGKDYSFLTATVKFKDKDGVVVDSQDVT
FT                   AEGLADGETTRLRPYVETKDWETYQLVLNSYELKK"
FT   gene            408327..411350
FT                   /gene="lacZ"
FT                   /locus_tag="LSL_0376"
FT   CDS_pept        408327..411350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="LSL_0376"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="COG3250 [G] Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99189"
FT                   /db_xref="GOA:Q1WUZ6"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ6"
FT                   /protein_id="ABD99189.1"
FT                   /translation="MENTKAKLSWLEKPDVFAINRLEAHSSHKFYASQEEYQNKKTSLK
FT                   QSLNGLWKFSYAQNPDLRVKKFYKEDFNDSGFDTIKVPGHIQTQGYDHLQYINTQYPWD
FT                   GLDELRPPYISRKYNPVGSYVKTFTVDKSLKNKRIFISFQGVETAMYLWLNGKFIGYSE
FT                   DSFTPHDFELTDFIREDSENRLAVEVYKRSSASWIEDQDMFRFSGIFRDVFLYAIPEVH
FT                   VRDIFAKTTLDDSYKDGILLLDTKLEGNLENTEINVELYDEDQVVWSQKEKAREKTFID
FT                   IKLENIKKWSAETPYLYDLKITLVKNGEVIEVATQKIGFRRFEMKDGIMLINGKQIIFK
FT                   GVNRHEFDYLHGRAISEDVMLHDIKFFKQNNINAVRTSHYPNQTRWYELCDEYGIYVID
FT                   ETNLESHGSWQKLGECEPSWNVPGSKEEWLDNVLDRANSMFQRDKNHASVIIWSCGNES
FT                   YAGDDIVKMHDFFHKVDDSRLVHYEGVTWNRDFEEATDMESRMYAKPQEIEEYLQGNPS
FT                   KPYISCEYMHSMGNSTGGMKLYTDLEDKYPQYQGGFIWDYVDQAMLKTDDFGEKVLGYG
FT                   GDFDERATDYEFSGDGIVFADSTPSPKAAEVKQLYANVKVKVTEEGVIIKNDNLFIDTS
FT                   AYIFETIVKRDGQKIWQKDYSFNVLPQTKQEEVIDWPNIEKIPGEYIFEVNVCLKESVA
FT                   WANERHELSFGQLVTKVSSKDNEIVSGKLNVVHGDVNIGINGDGFSVLLSRAEGGIVSL
FT                   AYNGKEYITRTPKTTFWRAMTDNDRGVKHGFDRGVWLQAGLYQKLVDVNVKEELGEITV
FT                   SFKWKLPLAKEVYNVISYTVTPDGKVKVTAKYFGVDGLPSLPAYGYELKLKRKYNQYKF
FT                   YGLGPDENYIDRDNGVKLGIYEGDADTNLAPYLVPQETGNHRGTRWLEVTDVYGEGLRF
FT                   VANGDTFESSVLPYSEYEIEQAMHQEELSNPHYTWVRLLAAQMGVGGDDSWGAPVQKQF
FT                   WIPSNKELTVSFTIEPTI"
FT   gene            411554..415003
FT                   /pseudo
FT                   /locus_tag="LSL_0377"
FT   misc_feature    411554..415003
FT                   /pseudo
FT                   /locus_tag="LSL_0377"
FT                   /note="Similar to sugar transport protein; nonfunctional
FT                   due to insertion of IS element"
FT   gene            412062..413351
FT                   /pseudo
FT                   /locus_tag="LSL_0378"
FT   misc_feature    412062..413351
FT                   /pseudo
FT                   /locus_tag="LSL_0378"
FT                   /note="Similar to transposase ISLasa4d, ISL3 family;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            complement(415063..416061)
FT                   /gene="galR"
FT                   /locus_tag="LSL_0380"
FT   CDS_pept        complement(415063..416061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galR"
FT                   /locus_tag="LSL_0380"
FT                   /product="Galactose operon repressor"
FT                   /note="COG1522 [K] Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99190"
FT                   /db_xref="GOA:Q1WUZ5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ5"
FT                   /protein_id="ABD99190.1"
FT                   /translation="MATIKDIAKLAGISPATVSRVLNYDESLSVGDETKRRIFKTAEKL
FT                   NYSKHKKKNKEEHLNKIAIVQWYAEAQELTDLYYYSIRLGIEKRAQELGYEVVRIFHDD
FT                   PLDAIQNVDGIIAIGKYSTNEIQQLDNLNANLIFVDSDSLSNGFSCVVTDFQNSVITVL
FT                   DHFLEKGQKNIGLLAGEEHTSDNSQTLIDLRFTIFKDYLSRLNLYNHQNVYVRSFNPES
FT                   GYKMMKKAIVELGDNLPEAFFTANDAIAIGAVRALQEEKISIPDRVSIISFNDTSITKY
FT                   VYPSLSSIKVFTEEMGVEAVNLLLDYIAHPFNVAKKVTLGTKLVLRDSTIN"
FT   gene            416233..417396
FT                   /gene="galK"
FT                   /locus_tag="LSL_0381"
FT   CDS_pept        416233..417396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="LSL_0381"
FT                   /product="Galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="COG0153 [G] Galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99191"
FT                   /db_xref="GOA:Q1WUZ4"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUZ4"
FT                   /protein_id="ABD99191.1"
FT                   /translation="MDKKVINDKFTEIFGEQAEATFFSPGRINLIGEHTDYNGGHVFPC
FT                   AISLGTYGAARKREDNKLRFYSANFEDLGIIETSLDDLKYDKKDNWVNYAKGMIYFLKE
FT                   TGHDVDKGMDIFIEGNIPNGSGLSSSASLEMLIGVIAQELFNLDIDRVDLVKLGMETEN
FT                   KFIGVNSGIMDQFAVGMGKQNQAILLDTNTLEYSYAPVDMGNNVIVIMNTNKRRELADS
FT                   KYNERRSECETAVGELQAKLDIKTLGELDAQTFDEYAYLIEDENRLKRARHAVWENQRT
FT                   MQAQAALEEGDLEKFGRLVNASHVSLEHDYEVTGIELDTLAHTAWKQEGVLGARMTGAG
FT                   FGGCGIAIVDKDKVEAFKENVGKVYTEKIGYAPAFYIAEIADGTKVL"
FT   gene            417424..418419
FT                   /gene="galE"
FT                   /locus_tag="LSL_0382"
FT   CDS_pept        417424..418419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="LSL_0382"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="COG1087 [M] UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99192"
FT                   /db_xref="GOA:Q1WUZ3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ3"
FT                   /protein_id="ABD99192.1"
FT                   /translation="MATLVLGGAGYIGSHTVDRLIEKGEKTIVVDSLVTGHRQAVNKDA
FT                   KFYQGDIADKDFMRQVFKENSDIDAVIHFAAYSLVAESMKKPLKYFDNNTAGMVKLLEV
FT                   MNEFSIDKIVFSSTAATYGIPEEVPIKETTPQNPINPYGESKLMMEKIMRWADEAYGIK
FT                   FVPLRYFNVAGAKPDGSIGEDHMPETHLLPIVLQVAMGKRDKLQIFGDDYNTPDGTNIR
FT                   DYVHPLDLADAHILAVDYLKAGNPSTAFNLGSSTGFSNREILEAARKVTNKEIPAEIAP
FT                   RRGGDPDVLVASSTKAREVLGWKPQFDDISKIIETAWKWHTLHPEGYQDK"
FT   gene            418438..419925
FT                   /locus_tag="LSL_0383"
FT   CDS_pept        418438..419925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0383"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /note="COG4468 [G] Galactose-1-phosphate uridyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99193"
FT                   /db_xref="GOA:Q1WUZ2"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUZ2"
FT                   /protein_id="ABD99193.1"
FT                   /translation="MDDKLLLDTFIKQVIEQENYTELDRNYLYNRILNLVGEGVEKLTT
FT                   TKNEIIDLKNELVEYAVQHGKVGETLNEQDCLGAELMNFITPLPSKVNQDFWQTYQQKS
FT                   PEEAIQNFYDLSKRNDYIKTKAIAKNIYFPVETSYGQLEITINLSKPEKDPKQIALAKK
FT                   MKASGYPLCQLCMENEGYQGRINYPARANHRIIRFDLDDKQWGFQYSPYAYFNEHCIFL
FT                   DTIHEPMEITKQTFNNLLGIIEQFPGYFVGSNADLPIVGGSILTHEHYQGGRHTFAMEK
FT                   APIETELKFAGYEDIQAGIVKWPMSVIRLRGNSKEDLVDLADKILKTWRGYSDEEVSVL
FT                   AESNGEKHHTITPIARKRDGQLELDLVLRDNQTSEQYPDGIYHPHPDVQHIKKENIGLI
FT                   EVMGLAILPPRLKGELQEVEKYLLGQENKMEEYHQVWADDIKQKYSDISQENVGTIIQQ
FT                   ELGRVFARVLEDAGVYKHDETGRMAFKRFVEEVGIVD"
FT   gene            419957..422152
FT                   /pseudo
FT                   /locus_tag="LSL_0383b"
FT   misc_feature    419957..422152
FT                   /pseudo
FT                   /locus_tag="LSL_0383b"
FT                   /note="Similar to alpha-galactosidase; nonfunctional due to
FT                   interrupting stop codon"
FT   gene            complement(422195..423235)
FT                   /locus_tag="LSL_0384"
FT   CDS_pept        complement(422195..423235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99194"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ1"
FT                   /protein_id="ABD99194.1"
FT                   /translation="MAFLDSVKNLMKFNKNNETKQKNDVSTVEKSDLSDKNKEPITKVG
FT                   HNATLIIIYQDDRGQSLTTPQIISGYIGEELHLRFKEFPNYDLINISGFTSAFVDPYGS
FT                   ITLTYRKHQGADVWLFSQDIDKQKLLMRPVFIRGDFGERFELNAPTIPDYSLQKAVGPT
FT                   RGVFSDKQQLVTYYYRKSRWKIVDHNVHYLRINSYCLSYTEPEGHDISVTLAPDTIWQT
FT                   FESIQLINNDWWYNIGGNAWVKFDEQRMELLENNPYTLSDTLKIAPIQDDPELSIPEPV
FT                   KLSVTAEINFVPNQKLALYDRPFGKKINEIENGKTVLITARNRVGRMLWFEVDGLGWTI
FT                   WEYLQF"
FT   gene            complement(423384..423659)
FT                   /locus_tag="LSL_0385"
FT   CDS_pept        complement(423384..423659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0385"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99195"
FT                   /db_xref="InterPro:IPR014959"
FT                   /db_xref="InterPro:IPR038226"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUZ0"
FT                   /protein_id="ABD99195.1"
FT                   /translation="MHLVDVTASHAKDIQRELAATPVHFIKVYTLGNSRVVYKKKHGFS
FT                   EIVISNKLRGITDKEINFVVEKLLKNDTKNMEITKQKSLVEIIVNN"
FT   gene            complement(423785..425977)
FT                   /gene="clpE"
FT                   /locus_tag="LSL_0386"
FT   CDS_pept        complement(423785..425977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="LSL_0386"
FT                   /product="ATP-dependent clp protease ATP-binding subunit"
FT                   /note="COG0542 [O] ATPases with chaperone activity,
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99196"
FT                   /db_xref="GOA:Q1WUY9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY9"
FT                   /protein_id="ABD99196.1"
FT                   /translation="MLCQNCHKNPATIHLTTNLNGRQTSIDLCQNCYQEIKNEANGFNN
FT                   IGQDPFGFGSLDDIFKAISNPNFSNQQSMSQEPPTQNSRIGGNNGNRNGDSSILGQYGL
FT                   DLTEEAKNGQIDPVIGRDKEIARVIEILNRRTKNNPVLIGEAGVGKTAVVEGLAQKIVN
FT                   GDVPQKLIGKKVIRLDVVSLVQGTGIRGQFEQRMQQLMKELKQQKDVILFIDEIHEIVG
FT                   AGNAEGGMDAGNVLKPSLARGEFQLVGATTLNEFRTIEKDAALARRLQPVQVDEPSVEE
FT                   TIKILNGIRNKYEAYHHVKYTDEALRAAVTLSNRYIQDRFLPDKAIDLLDESGSRKNLT
FT                   IHATDPKIIEERIKNAENQKQAALKEENYEKAAYYRDQVSRFEKMKDNASDKDTPVVTE
FT                   KDMEHIIEEKTNIPVGELKAKEKEQLRDLGSSLEKHVIGQDEAVDKVARSIRRNRIGFN
FT                   KSGRPIGSFLFVGPTGVGKTETAKQLARELFGTEDSMIRFDMSEYMEKFSVSKLIGSPP
FT                   GYVGYEEAGQLTEQVRRHPYSLILLDEVEKAHPDVMHMFLQILDDGRLTDSQGRTVSFK
FT                   DTIIIMTSNAGSGDSVVSVGFGAEANGSSHSVIDKLTKYFKPEFLNRFDDIIEFNPLSK
FT                   DNLVKIVRLMLDDVNKMMADQNMHIDVSDKVADKLAELGYDPKMGARPLRRVIQEQIED
FT                   KIADFYLDNPNVQNFVADLDENGDIVIKSKSEKNED"
FT   gene            426126..426320
FT                   /locus_tag="LSL_0387"
FT   CDS_pept        426126..426320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0387"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99197"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY8"
FT                   /protein_id="ABD99197.1"
FT                   /translation="MEKDYTALLDELREGTLDKLEINTEEFMDFQKAFMNYSHRKNIVG
FT                   TAKRGGGATYIYSKESKLI"
FT   gene            426579..426845
FT                   /gene="ptsH"
FT                   /locus_tag="LSL_0388"
FT   CDS_pept        426579..426845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="LSL_0388"
FT                   /product="Phosphocarrier protein HPr"
FT                   /note="COG1925 [G] Phosphotransferase system, HPr-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99198"
FT                   /db_xref="GOA:Q1WUY7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY7"
FT                   /protein_id="ABD99198.1"
FT                   /translation="MEKKEFHVIAETGIHARPATLLVQAASKFNSDVTLEYNGKSVNLK
FT                   SIMGVMSLGVGQNADVVISADGADEAEAIAAIEETMKKEGLAE"
FT   gene            426845..428566
FT                   /gene="ptsI"
FT                   /locus_tag="LSL_0389"
FT   CDS_pept        426845..428566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="LSL_0389"
FT                   /product="Phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="COG1080 [G] Phosphoenolpyruvate-protein kinase (PTS
FT                   system EI component in bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99199"
FT                   /db_xref="GOA:Q1WUY6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY6"
FT                   /protein_id="ABD99199.1"
FT                   /translation="MTKVLNGIAASDGIAAAKAYMLVQPDLSFEEKTIDNPDAEIERLS
FT                   AAVETSKQELEVIKQKATENLGAEEAQVFEAHLTILSDPELFGQINDKIKNDKVNAEAA
FT                   LKSVTDMFIQMFEAMEDNAYMQERAGDIRDVTKRVIGHLLGVSIPNPALINEEVVIVAH
FT                   DLTPSDTAQLDRNFVKGFITDIGGRTSHSAIMSRTLEIPAVVGSGNATSEISEGQMVII
FT                   DGLDGQALVEPTDEELEDYKARAKAFADQKAEWKLLKDAKSVTADGKEVKLAANIGTPK
FT                   DVEGANDNGAEAVGLFRSEFLYMDASELPSEEDQFKAYKAAVEGMNGKQVVVRTMDIGG
FT                   DKELPYLPLPEEQNPFLGYRAIRISLDRQDIFRTQLRALLRASHYGSLAIMFPMIATVQ
FT                   EFKDAKAIFEEEKAKLVADGVPVSDDIEVGMMMEVPAAAMVADKLAKYVDFFSIGTNDL
FT                   IGYSMAADRGNEKISYLYQPYNPSILRLIKNTIEASHKEGKWTGMCGEMAGDQVAVPIL
FT                   LGLGLDEFSMSATSILKTRSLLKTLDSKKMEELADKAVNDCETADEVVELVNQYTK"
FT   gene            428743..429942
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0390"
FT   CDS_pept        428743..429942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0390"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="COG0438 [M] Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99200"
FT                   /db_xref="GOA:Q1WUY5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY5"
FT                   /protein_id="ABD99200.1"
FT                   /translation="MNIGIFTDTYYPQVSGVATSIKTLREQLEKQGHTAYIFTTTDPNV
FT                   DKSIYERNIFRFSSIPFISFTDRRIAVRGLFHAYQVAKELNLDIIHTQTEFSMGLIGKF
FT                   VAKNLKIPCIHTYHTMYEDYLHYVAKGRLLKPYHVKQMSKSFCYHMSGIVAPSLRVKET
FT                   LERYGIDEPIEIIPTGVDISKFSKSTNENIREKYKINPEQPLLLTLSRLAFEKNIDKLL
FT                   NAMPDILARVPETKLMICGDGPARESLVQQVSDMNLTDSVIFTGEINNDEVGSYYKAAD
FT                   VFVSTSVSESQGLTYIEAIASGTKVITTHSPYTDSILTDASIGMAFTGEDELVNKVVDY
FT                   LLNGEKYNDSKPREELLNSISADNFGRKVISFYEKCMLDFDMKKKLRFNSDELNKAKGR
FT                   "
FT   gene            429945..430955
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0391"
FT   CDS_pept        429945..430955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="LSL_0391"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="COG0438 [M] Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99201"
FT                   /db_xref="GOA:Q1WUY4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY4"
FT                   /protein_id="ABD99201.1"
FT                   /translation="MIKIGMFSSATKVKGQGVGSAYTELINLLKKYYSQELNIEINKFN
FT                   RVNISHYHTIDPQFYLSTFLPGRGCKIGYVHFLPETIDGSLKLPWLAKKVFFKYIISFY
FT                   KRMDQLVVVNPSFIEKLTAYGIKREKTTYIPNFVSSDTFYKISDSKENLRKKLNLDNKF
FT                   TIVGVGQVQERKGVPDFVKLAKLNPEIQFVWVGGFSFGAITDGYDELKKVIKNPPANLK
FT                   FPGIVDRDKMNEYYNAADLFLLPSYNELFPMSVLEAFSSGLPVMLRDLDLYYSIIDGYY
FT                   EPAKDVDDMNKKIINLSQDRKKLEKLEEKSKKAAEYYSERRLAKIWLAYYQKFSR"
FT   gene            430960..431979
FT                   /locus_tag="LSL_0392"
FT   CDS_pept        430960..431979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0392"
FT                   /product="Hypothetical secreted protein"
FT                   /note="COG0392 [S] Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99202"
FT                   /db_xref="GOA:Q1WUY3"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY3"
FT                   /protein_id="ABD99202.1"
FT                   /translation="MTRKNRIVLFIMFGIGIAIFLFSLREISFRSFVHDVTTLNLWWLG
FT                   IAFLCMFLSLVFEALVIKILVQRQIKSYPFFDALRVPMLEQLFNGITPFSTGGQPAQLF
FT                   ALMQSGLDAGRATSSTLMKFIVYQAMIVVNFVLCLLIGFNFIQEKIHTLAWLVVFGFII
FT                   HLAVIVSLLMVMYWYDFTKKFIKVTLLPIKWIFNDEKYRNWNKIVDEKIDNFYEESLKL
FT                   KSNWKLLLKISAITFVQLAVYYIIPYFILLSLGVTHVNVIMVISMHVLIVMVVSLFPIP
FT                   GGAGGAEYSFSVIFSSFIGTGSKLVLAMLLWRIVTYYFGMLSGLIAMLIQPKRIVTKK"
FT   gene            432107..432340
FT                   /locus_tag="LSL_0393"
FT   CDS_pept        432107..432340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0393"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99203"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY2"
FT                   /protein_id="ABD99203.1"
FT                   /translation="MENSQLVAIITRLDAMAKSDSDEVQVRRFEKNGSERGQVAYDPTT
FT                   NTYTLEEMQTHQKFEFDDIDLAAIEIFDLLDD"
FT   gene            432452..434521
FT                   /locus_tag="LSL_0394"
FT   CDS_pept        432452..434521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0394"
FT                   /product="Sulfatase family protein"
FT                   /note="COG1368 [M] Phosphoglycerol transferase and related
FT                   proteins, alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99204"
FT                   /db_xref="GOA:Q1WUY1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY1"
FT                   /protein_id="ABD99204.1"
FT                   /translation="MRLALRKIRDGLSTRIGFFTLTLFLFWMKTYIVYNTKFTLGVSDG
FT                   MQEFLLALNPIPAGLLLFGIALYFRGRKSYWIMIVINLLQSLWLFANILYYREFSDFLS
FT                   MSIIKSSGSVSNNLSLSISQIIHGTDFLVFLDVIILALLVIFKVIKPDLSPVKIWRPII
FT                   ITVSSLVLFAINLGLAEKDRSQLLTRTFDNNYIVKYLGLDFFAGYSTYQAHQESATKAN
FT                   ASKKDLDEILKKINKNRTSPNIEYYGKAKGKNVFIFHLESFQQFMIDYKVNGEEVTPNI
FT                   NKFYHDSNTLAFDNFFNQVGQGKTSDAETMLENSLYGLPSGSAMTSYGAGNTFQALPAM
FT                   LDQRGYTTAAFHGDVGSFWNRDNTYKSWGYQYFFSKDYYKSKKDYNIGYGLKDKIFLKQ
FT                   SVKYIEQLPQPFYAKIITLTNHYPYELDKKNQSIAKTTTGDATVDGYVQTARYLDQSFE
FT                   EFINYLKKAGLYDNSMIVVYGDHYGISNNHKKAIAQLLGKKKVTSYDLAMFQKVPFMIH
FT                   LNGLKGGINHTYGGEIDVMPTLMDLLGIKDTGTVQLGQDLLSNNRSQTVAFRNGDFVSP
FT                   VYSKIGSKVYNNNGEVVNSKLTSKESKEVEKQQDEVDSELNMSDKIITGDLLRFYNLEG
FT                   FKKVDKSQYTYKKSVALKELKEAQKKKKTSLLTKNNGKSTEDMFSTDAPELKEK"
FT   gene            434853..436380
FT                   /locus_tag="LSL_RNA021"
FT   rRNA            434853..436380
FT                   /locus_tag="LSL_RNA021"
FT                   /product="16S ribosomal RNA"
FT   gene            436484..436558
FT                   /locus_tag="LSL_RNA121"
FT   tRNA            436484..436558
FT                   /locus_tag="LSL_RNA121"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA Ile anticodon GAT, Cove score 91.61"
FT   gene            436590..436662
FT                   /locus_tag="LSL_RNA122"
FT   tRNA            436590..436662
FT                   /locus_tag="LSL_RNA122"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA Ala anticodon TGC, Cove score 84.64"
FT   gene            436789..439568
FT                   /locus_tag="LSL_RNA025"
FT   rRNA            436789..439568
FT                   /locus_tag="LSL_RNA025"
FT                   /product="23S ribosomal RNA"
FT   gene            439813..439929
FT                   /locus_tag="LSL_RNA108"
FT   rRNA            439813..439929
FT                   /locus_tag="LSL_RNA108"
FT                   /product="5S ribosomal RNA"
FT   gene            439935..440007
FT                   /locus_tag="LSL_RNA123"
FT   tRNA            439935..440007
FT                   /locus_tag="LSL_RNA123"
FT                   /product="tRNA-Asn"
FT                   /note="tRNA Asn anticodon GTT, Cove score 79.59"
FT   gene            440022..440111
FT                   /locus_tag="LSL_RNA030"
FT   tRNA            440022..440111
FT                   /locus_tag="LSL_RNA030"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Ser anticodon GGA, Cove score 49.17"
FT   gene            440126..440200
FT                   /locus_tag="LSL_RNA124"
FT   tRNA            440126..440200
FT                   /locus_tag="LSL_RNA124"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA Glu anticodon TTC, Cove score 67.87"
FT   gene            440203..440275
FT                   /locus_tag="LSL_RNA032"
FT   tRNA            440203..440275
FT                   /locus_tag="LSL_RNA032"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Val anticodon TAC, Cove score 85.97"
FT   gene            440285..440357
FT                   /locus_tag="LSL_RNA125"
FT   tRNA            440285..440357
FT                   /locus_tag="LSL_RNA125"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA Asp anticodon GTC, Cove score 71.42"
FT   gene            440383..440458
FT                   /locus_tag="LSL_RNA126"
FT   tRNA            440383..440458
FT                   /locus_tag="LSL_RNA126"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA Phe anticodon GAA, Cove score 84.43"
FT   gene            440463..440545
FT                   /locus_tag="LSL_RNA035"
FT   tRNA            440463..440545
FT                   /locus_tag="LSL_RNA035"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 67.21"
FT   gene            440558..440631
FT                   /locus_tag="LSL_RNA036"
FT   tRNA            440558..440631
FT                   /locus_tag="LSL_RNA036"
FT                   /product="tRNA-Trp"
FT                   /note="tRNA Trp anticodon CCA, Cove score 65.21"
FT   gene            440638..440710
FT                   /locus_tag="LSL_RNA037"
FT   tRNA            440638..440710
FT                   /locus_tag="LSL_RNA037"
FT                   /product="tRNA-His"
FT                   /note="tRNA His anticodon GTG, Cove score 60.70"
FT   gene            440722..440793
FT                   /locus_tag="LSL_RNA038"
FT   tRNA            440722..440793
FT                   /locus_tag="LSL_RNA038"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA Gln anticodon TTG, Cove score 68.51"
FT   gene            440803..440873
FT                   /locus_tag="LSL_RNA039"
FT   tRNA            440803..440873
FT                   /locus_tag="LSL_RNA039"
FT                   /product="tRNA-Cys"
FT                   /note="tRNA Cys anticodon GCA, Cove score 71.39"
FT   gene            440904..440988
FT                   /locus_tag="LSL_RNA040"
FT   tRNA            440904..440988
FT                   /locus_tag="LSL_RNA040"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Leu anticodon CAA, Cove score 64.33"
FT   gene            441138..442784
FT                   /gene="pckA"
FT                   /locus_tag="LSL_0395"
FT   CDS_pept        441138..442784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="LSL_0395"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="COG1866 [C] Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99205"
FT                   /db_xref="GOA:Q1WUY0"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUY0"
FT                   /protein_id="ABD99205.1"
FT                   /translation="MSTISHYKEVDINKKNPLLSQIRTTVETAFYGNNFERVTDISKAY
FT                   YLAKNCPSTIVTDVPIKHTQELGLPVDSKMLVNNHGKIVGRTAAARHIIGHLGEDTNEL
FT                   AGVLRDAIFEASDRKFYKTEVYVGLDEDFMLKSHLAVPKGYEFNMLSYMLNFQPVTSEY
FT                   EKMYQASHKYEEGDIFIYADPEFKDENYPNGLVIIDAEHNVAAILGLRYFGELKKATLT
FT                   LAWAIAHRHGYTASHGGEKVFRFDDKDDKVFAFYGLSGSGKSTLTHAKHGGKYDIDVLH
FT                   DDAFVISRINGSSVALEPAYFDKTNDYMPGSKEASYFTTVMNVGVTLNEENKRVLVTED
FT                   LRNGNGRTIKSRYASLNRVDKENAPIDSIFWIMKDDSLPPVVKLDNPTLAATFGVTLAT
FT                   KRSTAENVVNADRNSLVIEPFANPFRAYPLAEDYRDFKELFEKRNVSGYIVNTASYNGI
FT                   DIDKEITLQILEDIANEKVNWEKFGSLDGMYYLPFEKYPVDFKDKSYTEKLKRRLEIRL
FT                   EWIEKYEGNHPDNPLPAEIKDCLSNLINELN"
FT   gene            442888..443649
FT                   /locus_tag="LSL_0396"
FT   CDS_pept        442888..443649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0396"
FT                   /product="Negative regulator of genetic competence mecA"
FT                   /note="COG4862 [OTN] Negative regulator of genetic
FT                   competence, sporulation and motility"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99206"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX9"
FT                   /protein_id="ABD99206.1"
FT                   /translation="MEMEKINENTIRVVLDDEDLTARGIKFLDLLGNQKEIESFFYEIL
FT                   DEVDVEHEFRENDAVTFQLVPNKESGLEIFITKVNPDDITDQDGEKETENENETVEDTE
FT                   DVKKDIDSSSDELLNLIKNSIENSRNIAENRDYSRRSKIDDDEVIQYLNDDTKKKYVFV
FT                   VEFSTFEDFVQLAHVLRIEGGVSNLYSYQEKYYLELVLFDDNYSEESAKDLISLSFEYG
FT                   KNSKISPILLKERGKLVMGQTALELARYYFK"
FT   gene            443698..444597
FT                   /locus_tag="LSL_0397"
FT   CDS_pept        443698..444597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0397"
FT                   /product="Putative competence protein/transcription factor"
FT                   /note="COG4469 [R] Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99207"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="InterPro:IPR021176"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX8"
FT                   /protein_id="ABD99207.1"
FT                   /translation="MIYAKDEKNNIVEANMAKKGRKYYCSGCHGQVILRCGKLRVSHFA
FT                   HKKHACDIFSEGETLEHLRGKKLLMTWLRKEGKNPQIEAYLTSLHQRPDILCNNKAFEF
FT                   QCSPISVERMSKRSKGYISEGYDFFWFLGKRHLIRKRLTQQIAQFIRWHKNLGFYLIYI
FT                   NVEQRNMEVYYHIQQADFLPVRFYRKKVNSWKELQDFFKQNRIKNYNLLSISERKRQKN
FT                   CFYRNCLQSTNKFKKLQVICYTHGYILQEIYEEISSERYTYPIYKEYIFTKKMYEKLNL
FT                   KDIELYYQLPFINFSNID"
FT   gene            444695..446512
FT                   /locus_tag="LSL_0398"
FT   CDS_pept        444695..446512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0398"
FT                   /product="Oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG1164 [E] Oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99208"
FT                   /db_xref="GOA:Q1WUX7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX7"
FT                   /protein_id="ABD99208.1"
FT                   /translation="MSEKKAKRLLQRNEVPEELTWDLTKVFKSDEEFEKEYQTVKDEVQ
FT                   NFRKLQGTMDQGSQRFLQIIENFLSINRKFEKVYVYASMRNDQDTTNAKYQGYNEMVDA
FT                   LAAEFSESISWFEPELLELDEDKLKQYFVEKKELKQYEHLIESMLVMRKHTLDKKSESL
FT                   LAGASDIFGTSQNVFGILNNADLKFPIVKDDNGDDIQLSHGVYGKLIESTNRKVRKAAF
FT                   KGLYSVYDQFKHTMATTLIGNVKVHNFKARVRNYKDAREAATTSNHIPTEVYDVLLEQV
FT                   HKNLPLLHRYVKLRKKILGVDELHMYDMYTPLTEDSKLTYNYIQAQIEAKKALEVLGMD
FT                   YLTHVSEAFENRWIDVVENKGKRSGAYSSGVYDTPPYILLNWQDNLENLFTLVHEMGHS
FT                   MHSYYTSHNQPYQYGDYPIFLAEIASTTNENILTDYLLKNNDEKEILIYILNHYLDGFK
FT                   GTVYRQTQFAEFEKWIHEQNSKGVPLTAKSISEYYLELNKKYYGNDVVSDPEIALEWAR
FT                   IPHFYYNFYVYQYATGFAAATTLAENILSGDENKLNKYLTYLKAGSSKYPLEVMKDAGV
FT                   DMTDSSYLEKAFKVFEERLNQLETLLSEK"
FT   gene            complement(446602..447207)
FT                   /locus_tag="LSL_0399"
FT   CDS_pept        complement(446602..447207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0399"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG2761 [Q] Predicted dithiol-disulfide isomerase
FT                   involved in polyketide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99209"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX6"
FT                   /protein_id="ABD99209.1"
FT                   /translation="MLDMYLFINPLGSTCYHTEQNILKLGDSLNEKINFNFVPLMNFKT
FT                   INDVMCRMNIPLNNVDIRNRLSENIYHSSIDFKAASFQGKKKGRNFLLNVQQLVVNDQK
FT                   DYNFETIKLAAQKSGLDWDIFEQDRHSKLAIEAFKQDQELATEMNVTEHPTIVVYDCSA
FT                   NNNSAYSFSGCESLDEIKKVLLSQRQQNSSGTSIMKLC"
FT   gene            447375..448229
FT                   /gene="pstS"
FT                   /locus_tag="LSL_0400"
FT   CDS_pept        447375..448229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="LSL_0400"
FT                   /product="Phosphate-binding protein"
FT                   /note="COG0226 [P] ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99210"
FT                   /db_xref="GOA:Q1WUX5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX5"
FT                   /protein_id="ABD99210.1"
FT                   /translation="MKKIKILIGSLLIATLMTGCASKKNNNITIVGSTAMQPMIEMAAE
FT                   EFQHHSKVRITVQGGGSGTGLSQVQAGAVAIGNSDIFAQQQPGIKAEKLQDNKVAVVGI
FT                   APVVNKKVGIDNLSMEQLKGIFTGKYTNWKQVGGKNQKIIVINRAQGSGTRKAFESDVL
FT                   KGESAIKAQEQDSSGTVQKMIAATPGSISYLAFPYLNKDVQKLSIDNVKPNAKNVENND
FT                   WKIWAYEHMYTKKKVDKKVKKFIDYIYTKEVQQNLVKTLGYITIHDMKVQKDENGNIEE
FT                   IQK"
FT   gene            448240..449157
FT                   /gene="pstC"
FT                   /locus_tag="LSL_0401"
FT   CDS_pept        448240..449157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LSL_0401"
FT                   /product="Phosphate transport system permease protein"
FT                   /note="COG0573 [P] ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99211"
FT                   /db_xref="GOA:Q1WUX4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX4"
FT                   /protein_id="ABD99211.1"
FT                   /translation="MRDEIREKIQKNSKATYQEIFGKLLVSISIIIILLIVSAIFGFIF
FT                   SKGIATFTENNAQVKDFFTGTNWNPSMNEKGHPQVGALPMILGSFGVTLLAAIFVTPFA
FT                   IGTALYITELASKKMKKILQIVIELLVGIPSVVYGFIGLNVVVPFIRENFGGTGYGILA
FT                   GAVVLFVMILPTVTSLTVDSLKAVPKHYRSASLALGATPWQTMFHVTLKAATSGILTAI
FT                   VFGMARAFGEALAVQMVIGNASLMPTSLLNPASTLTSVLTMGIGNTVMGTVGNNALWSL
FT                   ALVLLAMSLIFNLIVRLIGRKDIK"
FT   gene            449157..450047
FT                   /gene="pstA"
FT                   /locus_tag="LSL_0402"
FT   CDS_pept        449157..450047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="LSL_0402"
FT                   /product="Phosphate transport system permease protein"
FT                   /note="COG0573 [P] ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99212"
FT                   /db_xref="GOA:Q1WUX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX3"
FT                   /protein_id="ABD99212.1"
FT                   /translation="MKNTKFQNNVAMEIIKLIAAMVVLILVFLLGKILISGVPHISWKF
FT                   LVTPSKAFTAGGGISVRIFNSFYLLILTLLISFPISLGAGIYLAKYAAKNKITSLIRMV
FT                   IEILSSLPSVVVGLFVFLVCVVQMQIGFSILAGAIALTFFNLPLLTRNIEESIKAVPNL
FT                   QLEGGLALGLSKWKTITKIILPEALPGIITGVILSAGRVFGEAAALIYTAGQSAPAVDF
FT                   TNWNIFDETSPLNLMRPAETLAVHIWKINSEGIMPDANAISAGTSAVLIIAILIFNLSA
FT                   RYLGNYLYRKLTSAR"
FT   gene            450052..450846
FT                   /gene="pstB"
FT                   /locus_tag="LSL_0403"
FT   CDS_pept        450052..450846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="LSL_0403"
FT                   /product="Phosphate transport ATP-binding protein"
FT                   /note="COG1117 [P] ABC-type phosphate transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99213"
FT                   /db_xref="GOA:Q1WUX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUX2"
FT                   /protein_id="ABD99213.1"
FT                   /translation="MEYNLKDKYILQLNEKEKALETRDLNIFYGEKQALFDGNLQFERY
FT                   KITSLIGASGSGKSTFLRSLNRMNEGVADVKGSILYRGIDINSPKINVYEMRKYIGMVF
FT                   QRPNPFSKSIYENITFALKENGIKDKEKLAEIVETSLKQAALWDEVKDDLNKSALALSG
FT                   GQQQRLCIARAIAMKPDILLLDEPASALDPISTAKIEETLLELKEKYTLIIVTHNMQQA
FT                   SRISDYTAFFHLGNVIEYNKTKNIFTNPKIKLTEDYISGNFG"
FT   gene            450856..451611
FT                   /gene="pstB"
FT                   /locus_tag="LSL_0404"
FT   CDS_pept        450856..451611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="LSL_0404"
FT                   /product="Phosphate transport ATP-binding protein"
FT                   /note="COG1117 [P] ABC-type phosphate transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99214"
FT                   /db_xref="GOA:Q1WUX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUX1"
FT                   /protein_id="ABD99214.1"
FT                   /translation="MEKIITTKDVHLYYGSKEALKGITLDFPDKGIHALIGPSGCGKST
FT                   YLRTLNRMNDMIENVKIEGEFKFKNQNIYDEKIDLVELRKKIGMVFQQPNPFPFSIYDN
FT                   VTYGLRMAGIKDKRILDEKVETSLKQAAIWEEVKDNLNKNALALSGGQQQRICIARVLA
FT                   VAPEVILLDEPTSALDPISTEKIEEMLLTLRDNYTCIMVTHNMQQASRISDTTSFFLSG
FT                   NLVESNKTKKIFLNPDKEQTADYLSGKFG"
FT   gene            451624..452280
FT                   /gene="phoU"
FT                   /locus_tag="LSL_0405"
FT   CDS_pept        451624..452280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="LSL_0405"
FT                   /product="Phosphate transport system protein"
FT                   /note="COG0704 [P] Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99215"
FT                   /db_xref="GOA:Q1WUX0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUX0"
FT                   /protein_id="ABD99215.1"
FT                   /translation="MNRKFLGQLKIVHQDFIEMGLEAAEVIKLATEAFENHDLELANKV
FT                   IEHDEVINNLEIKLEKKTSQLIALQQPVATNLRKVIAILKASSDVERIGDHAVDVAKAV
FT                   RNINVKRRNVEIESLIREVSEQTQENLVKIVSMFAKFDEKGAVEIAKKNQEKREKINEI
FT                   RKLSINAIKEDANFAEEGIDYLSIIAHIKRINDYITNLAEWIVYEEEGKITELTF"
FT   gene            452407..453273
FT                   /gene="fba"
FT                   /locus_tag="LSL_0406"
FT   CDS_pept        452407..453273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="LSL_0406"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG0191 [G] Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99216"
FT                   /db_xref="GOA:Q1WUW9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW9"
FT                   /protein_id="ABD99216.1"
FT                   /translation="MSVFVNGNAIFNAARQGHYAVGAFNTNNLEWTRAILKAAQETNTP
FT                   VLIQVSMGAAKYMGDYKLVKKLVEEEMRVMNITVPVIMHLDHGNYEAAKECIEAGYSSV
FT                   MFDGHDLPFEENLEKTAEIVKLAHAKGISVEAEVGSIGGEEDGIVGEGELASVEEAKQI
FT                   AALGVDYLACGIGNIHGPYPENWKGLHFDRLQEIADAIDTPLVLHGGSGIPQEQIEKAI
FT                   KMGISKVNINTENQLAFAAATRKYIEAGKDQEGKGYDPRKLLAPGSEAIVDTVKEIIGW
FT                   LGTPEVK"
FT   gene            complement(453375..454664)
FT                   /locus_tag="LSL_0407"
FT   CDS_pept        complement(453375..454664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0407"
FT                   /product="Transposase ISLasa4e, ISL3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99217"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WR17"
FT                   /protein_id="ABD99217.1"
FT                   /translation="MDNNIKLLLGITDPNLTIDPKYQYTSYIEEKIIKNSKTLLCHLYL
FT                   SYPMYCPNCKALMLHNGTKVANNVHLSSAGKKLVLSIRKQKYLCPECKKTATAKFKDTN
FT                   YHDHFSNAVKAKLVRDLSLSRPMCEIAADSFTSSNTIIRSLESVENNFKVNRNWLPSHL
FT                   SLDDFKSGKRFSSSGMSMCLINAVNHRIIDIIPERNNKFLRNYFIQYSYKARLSVMTIT
FT                   VDLYAPYRSLIKKLFPNAFIIADKFHVVAQAYTAMNKIRTRVMKEYGAGTHEYRALKRF
FT                   WKLLLKNQDNVDYHRYYPRINFKYAELSDSEVLDRLSDMSSELKTAYEYYQLLLQMYRK
FT                   NSCQSLNLLIDTSSWNLPPEMRQALKTIKKHKAEIENSFVLPRLTNGPIEGINNHIKVI
FT                   KRIAYGYNNFKHFRLRILLSLKNNVIFFST"
FT   gene            454692..454895
FT                   /locus_tag="LSL_0408"
FT   CDS_pept        454692..454895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0408"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99218"
FT                   /db_xref="GOA:Q1WUW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW7"
FT                   /protein_id="ABD99218.1"
FT                   /translation="MACGPSLLFCRKNGENKRRTVIKKFYIISPKYYTTTFFKESLIRL
FT                   FFYMLFYILLNYYKYYVIIFLN"
FT   gene            454914..455606
FT                   /locus_tag="LSL_0409"
FT   CDS_pept        454914..455606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0409"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0700 [S] Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99219"
FT                   /db_xref="GOA:Q1WUW6"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW6"
FT                   /protein_id="ABD99219.1"
FT                   /translation="MDSTKQKSITLAQKINVLRAAVMGANDGIISVAGIVLGVAGAASS
FT                   SFAILISGLAGMLAGTISMAMGEYVSVHSQSDAEVAAVVREKKILDTDYQKEFLFIKNK
FT                   LLKAGISEELSHKATKEMMDRDPLKSIVREKYGFELNEKTNPYAAAIASMISFPLGATL
FT                   PLLSILIFPVQYRIFGTMLAVIISLVFTGYFAAQLSHSSKLHGTIRNVISGMLTMIVTY
FT                   FIGVMFSL"
FT   gene            455624..456313
FT                   /locus_tag="LSL_0410"
FT   CDS_pept        455624..456313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0410"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0700 [S] Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99220"
FT                   /db_xref="GOA:Q1WUW5"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW5"
FT                   /protein_id="ABD99220.1"
FT                   /translation="MLNKRKKKATMEEKMNVLRAGVLGSNDGILTVVGVLFSVGAATSN
FT                   RFTILIAGLADLVACALSMSAGEYASVSVQRDTEKSAVEEEATNLKNNYSEQINIVKQY
FT                   YQNKGVSLQTANLIAKQLMEKEDRVATLVNIKHGINMGQYLNPWMAAWSSMFSAALGGL
FT                   FPLVAMTYAPSNSRWLATILAVIISVGLTGMISAKLGKSNIKYAVLRNIVVGIITMAIH
FT                   YYVGQLI"
FT   gene            complement(456624..456977)
FT                   /locus_tag="LSL_0411"
FT   CDS_pept        complement(456624..456977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99221"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW4"
FT                   /protein_id="ABD99221.1"
FT                   /translation="MYIKFPYNLDFKSIYNRNLFRIYLCYNIVKGGLSMSSRINDELKL
FT                   SLIQFNDIYLPMWEEFPDFQVYMDQLVSLGNRYLKDLSDSELTPSMINSYVKKGLMQRP
FT                   EKKSTMLVILLSF"
FT   gene            457041..457640
FT                   /locus_tag="LSL_0412"
FT   CDS_pept        457041..457640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0412"
FT                   /product="Conserved membrane protein"
FT                   /note="COG1272 [R] Predicted membrane protein, hemolysin
FT                   III homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99222"
FT                   /db_xref="GOA:Q1WUW3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW3"
FT                   /protein_id="ABD99222.1"
FT                   /translation="MECNNSWNWNYPQLSILGMILLILKGIDTNSITLFSYIVYTCSLV
FT                   LLYLFSTLFHCLYFTKAKRVFQIFDHCSIFLLIAGTYTPYCMLAIKGVKGLILMIMIWL
FT                   MSILGILYHILASKRKQVFETIIFVVMGWLCILGAKELFLSLGKIGLGLLVAGGIIFTL
FT                   GALVYSIPKIKYAHVFWHIFVMLGSILMFISIYCYI"
FT   gene            457759..458094
FT                   /locus_tag="LSL_0413"
FT   CDS_pept        457759..458094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0413"
FT                   /product="Transcriptional regulator, ArsR family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99223"
FT                   /db_xref="GOA:Q1WUW2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW2"
FT                   /protein_id="ABD99223.1"
FT                   /translation="MSVSQLSKVQNEALDNFVENFDIINALADRNRQKIIVLLFGNLES
FT                   GMTVTAITNNMSITQPAVSHHLKILRDSGIVAYRKDGLQSYYYLTLQEPLEKLENISRN
FT                   LRLELEE"
FT   gene            complement(458249..459538)
FT                   /locus_tag="LSL_0414"
FT   CDS_pept        complement(458249..459538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0414"
FT                   /product="Transposase ISLasa4f, ISL3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99224"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WR17"
FT                   /protein_id="ABD99224.1"
FT                   /translation="MDNNIKLLLGITDPNLTIDPKYQYTSYIEEKIIKNSKTLLCHLYL
FT                   SYPMYCPNCKALMLHNGTKVANNVHLSSAGKKLVLSIRKQKYLCPECKKTATAKFKDTN
FT                   YHDHFSNAVKAKLVRDLSLSRPMCEIAADSFTSSNTIIRSLESVENNFKVNRNWLPSHL
FT                   SLDDFKSGKRFSSSGMSMCLINAVNHRIIDIIPERNNKFLRNYFIQYSYKARLSVMTIT
FT                   VDLYAPYRSLIKKLFPNAFIIADKFHVVAQAYTAMNKIRTRVMKEYGAGTHEYRALKRF
FT                   WKLLLKNQDNVDYHRYYPRINFKYAELSDSEVLDRLSDMSSELKTAYEYYQLLLQMYRK
FT                   NSCQSLNLLIDTSSWNLPPEMRQALKTIKKHKAEIENSFVLPRLTNGPIEGINNHIKVI
FT                   KRIAYGYNNFKHFRLRILLSLKNNVIFFST"
FT   gene            459722..460381
FT                   /gene="rnhA"
FT                   /locus_tag="LSL_0415"
FT   CDS_pept        459722..460381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="LSL_0415"
FT                   /product="Ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0328 [L] Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99225"
FT                   /db_xref="GOA:Q1WUW0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017067"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUW0"
FT                   /protein_id="ABD99225.1"
FT                   /translation="MGKFYAVKKGRKTGIFTTWAECQKQVSGFPKAEFKSFISKQEADD
FT                   WLKEIKSSNENRRKSYSVIVYTDGGSRNHGNKKGEHVKKNDKAAWAYLIKYQGSIISDT
FT                   DGEYGSTNNRMEIMALKKALLDLKQRELQNEKILVVLDSKYVLDAITKRWLQSWEKNGW
FT                   KTSAGTGVKNKELWMEISRLLPEFPNLDYQWTKGHANDEGNNLVDELLNKTMDQMD"
FT   gene            complement(460738..460896)
FT                   /locus_tag="LSL_0416"
FT   CDS_pept        complement(460738..460896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0416"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99226"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV9"
FT                   /protein_id="ABD99226.1"
FT                   /translation="MTLKNLIQYLDDISTISNRQNFDIRKLYGDGGNRTRVQAYRHLNL
FT                   YVHRHTI"
FT   gene            461276..461683
FT                   /locus_tag="LSL_0417"
FT   CDS_pept        461276..461683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0417"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG4768 [R] Uncharacterized protein containing a
FT                   divergent version of the methyl-accepting chemotaxis-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99227"
FT                   /db_xref="GOA:Q1WUV8"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="InterPro:IPR036437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV8"
FT                   /protein_id="ABD99227.1"
FT                   /translation="MFLTFGQLAGLIAALAFLVLVIYLCRVLARLTSTVSELTKSIKTL
FT                   TEDADDISEKIEDLLVKTNSLMDDVNQKSSKLDPLFQATSDLGESVSDLNQASRNFVEN
FT                   MGNSTHGLVKTSTMLKNGLRAIKLINKLRKK"
FT   gene            461706..462155
FT                   /locus_tag="LSL_0418"
FT   CDS_pept        461706..462155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0418"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99228"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV7"
FT                   /protein_id="ABD99228.1"
FT                   /translation="MGKKLLIGLGVAGVAFYASKKLSGKYLEKAASKLDDIVAEGQETA
FT                   LKYREYLLDYLDEDDKLEKLNKKVLQAKDLVDKDSVTEALSNLKSSTSNLKDKLMEKED
FT                   SLDNDEDLQDDIVIDQRSAFGKMKEKTELENPAVVFYPDGTSETK"
FT   gene            complement(462226..463329)
FT                   /gene="pepQ"
FT                   /locus_tag="LSL_0419"
FT   CDS_pept        complement(462226..463329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="LSL_0419"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="COG0006 [E] Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99229"
FT                   /db_xref="GOA:Q1WUV6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV6"
FT                   /protein_id="ABD99229.1"
FT                   /translation="MKHIEEVQEWLANNNLDIAYISDFHNIRYYTGFDSDPIERILALF
FT                   IFPDKDPFIFAPALEVGSVKESGWEYPVFGYLDHEDAFALIKSHINALAGNPKKWAVEK
FT                   DNLTVAKSEAILRNFPEAKFVENISPFINKQRSIKNEDEINLLLEAGKWADYAFKVGFD
FT                   ALSTNKTEQAVAAEIEYELKKKGVMHMSFDTIIQSGANAADPHGAPKEDTIKPNELTLF
FT                   DLGTVYKGYISDASRTVAFGEIDDKLKDIYNVCLEAQLTAQNAAKPGMTAEELDKIARD
FT                   VITKAGYGEYFIHRLGHGMGQSEHEFPSIMEGNKMELVPGMCFSIEPGIYIPNYAGVRI
FT                   EDCVYVTDNGVKPFTHTSKELQIIPLS"
FT   gene            463530..464537
FT                   /gene="ccpA"
FT                   /locus_tag="LSL_0420"
FT   CDS_pept        463530..464537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="LSL_0420"
FT                   /product="Catabolite control protein A"
FT                   /note="COG1522 [K] Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99230"
FT                   /db_xref="GOA:Q1WUV5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV5"
FT                   /protein_id="ABD99230.1"
FT                   /translation="MEKQTITIYDVAREADVSMATVSRVVNGNPNVKPATRKKVLEVID
FT                   RLDYRPNAVARGLASKKTTTVGVIIPDVTNVYFSSLARGIDDVASMYKYNIILANSDAN
FT                   EQKELQVLNTLLAKQVDGIIFMGNKITDELRKQIDKTKTPVVLAGSLDDKEEFESVHIN
FT                   YVDAVEEAVSDLINHGNDKIAFISGPLSEPINSKYRLQGYKNALSKNGIACDEELVFET
FT                   DYSYHSGEILWPALQSVGATAAYVGDDELAVGVLNGAQDAGAKVPTDFEIVTSNNSKLT
FT                   ELVRPKLSSITQPLYDIGAVSMRFLTKMMNKEETSADEKTIELPYGYIKRGSTK"
FT   gene            464631..465119
FT                   /locus_tag="LSL_0421"
FT   CDS_pept        464631..465119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0421"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99231"
FT                   /db_xref="GOA:Q1WUV4"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV4"
FT                   /protein_id="ABD99231.1"
FT                   /translation="MKIKSEKYLYLSIFIMILLFISSSMTYKEQSSVPFLQKYLTSQPF
FT                   KDILSQVSFSYGHSVISIKEVGYYKFVEFFIRKLAHFSTYFVMGLGFYMTLKDNLKKWQ
FT                   ATFFSYLAAVGYAGIDEFHQMITGDRTPSFEDVMLDGIGALTGIIITMVILYFFRRKK"
FT   gene            465226..465954
FT                   /locus_tag="LSL_0422"
FT   CDS_pept        465226..465954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0422"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99232"
FT                   /db_xref="GOA:Q1WUV3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUV3"
FT                   /protein_id="ABD99232.1"
FT                   /translation="MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMVAKSGGPDPDG
FT                   NPQLRLIMDKARAANMPKDNIKRAIDKATGTGGADYEEITYEGYGPAGVAILVHALTDN
FT                   RNRTASAVRADFNRNGGNLGETGSVSFMFDRKGYIAIAREDLEVDEDQMFEDVIEAGGE
FT                   DLQTSDEVFEIYTDPKAFADVRDELQKKYDLATAELTMVPQNTVPVPADKVEQLQRLID
FT                   RLEDEDDVSEVYTSADFPED"
FT   gene            466078..467001
FT                   /gene="rbsK"
FT                   /locus_tag="LSL_0423"
FT   CDS_pept        466078..467001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="LSL_0423"
FT                   /product="Ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="COG0524 [G] Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99233"
FT                   /db_xref="GOA:Q1WUV2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV2"
FT                   /protein_id="ABD99233.1"
FT                   /translation="MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQ
FT                   AISAARSKSHVTFIGGVGNDVQGEMMLKLLKEDGININNVAKLNEGTGQAFILLQESGE
FT                   NSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFETPLEVTNEAFKLARELNVKTILN
FT                   PAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLIDQGINNVIITLG
FT                   KQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKAS
FT                   SLAVQRLGAIPSIPYKDDVEKQLNSK"
FT   gene            467105..468088
FT                   /locus_tag="LSL_0424"
FT   CDS_pept        467105..468088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0424"
FT                   /product="ComG operon protein 1"
FT                   /note="COG2804 [NU] Type II secretory pathway, ATPase
FT                   PulE/Tfp pilus assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99234"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV1"
FT                   /protein_id="ABD99234.1"
FT                   /translation="MKKSVEILLQEAISLKASDIFFFPKNDRYQIKVNVLGTNRIIKEC
FT                   SKEFGGQLINYLKFQSNMAVSEKRRPQLGSWIYSDEKNEVFCRLSSVGDFLGNESLVVR
FT                   LIFPSTFFEENYFFEEQIYTLQKACIKNGLIVFSGPMGSGKTTTMYNLARKLANEKHVM
FT                   SIEDPIEIYEPNFLQLQVNNKAQMSYSELLKVALRHHPDIFLIGEIRDNMTAKVAINAA
FT                   LSGHLILTTVHARNVYGVYQRLKNLGISDEELQQTMQVISYQRLIPTIDGGAKVLFDQI
FT                   EGKDLDKDIIQGNIQSRMTKDWREKLEYCYLNNWINKESFETFIEG"
FT   gene            468024..469097
FT                   /locus_tag="LSL_0425"
FT   CDS_pept        468024..469097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0425"
FT                   /product="ComG operon protein 2"
FT                   /note="COG1459 [NU] Type II secretory pathway, component
FT                   PulF"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99235"
FT                   /db_xref="GOA:Q1WUV0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUV0"
FT                   /protein_id="ABD99235.1"
FT                   /translation="MSIVTLITGLIKKVLKHLLKDNKKVWSLKKQAIFFSILSDLLSAG
FT                   FSLRQSLISIQNIMPEFYSVSHKVKKNLLMGTKISDALKENISKSTYYQLLIAEQHGEM
FT                   EKSIKQLGSLLERRVEQQNKLKSLMVYPMILFFMLIIIMLGIKFWLKPTINNFGEDSVK
FT                   TSSIINWTAVGKYSLILVALIIVLYVLKILRWWSKQETITRHHWYSQLLIIGKIYRQYS
FT                   YYYLSFNLSLLLKSGLDLKQICSFLNEFDKQSLLYQLGQQLRELLNAGSMPDELVKKYP
FT                   FIPPELKLFLNKGETLENISNELAVYSEVSYRKLLKLIDKLIELVQPILFIVIAIIIVG
FT                   TYLTILLPIYKTLGGLY"
FT   gene            469097..469399
FT                   /locus_tag="LSL_0426"
FT   CDS_pept        469097..469399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0426"
FT                   /product="ComG operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99236"
FT                   /db_xref="GOA:Q1WUU9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU9"
FT                   /protein_id="ABD99236.1"
FT                   /translation="MKKKRRGFTLIEMAIVLFIISLLILIILPNIGTQRKHANTVNDKA
FT                   LQTQLNTQAELYMDEKNTNTVTIDELKSANYLNNDQYDQIKKKNIEIKLDNGKKE"
FT   gene            469401..469823
FT                   /locus_tag="LSL_0427"
FT   CDS_pept        469401..469823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99237"
FT                   /db_xref="GOA:Q1WUU8"
FT                   /db_xref="InterPro:IPR016785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU8"
FT                   /protein_id="ABD99237.1"
FT                   /translation="MVGYTLLEMIIVLGIFMVLILLAYRPIKITWQNYEERQFIKNFER
FT                   KWNQSTIKSIQEEKHTNVYFYHDLVRFSEYNKDRTTNDYEFSYPSTMHGDTNIVKISDN
FT                   GSVTPKTIKIFSSLGRRYVFVFQMGYGAKYYVKTYQ"
FT   gene            469804..470058
FT                   /locus_tag="LSL_0428"
FT   CDS_pept        469804..470058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0428"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99238"
FT                   /db_xref="GOA:Q1WUU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU7"
FT                   /protein_id="ABD99238.1"
FT                   /translation="MLKLTNKGFVLADSIIGLIIICSGILILLTNYQSLNNQENLKIED
FT                   KERMHLLLNRVRSMDKNELVNFKQIQVSYENKVETLSKE"
FT   gene            470024..470194
FT                   /locus_tag="LSL_0429"
FT   CDS_pept        470024..470194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0429"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99239"
FT                   /db_xref="GOA:Q1WUU6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU6"
FT                   /protein_id="ABD99239.1"
FT                   /translation="MKIKLKLCQKSKKSGFTLLETIITIGITCLTCMMIFSTLQIVWKI
FT                   NANETKNDRLQ"
FT   gene            470228..470488
FT                   /locus_tag="LSL_0430"
FT   CDS_pept        470228..470488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0430"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99240"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU5"
FT                   /protein_id="ABD99240.1"
FT                   /translation="MDFKYVRVDNENNELILYSDAMDDFYELDLYKQQIRMRRKIDGYM
FT                   PLLYNVQKVEWRYDENRKSIFISIRIHGREYSEEYIMDRKK"
FT   gene            470485..470766
FT                   /locus_tag="LSL_0431"
FT   CDS_pept        470485..470766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99241"
FT                   /db_xref="GOA:Q1WUU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU4"
FT                   /protein_id="ABD99241.1"
FT                   /translation="MKSSFRKEGYLIYTSIYFLMFFLMIFLGQTLLFKWQILAYSREVN
FT                   YYRARVMYEVVKRKNCDSENFNYGKVMWDKERRKYIIILKNGREYQFK"
FT   gene            470841..471881
FT                   /locus_tag="LSL_0432"
FT   CDS_pept        470841..471881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0432"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0827 [L] Adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99242"
FT                   /db_xref="GOA:Q1WUU3"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU3"
FT                   /protein_id="ABD99242.1"
FT                   /translation="MIGKMKKIQKEYSLLEEAVKELQKNLQTTYLDALIETLENILDNN
FT                   QVHVEDDKPDKKTVAKLKELYADSNIKNLEADEKRQVIQLLILKSYSEDKIQANHQMTP
FT                   DSIGMIVSYLIELFADSKKVLTITDICVGTGNLLTDIYNNLDKQNKNIQAYGIDNDDTL
FT                   LALASISTQFQKQNIELYHQDAIEELLIPKTDLVVGDLPVGYYPIDDKVSDYITKNNDG
FT                   HSYAHYVLIEKSIRQLKEDGIGIFIVPRGIFEVKDSVKLLKYIQKVGYLQGLLNLPTEL
FT                   FNDKQSMKSILVVQKKGNKAKQAEEVLLGDFPSFKKQEEFKKFINEIVSWAKKNIYFNW
FT                   FFVKKD"
FT   gene            complement(471944..473230)
FT                   /pseudo
FT                   /locus_tag="LSL_0432b"
FT   misc_feature    complement(471944..473230)
FT                   /pseudo
FT                   /locus_tag="LSL_0432b"
FT                   /note="Similar to transposase ISLasa4g, ISL3 family;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            473536..474894
FT                   /locus_tag="LSL_0433"
FT   CDS_pept        473536..474894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0433"
FT                   /product="Amino acid permease"
FT                   /note="COG1113 [E] Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99243"
FT                   /db_xref="GOA:Q1WUU2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU2"
FT                   /protein_id="ABD99243.1"
FT                   /translation="MNKENKGYARNLKSRHIQLIALGGTIGTGLFLGSGKSIHLAGPSI
FT                   VLAYCITGLICFFLMRAMGELLLSDLNTHSFIDFITKYLGEKIGFIAGWTYWICWITIA
FT                   MADVTATGLYIEYWFPNIPQWVPGLVAVVVLLSLNLVTVGLFGETEFWFSLIKIIAIIA
FT                   LIVSGIAMVIVSYKTPVGHATLGNLYSYGGLFPKGLKGFLLSFQMVTFGFIGIEMVGIT
FT                   ASEAENPKKVIPKAINEIPLRIIIFYVGSLLAIMSIYPWNSISINESPFVQVFQNIGIT
FT                   FAAGIINFVVLTAALSATNSALFSTGRMLFSLNWGKKGKFAKKMSTLSRQQVPANGLIF
FT                   SAIIIAIAVLANFVVSNTSLFTFVSSVATTCFLFIWGAIVVCHLEFKKQQKKQNIPEGE
FT                   FKLHFHPWTDYLVLAFLIFVGVIMCLEKTTLFALIAAIAWFVMLYMISSIKGK"
FT   gene            474993..475598
FT                   /locus_tag="LSL_0434"
FT   CDS_pept        474993..475598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0434"
FT                   /product="Phosphoesterase"
FT                   /note="COG4186 [R] Predicted phosphoesterase or
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99244"
FT                   /db_xref="GOA:Q1WUU1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU1"
FT                   /protein_id="ABD99244.1"
FT                   /translation="MKYFTADTHFFHKELIHDTRFANRMFFSVNDMNNTIVENWNSVVN
FT                   DNDTVYHLGDIALINSKKEDLKRVLEILKKLKGQIVFLKGNHDSRALFKFIDKNNVILP
FT                   DGRMKFTFIDVGLILKLNHYQLFLTHYPLLVGPSKNRVNVHGHIHHSSVNSPWNINVGV
FT                   DSADIDYLINKLPFGTPISEKNLFKIIEAKLIDHKKRW"
FT   gene            475676..476260
FT                   /locus_tag="LSL_0435"
FT   CDS_pept        475676..476260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0435"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99245"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUU0"
FT                   /protein_id="ABD99245.1"
FT                   /translation="MNSERKERREVQLAKKAETIEAAASEVLVINETRIKIDGRPYDLV
FT                   ENYHEGFSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDD
FT                   YLYEYCNFGCSYFILHNLEVQTPEPIPANIRKKSSKRKSQSSSKKHNSKNNVFTNEKRY
FT                   NIRSQKNKKNAHLKSVSKKNTKHRHFTIRQK"
FT   gene            476271..477044
FT                   /gene="nagD"
FT                   /locus_tag="LSL_0436"
FT   CDS_pept        476271..477044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="LSL_0436"
FT                   /product="N-acetylglucosamine catabolic protein"
FT                   /note="COG0647 [G] Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99246"
FT                   /db_xref="GOA:Q1WUT9"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT9"
FT                   /protein_id="ABD99246.1"
FT                   /translation="MDLEKYKGYLIDLDGTMYKGKIKIPAAKRFIERLQEKDIPFLFLT
FT                   NNSTQTPEAVVENLGMNFDIHVGVENVYTTALATADYVADLDENKRKVYAIGELGLKQA
FT                   LMDKGFRFEEVTPDYVVVGLDYDVTYHKFELATLAIKRGAKFIGTNPDTNLPNERGLVP
FT                   GAGSVIALVERATQQVATYVGKPEKIIMEKALKKMNMKADDVIMVGDNYNTDIKAGIAS
FT                   DIDTLLVYTGVSTREDVAKEKIKPTYEINSLDEWQ"
FT   gene            477044..477688
FT                   /locus_tag="LSL_0437"
FT   CDS_pept        477044..477688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0437"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /note="COG0344 [S] Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99247"
FT                   /db_xref="GOA:Q1WUT8"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT8"
FT                   /protein_id="ABD99247.1"
FT                   /translation="MIRSIWIERVILLLFGVILFFFVLSLAISITINSDWLYYIFIKLE
FT                   HLDKKVFLTSNELWHEYKTILYYLNFPWIETLHTKLPLSVSAIHHFEDVKKLFEFNYIV
FT                   LLITSIMIGIMWRRIFTKTEWWNLLNLFKVSNIIILMLVCIVCLDFSNVFIVFHQLLFN
FT                   NRDWIFNPANTPIIKALPELFFETCFIEIVVIFELVMYTFNWFLKNRLRRE"
FT   gene            complement(477779..478420)
FT                   /gene="dedA"
FT                   /locus_tag="LSL_0438"
FT   CDS_pept        complement(477779..478420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="LSL_0438"
FT                   /product="DedA family protein"
FT                   /note="COG0586 [S] Uncharacterized membrane-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99248"
FT                   /db_xref="GOA:Q1WUT7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT7"
FT                   /protein_id="ABD99248.1"
FT                   /translation="MNFLIDFILHIDAHLVNIVNSFGNLTYLIVFGVIFIETGAVIMPF
FT                   LPGDSLLFAASALSASSEYHLNIWLFIILFWLASVTGDSLNYFIGHKVGRSVSQHHFFG
FT                   KFIKEENMKKTEAFFEKHGGIAISLARFMPIIRTLSPFVSGGTGVKYSTFIKYNLLGAT
FT                   AWVLICCGAGYFFGNIPVVKEHFSLVIIGIIVVSLIPAIIGALRSKLSKN"
FT   gene            complement(478481..479506)
FT                   /gene="trxB"
FT                   /locus_tag="LSL_0439"
FT   CDS_pept        complement(478481..479506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="LSL_0439"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COG0492 [O] Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99249"
FT                   /db_xref="GOA:Q1WUT6"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUT6"
FT                   /protein_id="ABD99249.1"
FT                   /translation="MPEDNLYDISIIGGGPIGMFAATYAGMRSAKVQLLESLGQLGGQP
FT                   QALFSEKTIYDIPGFSSISGKDLIRNLNTQLQQFNVDVYVNSPVLNIQKTEKNQFKIIT
FT                   NNRISYSKSIIISTGIGSFEPRRLRIANAEALENDKLFYTVNDPSIFENKTIAIAGGGD
FT                   SAIDWALELNTIAKDTIVIHRRNQFRAMESNVDKLKESGSKIMTPYTIDNLSTDNSHNN
FT                   LTIQLKKVRTKDTVELSVDALLVNYGFMSNNSILKSWDLDLITTKNNLIPVNSKLETNL
FT                   QNVYAIGDIANYPGRIDLIAVGMGEAPMAVNNALESLYPEKIQPKHSTQLVKNIKNNEN
FT                   N"
FT   gene            479626..480036
FT                   /locus_tag="LSL_0440"
FT   CDS_pept        479626..480036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0440"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /note="COG1098 [J] Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99250"
FT                   /db_xref="GOA:Q1WUT5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT5"
FT                   /protein_id="ABD99250.1"
FT                   /translation="MRYRIGMIIEGRITGIQPYGAFVSLDNRTQGLIHISECHHGYVDN
FT                   IRNFLKVGQMVRVMIIDIDEYTGKISLSIRCLEKAFDFSREKRRPGFNHRKYWTNKHVQ
FT                   EGFKPISKRMSKWINEALEDIEKKKKKLLTRY"
FT   gene            480393..481909
FT                   /locus_tag="LSL_RNA041"
FT   rRNA            480393..481909
FT                   /locus_tag="LSL_RNA041"
FT                   /product="16S ribosomal RNA"
FT   gene            481923..484882
FT                   /locus_tag="LSL_RNA042"
FT   rRNA            481923..484882
FT                   /locus_tag="LSL_RNA042"
FT                   /product="23S ribosomal RNA"
FT   gene            485127..485243
FT                   /locus_tag="LSL_RNA044"
FT   rRNA            485127..485243
FT                   /locus_tag="LSL_RNA044"
FT                   /product="5S ribosomal RNA"
FT   gene            485249..485321
FT                   /locus_tag="LSL_RNA045"
FT   tRNA            485249..485321
FT                   /locus_tag="LSL_RNA045"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Val anticodon TAC, Cove score 85.97"
FT   gene            485325..485397
FT                   /locus_tag="LSL_RNA046"
FT   tRNA            485325..485397
FT                   /locus_tag="LSL_RNA046"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.77"
FT   gene            485463..485535
FT                   /locus_tag="LSL_RNA047"
FT   tRNA            485463..485535
FT                   /locus_tag="LSL_RNA047"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Thr anticodon TGT, Cove score 86.05"
FT   gene            485540..485611
FT                   /locus_tag="LSL_RNA048"
FT   tRNA            485540..485611
FT                   /locus_tag="LSL_RNA048"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA Gly anticodon GCC, Cove score 83.89"
FT   gene            485624..485709
FT                   /locus_tag="LSL_RNA049"
FT   tRNA            485624..485709
FT                   /locus_tag="LSL_RNA049"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Leu anticodon TAA, Cove score 68.14"
FT   gene            485718..485791
FT                   /locus_tag="LSL_RNA050"
FT   tRNA            485718..485791
FT                   /locus_tag="LSL_RNA050"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Arg anticodon ACG, Cove score 69.22"
FT   gene            485798..485871
FT                   /locus_tag="LSL_RNA051"
FT   tRNA            485798..485871
FT                   /locus_tag="LSL_RNA051"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Pro anticodon TGG, Cove score 89.02"
FT   gene            485896..485969
FT                   /locus_tag="LSL_RNA052"
FT   tRNA            485896..485969
FT                   /locus_tag="LSL_RNA052"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 73.91"
FT   gene            485986..486059
FT                   /locus_tag="LSL_RNA053"
FT   tRNA            485986..486059
FT                   /locus_tag="LSL_RNA053"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 89.25"
FT   gene            486100..486189
FT                   /locus_tag="LSL_RNA054"
FT   tRNA            486100..486189
FT                   /locus_tag="LSL_RNA054"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Ser anticodon TGA, Cove score 62.46"
FT   gene            486200..486273
FT                   /locus_tag="LSL_RNA055"
FT   tRNA            486200..486273
FT                   /locus_tag="LSL_RNA055"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 77.81"
FT   gene            486278..486350
FT                   /locus_tag="LSL_RNA056"
FT   tRNA            486278..486350
FT                   /locus_tag="LSL_RNA056"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA Asp anticodon GTC, Cove score 71.42"
FT   gene            486360..486432
FT                   /locus_tag="LSL_RNA057"
FT   tRNA            486360..486432
FT                   /locus_tag="LSL_RNA057"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA Phe anticodon GAA, Cove score 73.32"
FT   gene            486452..486522
FT                   /locus_tag="LSL_RNA058"
FT   tRNA            486452..486522
FT                   /locus_tag="LSL_RNA058"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA Gly anticodon TCC, Cove score 71.75"
FT   gene            486531..486604
FT                   /locus_tag="LSL_RNA059"
FT   tRNA            486531..486604
FT                   /locus_tag="LSL_RNA059"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA Ile anticodon GAT, Cove score 92.91"
FT   gene            486608..486695
FT                   /locus_tag="LSL_RNA060"
FT   tRNA            486608..486695
FT                   /locus_tag="LSL_RNA060"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Ser anticodon GCT, Cove score 59.40"
FT   gene            486700..486771
FT                   /locus_tag="LSL_RNA061"
FT   tRNA            486700..486771
FT                   /locus_tag="LSL_RNA061"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA Glu anticodon TTC, Cove score 67.25"
FT   gene            486794..486867
FT                   /locus_tag="LSL_RNA062"
FT   tRNA            486794..486867
FT                   /locus_tag="LSL_RNA062"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 77.81"
FT   gene            486872..486944
FT                   /locus_tag="LSL_RNA063"
FT   tRNA            486872..486944
FT                   /locus_tag="LSL_RNA063"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA Asp anticodon GTC, Cove score 71.42"
FT   gene            487146..488336
FT                   /gene="metK"
FT                   /locus_tag="LSL_0441"
FT   CDS_pept        487146..488336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="LSL_0441"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG0192 [H] S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99251"
FT                   /db_xref="GOA:Q1WUT4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUT4"
FT                   /protein_id="ABD99251.1"
FT                   /translation="MTEKHLFTSESVSEGHPDKIADQISDSILDAMLEQDPEARVAVET
FT                   TVTTGLVVVVGEVSTTAHIDIQKVVRETIKEIGYKNGKYGFDGDNCAVITAIDEQSPDI
FT                   ALGVDNSLEVKNGDVDPLDQIGAGDQGMMFGYAINETPELMPLPISLSHHLMKKVAEVR
FT                   KNGTLAYLGPDAKAQVTVEYDDNNQPLRIDTVVLSTQHDENISLDQIRKDVMDQVITKV
FT                   IPDKYLDSNTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYAHHGGGAFSGKDATK
FT                   VDRSASYAARYIAKNIVAAGLASQVEVQISYAIGVAQPVSVSVNTFGSGKVPNQKLVDA
FT                   IRKVFDLRPAGIIKMLDLRRPIYKKTAAYGHFGRTDIDLPWEKTDKINELKKELDF"
FT   gene            488667..491084
FT                   /gene="leuS"
FT                   /locus_tag="LSL_0442"
FT   CDS_pept        488667..491084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="LSL_0442"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COG0495 [J] Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99252"
FT                   /db_xref="GOA:Q1WUT3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUT3"
FT                   /protein_id="ABD99252.1"
FT                   /translation="MSYKHIEIEKKWQRYWEEHKTFKTTEDDDKKNYYALDMFPYPSGQ
FT                   GLHVGHPEGYTATDIMARMKRMQGYNVLHPMGWDAFGLPAEQYALNTGNSPREFTKKNV
FT                   NNFRRQIKSLGLSYDWDREVNTTDPAYYKWTQWIFEQLYKKGLAYEAEVPVNWSPDLGT
FT                   VVANEEVIDGKTERGGFPVIRKPMRQWVLKITAYADRLIDDLDDLDWPEAIKEQQRNWI
FT                   GRSVGAAINFPVSGDENTKIEVFSTRPDTIFGVAALVLAPEHELVKQLTTPEHENEVEA
FT                   YIEKISHKSDLERTDLAKDKTGVFTGSYVVNPVSGEKLPIWIADYVLNSYGTGAVMVVP
FT                   AHDERDHEFAQKFDLPIVQVIEGGDVQKEAYTGDGVHINSDFLNGMDKEEAIDAINNWL
FT                   EENGVGEKKVNYRLRDWLFSRQRYWGEPIPVIHWEDGETTLVPEDELPLYLPKATDIKP
FT                   SGTGESPLANLDDWVNVVDENGRKGRRETNTMPQWAGSSWYFLRYIDPHNNHEIADYEK
FT                   LKEWLPVNLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGSNHEK
FT                   MSKSKGNVVNPDDIVEQYGADTLRLYEMFMGPLDASIPWSEEGLGGAHKFINRVWNLLI
FT                   DENDNLRDRVTTINNHDLDKIYNETVKKVTEDYEAMHFNTAISQLMVFVNNAYKADSLP
FT                   LEYVEGLVKLLSPVVPHITEELWSKLGHVGSIAYAKWPTYDESKLVEDVVEIVVQINGK
FT                   VRQHLQVSKDASREELQALALNDERIKQELADKEVKKVIAVPGKLVSIVVAK"
FT   gene            491324..492661
FT                   /locus_tag="LSL_0443"
FT   CDS_pept        491324..492661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0443"
FT                   /product="Amino acid permease"
FT                   /note="COG1113 [E] Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99253"
FT                   /db_xref="GOA:Q1WUT2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT2"
FT                   /protein_id="ABD99253.1"
FT                   /translation="MKNELSRALTHRHVQMIAIGGAIGTGLFLGSGSAIQKAGPALILA
FT                   YLIAGIFCFFMMRAIGELILSDKSKNSFIEFVKVYMGRGWEFIIGWTYWLCWASLAMAD
FT                   LTASGIYLRYWFPNLPQWLTALIIILVLLIFNLLSVGLFGELESWFSSIKVLAILALIG
FT                   TGIILLLTQANVGGNEVSIMNLFNHGGFFPKGTIGFMAAFPMVIFAFTGIEMVGLASGE
FT                   TANPEKDIPQAINTLPFRIGLFYIGSMFVLMCIYPWNEIVTTSSPFVQVFNGIGIKFAA
FT                   GIINFVVLTAALSACNSAIFSTSRTLFVLSHSGHAPKSFGQTNNRSIPVKSLLFSSSSL
FT                   FLIVILNYVLPKSIFDIISGVATVSFVFVWIALVWCHYQYRKNSPNNNEKIFPMPLYPV
FT                   SNVITIIFFVLVLVLLTFNTNTLMSLIFSIVWFGILGAIYFFKARK"
FT   gene            492781..494427
FT                   /locus_tag="LSL_0444"
FT   CDS_pept        492781..494427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0444"
FT                   /product="Export protein for polysaccharides and teichoic
FT                   acids"
FT                   /note="COG2244 [R] Membrane protein involved in the export
FT                   of O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99254"
FT                   /db_xref="GOA:Q1WUT1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT1"
FT                   /protein_id="ABD99254.1"
FT                   /translation="MNDNNEQIKKDLEETSSKEKMLKGSAWMTAGSIFSRILGAIYIIP
FT                   WATWFGVNYLQANALFTKGYTVYALFLMLSTAGIPSAVGKQVAHYNSLNEYGIGRRLFK
FT                   RSLGVMMFLGIISAMILWFIAPLISQGDAAVIPVYRSLAVTLLLIPVMSLTRGFFQGYF
FT                   DMAPFAISQLVEQVARIVYMLAATYLITQVLHGSYQSAVVQSTFAAFIGAVGGLLVLLW
FT                   HYWRKRPTMNYLLAHSNNKLEVSDKRLIKEILYQSIPFIIIGSTTTLYNLFDQFSFPTI
FT                   MSFVTDYSTKEINALYALFAGNANKLIMITISVAAAMADTAIPLLSQAVTKNDNEEVSA
FT                   ALLDSVELFFFVMLPCSFGMAAVSRPLYVLFYPYDYTGIFVLAFSSYIALALGLFMVLA
FT                   ALLQGIYENTIAIKFAVIGMIVKVIIQFPLTAFLHVYGPLAATGIGMTVSNVLIFRYLY
FT                   FKYNLNINKLQKNTNMMMLFSLFMFIVVLVISFALGKVTNTYSKFQSTIVLIIGAGIGG
FT                   YIYAFLSLKARLADDILGARANFLRRILRIK"
FT   gene            494432..495154
FT                   /gene="rsuA"
FT                   /locus_tag="LSL_0445"
FT   CDS_pept        494432..495154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="LSL_0445"
FT                   /product="Ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG1187 [J] 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99255"
FT                   /db_xref="GOA:Q1WUT0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUT0"
FT                   /protein_id="ABD99255.1"
FT                   /translation="MYMRLDKFLSQTGKFTRAEAKKVIKAKRVRLNDEVVKDGKIKINE
FT                   ESDKIFLDGELLALNNKEVYYMLNKPAGVVSATRDDKDKTVIDLINFPGRKEDLFPVGR
FT                   LDKETTGLLIITNDGKFAHDIISPKKHVSKTYEAVVTGKISEKEVKIFSQGMELSNGDK
FT                   LQPAQLDIISYSEKDDTSKVRVIIHEGKYHQVRRMFGAVSQRVLELDRVKIGLLELDDT
FT                   LERGEYRELTEEELNLIK"
FT   gene            complement(495185..496036)
FT                   /locus_tag="LSL_0446"
FT   CDS_pept        complement(495185..496036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0446"
FT                   /product="Sugar kinase"
FT                   /note="COG0061 [G] Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99256"
FT                   /db_xref="GOA:Q1WUS9"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS9"
FT                   /protein_id="ABD99256.1"
FT                   /translation="MEITLDILQKVIKKREPNSHKGNFGRVLLIGGNINYGGAIIMAAS
FT                   AAVHTGAGLVTVATNKENLSSLHSVVPEAMFINFFDKVSLTTAISTADVVVVGPGLGAD
FT                   NRAKEVLEVTLSNISDNQLCIIDGSAITLISENDSLKELIANNKKIIFTPHQMEWQRLS
FT                   GIPIDKQIDDINLQKQTSLNATVILKKHHTTIYHQSGTIDNLAIGGPFMATGGMGDILT
FT                   GVLAAFITQFKESSLDERINAAVYLHSYIAENLSHKYYVTLPTDIIKKIQKTMLKVISE
FT                   QK"
FT   gene            496152..497561
FT                   /locus_tag="LSL_0447"
FT   CDS_pept        496152..497561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0447"
FT                   /product="Xaa-His dipeptidase"
FT                   /note="COG0624 [E] Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99257"
FT                   /db_xref="GOA:Q1WUS8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS8"
FT                   /protein_id="ABD99257.1"
FT                   /translation="MAIDWKAEVEKRRDDILEDLKTMLRIESVRDESIATADAPLGPGP
FT                   KEALDAFLNIGKRDGFEVEEFDGMAGHIKFGDGKEDLGILAHVDVMPAGKGWNTDPFNP
FT                   VIKDGKLYARGASDDKGPSMAAYYGLKIVKELGLPVKKSVRFILGTDEESSWRGMTHYF
FT                   EKMPKPTIGFSPDAFFPIINGEKGNFSMLVKFDGKNGDELKLLSFDSGLRDNMVPRDAV
FT                   AIVEGNDLESIAADFKQYVAENSVLSGDAEIKDGKLELSLIGKAAHAQEPRNGENAGTY
FT                   LAVFLNKYNFAKDAKGYLAFAAEYLHQDSRMDNFGISYTDEVMGDLTMNAGIFTFEAGK
FT                   GGEITLNFRYPRGIDDEYVFNAVKEAATKLEAVSFEKKEHAMVPHYVSPEDPLVSKLLA
FT                   VYSRQTGQEAHGMVVGGGTYGRLLERGVAFGAMFPGVEDTMHQANEFIPVDDVMKAAAI
FT                   YAESIYELIKD"
FT   gene            complement(497858..497941)
FT                   /locus_tag="LSL_RNA064"
FT   tRNA            complement(497858..497941)
FT                   /locus_tag="LSL_RNA064"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Leu anticodon CAG, Cove score 52.52"
FT   gene            complement(497989..498273)
FT                   /locus_tag="LSL_0448"
FT   CDS_pept        complement(497989..498273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0448"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99258"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS7"
FT                   /protein_id="ABD99258.1"
FT                   /translation="MFLSTSGLNQSYILKGIVNATVKRTLKAEELDEVDQFDNLYAQVQ
FT                   KKLENKALELDADGVIDIRFVPQIVRVSVGPKYMLLHGYGTAISFPKKN"
FT   gene            498676..499122
FT                   /gene="fabA"
FT                   /locus_tag="LSL_0449"
FT   CDS_pept        498676..499122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="LSL_0449"
FT                   /product="(3R)-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /note="COG0764 [I]
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99259"
FT                   /db_xref="GOA:Q1WUS6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS6"
FT                   /protein_id="ABD99259.1"
FT                   /translation="MAIMDAQEIMDMIPNRYPICYIDYVDELVPGEKIIATKNVTINES
FT                   FFRGHFPGNPVMPGVLLIETLAQAASILILKSPEFVGKTAYLGSISKAKFRKVVRPGDV
FT                   LKLNVEMKKKHENMGIVDTQVIVNGKKACTAELMFIVADRDKKL"
FT   gene            499199..499639
FT                   /locus_tag="LSL_0450"
FT   CDS_pept        499199..499639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0450"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /note="COG1522 [K] Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99260"
FT                   /db_xref="GOA:Q1WUS5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS5"
FT                   /protein_id="ABD99260.1"
FT                   /translation="MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINA
FT                   ISMYDHQTASQVAKKLHLTPGTLTATIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLV
FT                   YRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLEDFLKEHS"
FT   gene            499656..500636
FT                   /gene="fabH"
FT                   /locus_tag="LSL_0451"
FT   CDS_pept        499656..500636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="LSL_0451"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0332 [I] 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99261"
FT                   /db_xref="GOA:Q1WUS4"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS4"
FT                   /protein_id="ABD99261.1"
FT                   /translation="MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHI
FT                   SLNESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSFTPATAAIVQGRISADNAV
FT                   CFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLIDWNDRSTAVLFGDGAAG
FT                   ALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRKYTTFKMDGRRVY
FT                   TFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDSF
FT                   GNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY"
FT   gene            500656..500898
FT                   /gene="acpP"
FT                   /locus_tag="LSL_0452"
FT   CDS_pept        500656..500898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LSL_0452"
FT                   /product="Acyl carrier protein"
FT                   /note="COG0236 [IQ] Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99262"
FT                   /db_xref="GOA:Q1WUS3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS3"
FT                   /protein_id="ABD99262.1"
FT                   /translation="MTEAEVLKKVQDIVVEQLDVDVDDVTLTADIKDDLDADSLDVFEI
FT                   MNELEDDLDIKLEADENIKTIQDVVTYVKKELDNK"
FT   gene            500912..501850
FT                   /gene="fabD"
FT                   /locus_tag="LSL_0453"
FT   CDS_pept        500912..501850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="LSL_0453"
FT                   /product="Malonyl-CoA-[acyl-carrier-protein] transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="COG0331 [I] (acyl-carrier-protein)
FT                   S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99263"
FT                   /db_xref="GOA:Q1WUS2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS2"
FT                   /protein_id="ABD99263.1"
FT                   /translation="MKLAILFSGQGSQFTDMGLDFYQESPIFKDCVDKASEIADFKITS
FT                   VFANDGDKLSETKYIQPAIVAMSIGIWKMLQNTLGDKLAVEGMVGLSLGEYSALIASQK
FT                   LSFSDGMSVLKDRAIYMQDDANKVDSKMAAIIDPQIEVIEKLCTDYPNVYVANYNTPKQ
FT                   LVIGGDGEELVDVVDKIDSLNAAKKIVELKVSGAFHTPLFTNASQKMKKRLSNVTFAEG
FT                   SNLVVSNTTMRPFEKDSLAEILAKQIIKPTHFGECVQYLIDNKKIDTVLEIGPGKTLSK
FT                   FTKQIDKSIKRYHISKLSDFKKFIDSVKESE"
FT   gene            501851..502582
FT                   /gene="fabG"
FT                   /locus_tag="LSL_0454"
FT   CDS_pept        501851..502582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="LSL_0454"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 [IQR] Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99264"
FT                   /db_xref="GOA:Q1WUS1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS1"
FT                   /protein_id="ABD99264.1"
FT                   /translation="MELKEKVVLVTGSSRGIGAEIALAFARKGSTVVLNGRHQIPNDMI
FT                   SKMEEIGCNYDVILGDISIESDVKRIVKEAIEKFGRIDILINNAGITNDKLLIGMKPAD
FT                   FKSVIDVNLIGTFQMTQAVVKKMYKQRSGVIINLASVIGQHGNIGQANYAASKAGVIGL
FT                   TKSVAKEGAMRNIRVNAIAPGMIVSDMTDVLSDKVKENILTTIPLNRFGKAEEVAQTAV
FT                   FLAENDYITGQVITVDGGMTI"
FT   gene            502595..503833
FT                   /gene="fabB"
FT                   /locus_tag="LSL_0455"
FT   CDS_pept        502595..503833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="LSL_0455"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0304 [IQ] 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99265"
FT                   /db_xref="GOA:Q1WUS0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUS0"
FT                   /protein_id="ABD99265.1"
FT                   /translation="MTNRVVITGMGIVGPVGNDRETFLKNIFDSKVGIEKITKFDATQT
FT                   GISVAGEVKDFDPKNSIGKKAAKRMDLFSQYAVHSAIEAVEQAGINEENTDSYDMGVIY
FT                   GSGIGGLTTIQEQVIKMHEKGPKRVSPMFVPTSIVNMAAGNIAMHFGAKNICTAVVTAC
FT                   SSATNAIGEAYRQIKEGRAQVMLTGGSEASVNEIGIAGFAALTALSPEKDPLKASLPFD
FT                   RNRSGFVMGEGGATLVLENLEHAQKRNATILGEVVGYGSTCDAFHITSPDPTGEGAARA
FT                   MKQAIDEAGITPDKVGYINAHGTATHANDSGESLAINKVFGENSSVMVSSTKSMTGHLL
FT                   GAAGAIEAAITVRALQMQQLPENVGLNELDEECNINIVTKDKTTTSNLEYAISNSLGFG
FT                   GHNAVLALRKWSE"
FT   gene            503836..504285
FT                   /gene="accB"
FT                   /locus_tag="LSL_0456"
FT   CDS_pept        503836..504285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="LSL_0456"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /note="COG0511 [I] Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99266"
FT                   /db_xref="GOA:Q1WUR9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR9"
FT                   /protein_id="ABD99266.1"
FT                   /translation="MDFNDVKKLMEDFNNSPTRELEITTDGFHIHLSKNEAPFISQDNK
FT                   NYADSPAIEASDESIISSKNDDLDDASLIKSPMVGTVYLQPEPEKAAYVSVGSHVHKGD
FT                   VVCIIEAMKMMTEIKSEYTGEVVEVLVDNEDLVEFDQPLFKIKEG"
FT   gene            504290..504712
FT                   /gene="fabA"
FT                   /locus_tag="LSL_0457"
FT   CDS_pept        504290..504712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="LSL_0457"
FT                   /product="(3R)-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /note="COG0764 [I]
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99267"
FT                   /db_xref="GOA:Q1WUR8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUR8"
FT                   /protein_id="ABD99267.1"
FT                   /translation="MLDITEIKKIIPHRYPMLLIDRVEELIPGEKAVAKRNVTINEELF
FT                   NGHFPGNPVMPGVLIVEALAQTGAVALLSLPEFKGKTAYFGGIKSAKFRKVVRPGDSLR
FT                   LEVTLEKIRNNVGLGKAIATVDGKKACTAELTFMIG"
FT   gene            504737..506116
FT                   /gene="accC"
FT                   /locus_tag="LSL_0458"
FT   CDS_pept        504737..506116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="LSL_0458"
FT                   /product="Biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="COG0439 [I] Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99268"
FT                   /db_xref="GOA:Q1WUR7"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR7"
FT                   /protein_id="ABD99268.1"
FT                   /translation="MFSKVLVANRGEIAVRIIRSLKELGIKSVAIYSTVDRESLHVQLA
FT                   DEAVCVGTARPQDSYLNMKNILAAAIGTGAEAIHPGFGFLSENSQFVEMCEAVGITFIG
FT                   PNSEIIDLMGNKANAREQMQKSGVPVIPGSEGFIETVEEAKKVANKVGYPVLLKAAAGG
FT                   GGKGIRKVNDDNELTSLFEEAKREAQVSFGDKRMYLEKIMTNVKHIEVQIFRDKQGNVV
FT                   YFPERDCSVQRNKQKMIEESPCLLITEEQRKELGNIAIKAANAINYVNTGTIEFLMDSQ
FT                   HNFYFMEMNTRIQVEHTVTEMVTGIDLVKAQVKVASGERLPFNQNDIQINGSAIECRIN
FT                   AEDPSKNFMPQVGKVRYLYFPVGNLGMRIDSDLYAGWEITPFYDSMIAKVISLGQDRHE
FT                   AIEKVKRLLSEMLITGVKTNQSFYLDILKDKNFLDGKVTTEYLEQNFLPKWKEEHKDAA
FT                   I"
FT   gene            506103..506954
FT                   /gene="accD"
FT                   /locus_tag="LSL_0459"
FT   CDS_pept        506103..506954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="LSL_0459"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0777 [I] Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99269"
FT                   /db_xref="GOA:Q1WUR6"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUR6"
FT                   /protein_id="ABD99269.1"
FT                   /translation="MQLFDELKTISKKHIKANKKAGEKVPSGLWISCPKCQQSIYHKDL
FT                   GKYKTCPNCYYGFRIHARERLEWLVDTFQEFDTDLETKDPLNFPGYKEKLIKAQQDSKL
FT                   NDSVLTGIAMIDDVEFALGIMDPYFIMGSMGTVTGEKITRLFERATQKNLPVILFTASG
FT                   GARMQEGISSLMQMSKISQAVKEHSNAGLLYITVITDPTTGGVTASFAMQGDIILSEPR
FT                   ALLGFAGKRVIEQTIHQKVPDDLQDAETVLKNGFIDNIIKREDQKEKLAWLVKIHSMKG
FT                   AF"
FT   gene            506955..507743
FT                   /gene="accA"
FT                   /locus_tag="LSL_0460"
FT   CDS_pept        506955..507743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="LSL_0460"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0825 [I] Acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99270"
FT                   /db_xref="GOA:Q1WUR5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR5"
FT                   /protein_id="ABD99270.1"
FT                   /translation="MPKILKKKKTASEIVAAARGLKKVTANELIDGIFDDFFELHGDRK
FT                   YSDDEAIIGGIALFNGIPITVIATDKGGTPEERIAKHFGCPEPSGYRKSLRLMKQAEKF
FT                   NRPIVTFVNTSGAYPGRSAEENGQGEAIARNLLEMSDLKVPIISFIYGEGGSGGALALA
FT                   CGDQVWMLEDSMYSILSPEGFASILWKDSKRADEAAEVMQLTPEALLKQEIIEGIIPES
FT                   NSHRKVCKEIKKILAQELKNLTSLTKFELVKRRKERYRKF"
FT   gene            507759..508517
FT                   /gene="fabI"
FT                   /locus_tag="LSL_0461"
FT   CDS_pept        507759..508517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="LSL_0461"
FT                   /product="Enoyl-[acyl-carrier protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="COG0623 [I] Enoyl-[acyl-carrier-protein] reductase
FT                   (NADH)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99271"
FT                   /db_xref="GOA:Q1WUR4"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR4"
FT                   /protein_id="ABD99271.1"
FT                   /translation="MSDLLKGKKILVMGVANKRSIAWGCSQMMMENGAELIFTYQNDRI
FT                   KKSLSRLVSEEEKLVECDVSDDASIENAFKLVNERFGKVDGILHAIAFANKEELGGEIM
FT                   QASREGYALAQDISAYSLIAVAKYGREILNDPSSIVTLTYFGSERAIPNYNVMGVAKAS
FT                   LEASVRYLARDMAKYGTRVNAISAGAIKTLAVTGIKGHSELLKMSEERTVDGESVTIRE
FT                   VGGTCAFLMSDLSIGVVGDVIYVDKGVHLI"
FT   gene            508664..510148
FT                   /gene="zwf"
FT                   /locus_tag="LSL_0462"
FT   CDS_pept        508664..510148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LSL_0462"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COG0364 [G] Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99272"
FT                   /db_xref="GOA:Q1WUR3"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR3"
FT                   /protein_id="ABD99272.1"
FT                   /translation="MTEKGKEQNALFIIFGATGDLAQRKLYPSLFNLYKKGFLCKRFAV
FT                   IGTARRPWTDEHFQQVVRNSISGMEDTAAQTTEFSRHFYYQSHNVNDVEHYVTLKKLAE
FT                   KLDEKYKINGNRLFYLAMSPRFFGTICKYLKSEEIVTDEGYNRVIIEKPFGHDLQSAVE
FT                   LNDEIAKYFSEESVYRIDHYLGKEMNQNILAVRFGNNIFRALWNNRYIDNIQITLSESL
FT                   GVEDRAGYYETAGALRDMVQNHILQIVSLLTMNAPVTFTDVDIRREKISALKALQLYTP
FT                   EEVKKYFVRGQYAHTEDLNGYREEDQVDPNSTTETFVAGKLHVNSMNFAGVPIYIRTGK
FT                   RLAAKSTRVDVVFKNMPNNIFNANKKLLPNVLSFDIDANPGMSLTLNTKKVSQSGYKLE
FT                   NRALSYRHDISTQAITPEAYEKLILDAVKGDATNFVHWEEVYYSWRFIDSVRTAWDNED
FT                   VTPDELTNYNCNTMGPKISDELLAKDGNYWFFDPTK"
FT   gene            510341..511627
FT                   /pseudo
FT                   /locus_tag="LSL_0463"
FT   misc_feature    510341..511627
FT                   /pseudo
FT                   /locus_tag="LSL_0463"
FT                   /note="Similar to transposase ISLasa4h, ISL3 family;
FT                   nonfunctional due to interrupting stop codon"
FT   gene            complement(511732..513084)
FT                   /gene="pgi"
FT                   /locus_tag="LSL_0464"
FT   CDS_pept        complement(511732..513084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="LSL_0464"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="COG0166 [G] Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99273"
FT                   /db_xref="GOA:Q1WUR2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUR2"
FT                   /protein_id="ABD99273.1"
FT                   /translation="MAHISFDSSNLTKFVNDNELGEMQALVTAVDKELREGTGAGNDFR
FT                   GFLNLPVDYDKDEFDRIKKAAKKIQSDSEVLVVIGIGGSYLGARAAIDFLHHQFFNLLP
FT                   AEKRNAPQIFFAGNSISGSYVHDLIELIGDRDFSVNVISKSGTTTEPSIAFRVFKEKLI
FT                   AKYGVEGARERIYATTDRARGALKTEADAEGYETFVIPDDVGGRFSVLTPVGLLPIAVS
FT                   GADIDKLMQGAADAREEYSDADLTKNEAYQYAALRNILYRKGYTTEILENYEPTLQYFA
FT                   EWWKQLMGESEGKDGKGIYPSSANFSTDLHSLGQYIQEGMRNLMETVITVGNPTNDTDI
FT                   PKEEENLDGLGYLEGKSMNYVNSKAFQGVVLAHTDGNVPNMIVNIPDQTEYTLGYMIYF
FT                   FEIAVAISGYLNGINPFNQPGVEAYKKNMFALLGRPGYEELTKELQDRLNK"
FT   gene            513311..515494
FT                   /locus_tag="LSL_0465"
FT   CDS_pept        513311..515494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0465"
FT                   /product="Sulfatase family protein"
FT                   /note="COG1368 [M] Phosphoglycerol transferase and related
FT                   proteins, alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99274"
FT                   /db_xref="GOA:Q1WUR1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR1"
FT                   /protein_id="ABD99274.1"
FT                   /translation="MNLLRIKKFLNTRWGFFSLLVFLFWLKTILVYFIDFHLGVKGIYQ
FT                   YFVLLVNPLATTLLLLGIALYIKRTIPSYIFMGLIYIANTALLMFNVIYYREFTDFMTI
FT                   NTIFGYSTVSQGLSGSSFALLKPQDIIIVADIIIVVLGFITGFLHLDKRPIPRVQALAL
FT                   TSFSLFCLVLNITLGEISRPQLLSRTFDRNYLVKYLGIDTYMVYDGLKTARNSQVRNKA
FT                   GSSDLNNIINFTRNHYAEPNSKMYGIAKGRNVIVIHLESFQQFLINYKLNDKEVTPFLN
FT                   SLYNSKETYSFANFFNQVGQGKTSDAENMLETSTYGLSQGSLFSILGTDNTFEGAPAIL
FT                   GQSQGYTSAVFHGNSGSFWNRNNVYKNLGYDYFFDSSYYNTDANNLTEYGLKDKLLFHD
FT                   SVKYLERLQQPFYTKFVTVSNHFPFALDDQNTSFDKANTSDASINNYFVTAHYLDQAVQ
FT                   EFFEYLKKSGLYDNSIIVLYGDHYGISDTRNLKLASLLGKSSSTWSDFDNTQMQRVPFM
FT                   IHIPGTKDGGVQTQYGGEIDVLPTLLHLLGIDSRDYIQFGTDLFSSKHDQVVAFRNEDF
FT                   ITPKYTVIGNTIYQNSTGKILTHPSQKVKDEIKKDREKVNTELSLSDTLNNKNLLRFYI
FT                   PTGFTPVDPKKYNYTNQYGQILKIQEDLGKKSTSLWSKNGNKTTIDDYSSDAPELTTTD
FT                   QNDANVSSVKNTLKSNKKESIDTSSSSAESDSD"
FT   gene            complement(515606..516343)
FT                   /gene="glpF"
FT                   /locus_tag="LSL_0466"
FT   CDS_pept        complement(515606..516343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="LSL_0466"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /note="COG0580 [G] Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99275"
FT                   /db_xref="GOA:Q1WUR0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUR0"
FT                   /protein_id="ABD99275.1"
FT                   /translation="MDFPLFTRLAAEFFGTAIMLMLGNGSVADVELKGTKGYHSGWITI
FT                   SIGYGFAVLVPALMFGSVSGGQFNPAMTLGLAINGAFPWNEAFLYILAQFLGAIAGQLV
FT                   VVACFYPHYDITEDPESILGTFSTISATNSRFNGFVNEFFGTFTLVFGALAITHTSFFE
FT                   HGNQGAGYIGIGLLVMVLVTSFGGPTGPALNPARDLGPRIVHALLPLKHKGSSQWDYAW
FT                   VPVLAPICAAVSGVLIYNIIFGL"
FT   gene            516557..517021
FT                   /locus_tag="LSL_0467"
FT   CDS_pept        516557..517021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0467"
FT                   /product="CBS domain containing protein"
FT                   /note="COG0517 [R] FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99276"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ9"
FT                   /protein_id="ABD99276.1"
FT                   /translation="MMSQPIEQMLMRNSEDFLIPADIVANVQEENHLDHAFMVLTKVRY
FT                   AKIPVLDHNQKFKGLLSLSMITEEMLGLKGIDARCLSKKQVKDVMQTEVETIKPTADCE
FT                   EILHRLVNQPFLVVVDDDNRFLGIVTRRELLKSMNYLSHEFDNFYVTEPK"
FT   gene            517047..517751
FT                   /locus_tag="LSL_0468"
FT   CDS_pept        517047..517751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0468"
FT                   /product="Tetrahydrodipicolinate N-acetyltransferase"
FT                   /EC_number="2.3.1.89"
FT                   /note="COG2171 [E] Tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99277"
FT                   /db_xref="GOA:Q1WUQ8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUQ8"
FT                   /protein_id="ABD99277.1"
FT                   /translation="MAKLDAHDIIRTIAESKKKTPVKVYVKGDLNSLDVPSNVETYFTD
FT                   NVGVMFGDWADVEPILKDSSVESYHLENDGRNTGVAMVDKKKFNARIEPGAIIRDQVEI
FT                   GDNAVVMMGAVINIGAEIGEGSMIDMGAVLGGRAIVGKNCHIGAGTVLAGVVEPPSAQP
FT                   VVIEDDVLIGANAVVLEGVRVGKGAVVGAGAVVTKDVEPYTVVMGMPAKKVKDVSQVDD
FT                   SKTEIVDDLRKL"
FT   gene            517868..519013
FT                   /locus_tag="LSL_0469"
FT   CDS_pept        517868..519013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0469"
FT                   /product="N-acetyldiaminopimelate deacetylase"
FT                   /note="COG1473 [R] Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99278"
FT                   /db_xref="GOA:Q1WUQ7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUQ7"
FT                   /protein_id="ABD99278.1"
FT                   /translation="MTLQENELIKIRRDLHQIPEIGLEEYETSDYLLKIINGLPQENLE
FT                   IKRWKTAILVHLNGENKNYTIGYRTDIDGLPVEEKTGLPFSSKHEGRMHACGHDIHMTV
FT                   ALGVLSYFASHRPKYNMTFIFQPAEENASGGMKLYQSGELDEWMPDEIYALHDNPQLPA
FT                   GTIGCRKGTLFAGTCEIHVKFIGKSGHAAYPHQANDMVVAGAQFVNQIQTIVSRNVDPI
FT                   QSVVVTLGHFSAGTTGNVISGVCQIDGTIRALTQENNLLIQKRVRTIAEGIAHSFDCEL
FT                   EIDLHQGGYYPVENDDNTTEAFINYMKNEDDVDFVETLPAMTGEDFGYLISKIPGTMFW
FT                   LGVDSPYSLHSEYLAPKEESIMLGVNAITGYLKNRQESLNK"
FT   gene            complement(519110..520000)
FT                   /locus_tag="LSL_0470"
FT   CDS_pept        complement(519110..520000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0470"
FT                   /product="Mechanosensitive ion channel"
FT                   /note="COG0668 [M] Small-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99279"
FT                   /db_xref="GOA:Q1WUQ6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ6"
FT                   /protein_id="ABD99279.1"
FT                   /translation="MLNFWLESNIITKKVSTDTNIFKKYIDNFNWDELLSKVITTTILL
FT                   LLVSLLFYIFHYIGKKIIKRAFKKNRLVESLSSGRINTAYTLSQNIFHYFILFFYFYAV
FT                   LSLLGIPIGSLIAGAGIMGVAIGLGAQGFVTDVVTGFFILLEQQFTVGDDVKIGTISGK
FT                   VAAFGLRTTQILDYDGTLHYIPNRSITIVSNLSRNDMRAQIDIHVKPNQDFDKIKTAIQ
FT                   NVNKSLTPKFDDITKKPQILGVVETPNGLVYRVIIFTKNGAQAPVQRAFLAKYLEALKQ
FT                   AGLEMPISPINLSAK"
FT   gene            520190..520855
FT                   /locus_tag="LSL_0471"
FT   CDS_pept        520190..520855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0471"
FT                   /product="Transcription regulator, Crp family"
FT                   /note="COG0583 [K] Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99280"
FT                   /db_xref="GOA:Q1WUQ5"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ5"
FT                   /protein_id="ABD99280.1"
FT                   /translation="MRSIIKKEFTLSNEEQEILVRACRIKKFKYAETIYNEVDDRTHYY
FT                   YLLNGNIEITKLYGDREVPFYKGRGRFFPNFSQNEDLCCERVTVASKIATVLVIKHDVM
FT                   EKLVRAGKEFCNLVWDDIIEELDFLKSLSQEIGNRNKLEALDRTYRLYAIFIDEKDKHG
FT                   HYELPRSLNQEKLSKILGTTRVTVNKKIKELRQKRVLLQKERNMRIANKAIEEFKNFL"
FT   gene            520935..523079
FT                   /gene="mrcA"
FT                   /locus_tag="LSL_0472"
FT   CDS_pept        520935..523079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="LSL_0472"
FT                   /product="Multimodular transpeptidase-transglycosylase PBP
FT                   2A"
FT                   /note="COG0744 [M] Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99281"
FT                   /db_xref="GOA:Q1WUQ4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ4"
FT                   /protein_id="ABD99281.1"
FT                   /translation="MKIKDFFEKIKDDFLANSRIFGSWFKKKWTRYQGWRWLTIVFLSI
FT                   FFLISSYGVFLAKKTNVRGLKSALQTSTEIYDYKGQKAGALYSQKGTWVPLDKISDNVQ
FT                   NAVLSTEDRNFYHEYGFSITGIGRATLLYAKNKILHRDYISGGGSTLTQQLVKNAFLSQ
FT                   EQTFSRKIKEIFIAMQVENDYSKKDILAMYLNNAYFGNGVWGVEDAAEKYFGVHASKLS
FT                   VPQAATLAGMLKSPTAYNPIDHPQASRDRRNVVLGLMEDNKKLSAEQVSQYQATPMTTN
FT                   DNYQYTSSYRYPYYFDAVINEAMNRYGLSETDIMNRGYKIYTSLNQNYQNEMQDDFADS
FT                   SLFPYNAEDGTKAQGASIAINPQNGGVAAVVGGREGTHVFRGYNRGTQLVRSPGSTIKP
FT                   LAVYTPALQLGYHYDTDVKDELKAYGKDKYEPHNWNDVYSGEIPMYQALAESKNTSAVW
FT                   LLNKIGVSKGYKSVEKFGIKLTSDDENLSLALGGLKKGVSPYQMANAYTAFANGGKLYT
FT                   AHFITKIVDAQGKVIVDNTENDSKKIMTKKIANEMTSMMMDVYRTGGTGQSASPSGYTI
FT                   AGKTGSTESLTASNSSNENDHWYIGYTPDVVVATWVGFDSTKYSLSEEGIRGGASLFKN
FT                   EMEGILPHTAGNTFTVKPASTMVAQESGASSSSSNVWDTFRKAGETLDDSFSKSASDWG
FT                   SKASSLFDQGKQKLQEWFGQ"
FT   gene            523125..523469
FT                   /locus_tag="LSL_0473"
FT   CDS_pept        523125..523469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0473"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99282"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUQ3"
FT                   /protein_id="ABD99282.1"
FT                   /translation="MINVYDTANQLEKDLRESQEYKDLQAVVAKVKADDATFAVYKKLR
FT                   EAQKTLQEQQMQGTLDEKVMKSLQEISQEASQYPLMMELMEKERAISVLIDDLNKIIFK
FT                   PLSEVYDIEG"
FT   gene            523562..524509
FT                   /locus_tag="LSL_0474"
FT   CDS_pept        523562..524509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0474"
FT                   /product="CMP-binding factor"
FT                   /note="COG3481 [R] Predicted HD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99283"
FT                   /db_xref="GOA:Q1WUQ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ2"
FT                   /protein_id="ABD99283.1"
FT                   /translation="MEEKKLLDFSINENMDIFVLIKSAEVRVAKNGKKFIAFNFADKSG
FT                   EISAKFWNATEKEIEEFKEGKVVRLKGKRENYQDNPQIKIFNLRIATENEPNKPEYYLQ
FT                   TAPESIKKIEEEINNTFFEITNPKWNRIVRYLLNKYHDSFFSFPAAKKNHHAFSGGLAF
FT                   HTVSMLRLAKAIAKEYDVLNESLLYAGVLLHDLGKVKELSGPIATKYILEGNMIGHIVI
FT                   VDEEIVKACEILQIDYNSEEVILLRHMILSHHGLLEYGSPVRPHIMEAEVLHQIDQLDA
FT                   SIQMMKSSLSHTESGEFSERIFGLDGRNFYKPKE"
FT   gene            complement(524582..525472)
FT                   /gene="surA"
FT                   /locus_tag="LSL_0475"
FT   CDS_pept        complement(524582..525472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="LSL_0475"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COG0760 [O] Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99284"
FT                   /db_xref="GOA:Q1WUQ1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUQ1"
FT                   /protein_id="ABD99284.1"
FT                   /translation="MKKKWLVAISGIVLTFGLAACSKTVATTSGGKITESEYYSSMKKT
FT                   SSGKQVLQQMILNKVLEKEYGSKVSDKKVNEQYNTYKKQYGSSFDSVLAQNDMTKSSFK
FT                   QEIRSNLLLKEAVKDNTKITNKQLKAQWKEYEPKVTVAHILVSKKSTAEDIINKLKEDG
FT                   SYANFKKLAKKYSTDSSTKNDGGKLAAFDNTDTSLDSTFKKAAFGLKQGSFTTEPVKTE
FT                   YGYHVIYSIKNPGKGKMSDHTSELKSQIIDSKMSDSTTLQTVVSKVLKKGNVSIKDKDL
FT                   QNILSSYLGSSSSSK"
FT   gene            complement(525592..525870)
FT                   /locus_tag="LSL_0476"
FT   CDS_pept        complement(525592..525870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0476"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99285"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUQ0"
FT                   /protein_id="ABD99285.1"
FT                   /translation="MKKRKLIIPIALGAVGLAYYNRKALKNEFLIYKDYYENLSKELSQ
FT                   VSFASKKVLFNVMQLLDQVSESSDTIENLLTEIDTFSQEVNKTLDSF"
FT   gene            complement(525874..526302)
FT                   /locus_tag="LSL_0477"
FT   CDS_pept        complement(525874..526302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0477"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /note="COG0537 [FGR] Diadenosine tetraphosphate (Ap4A)
FT                   hydrolase and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99286"
FT                   /db_xref="GOA:Q1WUP9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP9"
FT                   /protein_id="ABD99286.1"
FT                   /translation="MEDCIFCKIIAGEIPSTKVYEDDEVLAFLDISQVTPGHTLVVPKK
FT                   HVANIYEYDTDLAAKVFSRIPMLARAIKNSNPNILGLNILNNNGEVAYQSVFHSHIHLI
FT                   PRYSKKEGFGLKFDDNSSKYDSKKLQEIANQIASKVEK"
FT   gene            526423..527163
FT                   /locus_tag="LSL_0478"
FT   CDS_pept        526423..527163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0478"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1131 [V] ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99287"
FT                   /db_xref="GOA:Q1WUP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP8"
FT                   /protein_id="ABD99287.1"
FT                   /translation="MTLKVKNLVGGYSQIPVLKGIDFSVDNGELVGLIGLNGAGKSTTI
FT                   NHIIGLLHAMKGSIEIDGITIDEDAQAYKSKIAYIPETPILYDELTLKEHIELTILAYN
FT                   LDKDEAWKKANELLEIFRLQNKLDWFPANFSKGMKQKVMIVCAFITKAKLFIIDEPFLG
FT                   LDPLATDDLLKLIDDVKKEGSAVLMSTHVLGTAQEYCDRFVMINHGELKASGTLEELRA
FT                   QFNKQDASLSEIYLSLTKGEKANE"
FT   gene            527156..528349
FT                   /locus_tag="LSL_0479"
FT   CDS_pept        527156..528349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0479"
FT                   /product="Protein ecsB"
FT                   /note="COG4473 [U] Predicted ABC-type exoprotein transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99288"
FT                   /db_xref="GOA:Q1WUP7"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP7"
FT                   /protein_id="ABD99288.1"
FT                   /translation="MNNLWKKRLNLYLKRMIKYYRYVFNDHFVIALLFLLGGISYTYSN
FT                   FIKSLNVDLSYPWAKPVVIIVLLVMLQFGKVGTLIDEPDKVFLLPQEKGMREYLMKAQK
FT                   RAWVSNSVIQIVVWIVLLPFIYYGVHLNLLESIILLLSQVALKIAQVNLFFIRAFEAKY
FT                   QAGKYSLILNYVVPLIVYMLGLYASIYFALGITVGLILYLKSLPKNKIIQWNYLIDVEK
FT                   LRLMRKYSFFNLFTDVPQVKKKAKRRKYLDWLIPKFKNVYGYLFIRAIIRNGEYSGLYI
FT                   RLTVIEFIVLLFIPKFWLSLVIGMLFIYLIGFQMLPLYKYFDDNVFVHLYPLETNSKGK
FT                   EFKSILLALLIINALISAIAVYIAIQNILLSGAFLALVLVESILFVYGYANLRLEKS"
FT   gene            528412..529200
FT                   /locus_tag="LSL_0480"
FT   CDS_pept        528412..529200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0480"
FT                   /product="Phosphotransferase enzyme family"
FT                   /note="COG0510 [M] Predicted choline kinase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99289"
FT                   /db_xref="GOA:Q1WUP6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP6"
FT                   /protein_id="ABD99289.1"
FT                   /translation="MNLNLENGWQILPIGGDTDTAYMGIKSDQKVFLKRNTSPFLAALS
FT                   LEEIAPRLIWTKRISTGDTLTAQEWLNGRSLYRSEMGQKSVSDLLYKVHHTPVLKKMLI
FT                   QVGGKVVTPIDLVRKYFEGLPDDLNQHPLLNKVANYLKANQPDLKSDFYEVCHGDLNHK
FT                   NWLLSDKEKLYLVDWESARIADPASDLSMLMCQYVPRKNWEQWLRQYGLEVNRDLWYRI
FT                   YWYSLINLLLDVKYYHQRGRFTEMNQDILKISELINELNF"
FT   gene            529276..529914
FT                   /locus_tag="LSL_0481"
FT   CDS_pept        529276..529914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0481"
FT                   /product="tRNA (m(7)G46) methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG0220 [R] Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99290"
FT                   /db_xref="GOA:Q1WUP5"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUP5"
FT                   /protein_id="ABD99290.1"
FT                   /translation="MRLRNKPWAKPLIEENPDFVVTEPTKLKGKWHTRFQNNNPIFVEI
FT                   GMGKGRFIVEMAKKNPEKNYIGLELQTVAVGIALKKQLEEKLPNLQLICANGSGLGEYF
FT                   EKGEIAGIYLNFSDPWPKKRQTKRRLTYKTFLEQYKEVLDSNGHIEFKTDNQGLFEYSL
FT                   VSMNNFGMKFDGVWLDLHSSPEAEDNVMTEYEEKFSKKGQPIFKLEAHF"
FT   gene            complement(529897..530289)
FT                   /locus_tag="LSL_0482"
FT   CDS_pept        complement(529897..530289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0482"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99291"
FT                   /db_xref="GOA:Q1WUP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP4"
FT                   /protein_id="ABD99291.1"
FT                   /translation="MLIHQIFDITIVSLKGLMTVKKLNLQLLFALLIVLCPLFLFIFYL
FT                   KRKYIKNSETVLSKIRDEFSKQYIVKDSWIHVYPRQNYQFNQPLTYAGGVKCIDPSGKT
FT                   INYTFTADAKTGKIIDSHIINLEMGF"
FT   gene            530363..530680
FT                   /gene="trxA"
FT                   /locus_tag="LSL_0483"
FT   CDS_pept        530363..530680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="LSL_0483"
FT                   /product="Thioredoxin"
FT                   /note="COG0526 [OC] Thiol-disulfide isomerase and
FT                   thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99292"
FT                   /db_xref="GOA:Q1WUP3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP3"
FT                   /protein_id="ABD99292.1"
FT                   /translation="MEQLAKMNKQELEEKLAKGKYVLFFTAGWCPDCRFIKPAMPEIEE
FT                   EFSDFNFIQVDRDENIDLCQELDVYGIPSFIVYEDGKEVDRFVNKDRKTKKEVENFLKA
FT                   I"
FT   gene            530707..531357
FT                   /locus_tag="LSL_0484"
FT   CDS_pept        530707..531357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0484"
FT                   /product="tRNA binding domain protein"
FT                   /note="COG0073 [R] EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99293"
FT                   /db_xref="GOA:Q1WUP2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP2"
FT                   /protein_id="ABD99293.1"
FT                   /translation="MFIASYNPKSIGDVLVVVLRPDTIQQKSEKKGNVVRIFDAESNTT
FT                   LGYNFFGISTVLADLQGHGEEQLNQEQVDKLNKLLEENDFDPELILDANPKFVVGYVES
FT                   MKEHPDSDHLHITKVKVDNDQELQIVCGAPNIDEGQKVVVAKVGAMMPNGAMIFPGKLR
FT                   GVESMGMICSARELELPNAPQKRGILVLPETDAFEVGKEFNFVKGAELFVNKV"
FT   gene            531451..533733
FT                   /pseudo
FT                   /locus_tag="LSL_0484b"
FT   misc_feature    531451..533733
FT                   /pseudo
FT                   /locus_tag="LSL_0484b"
FT                   /note="Similar to cell division protein FtsK; nonfunctional
FT                   due to truncation; Nonfunctional due to truncation"
FT   gene            533809..535140
FT                   /gene="murC"
FT                   /locus_tag="LSL_0485"
FT   CDS_pept        533809..535140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="LSL_0485"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG0773 [M] UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99294"
FT                   /db_xref="GOA:Q1WUP1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUP1"
FT                   /protein_id="ABD99294.1"
FT                   /translation="MNSEQTYFFVGIKGTGMSSLALILHDKGYKVLGSDIDKYTFTQRG
FT                   LENAGIKILPFDEDNIKEDMIVVAGNAFGDDQVEIKKAHEMGLTVQTYPETVEQIIEET
FT                   TSIGVAGAHGKTSTSGLLAHVLSGVSPTSYLVGDGSGKGTPNARFFVFEADEYRRHFVA
FT                   YHPDYAIMTNIDFDHPDYFTDIDDVRDAFETLAMQTKKGIFVWGEDENLRKLNAKVPVH
FT                   YYGTKSDDDFRAENIKRTTKGSNFDVYFHDEFIGNYDIPMFGEHNVLNSLAVIAVSYME
FT                   KVDQQEIAKELLTFKGVKRRFTEKRVADMVIIDDYAHHPAEIKATIDAARQQYPDKKII
FT                   AVFQPHTFSRTIALMDEFAESLSLADKVYLTDIFSSIREHDGKVSSEDLGKKISKGGEV
FT                   LKLDNMSPLLDFHDDVVIFMGAGDIQKYEHAYEDLLSNLSLKNN"
FT   gene            535249..535689
FT                   /gene="maoC"
FT                   /locus_tag="LSL_0486"
FT   CDS_pept        535249..535689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maoC"
FT                   /locus_tag="LSL_0486"
FT                   /product="Dehydrogenase with MaoC-like domain"
FT                   /note="COG2030 [I] Acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99295"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUP0"
FT                   /protein_id="ABD99295.1"
FT                   /translation="MSEDVHRRGKTIDEIKEGDSLTVTESISDRDLLLYLGITNDNNPL
FT                   YIQHDYARDTEYQKPIVPPVLLTGIITSSISKVLPGPGSDVVNLSTNFILPVYHDEMVT
FT                   FSFEVIKVDSMKEVITISVEGENEDGDRVIDAVVIVKPPKIF"
FT   gene            535711..536424
FT                   /locus_tag="LSL_0487"
FT   CDS_pept        535711..536424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0487"
FT                   /product="Integral membrane protein"
FT                   /note="COG0670 [R] Integral membrane protein, interacts
FT                   with FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99296"
FT                   /db_xref="GOA:Q1WUN9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN9"
FT                   /protein_id="ABD99296.1"
FT                   /translation="MILRMNNNEIYGNQAGLNSFMTKMYGFMAGAVAISAVTAYLISNV
FT                   YQVQALTFFSNNRWAVWGILILQVVLVMSMSFKADRSPAMSLTGLGLYSVLEGLFFGLI
FT                   VQVYSSQDVTMAFVSATVMFTVLALMGTNTKKDLSGVGRQAMAALIALIIVMIINIFLR
FT                   SSIITLAFSFIGVVIFAALIAWDSQRFRQMYIQYGNQINTTNLAIMGALQLYLDFVNLF
FT                   IQLLNIFTGLGGNKD"
FT   gene            536545..539223
FT                   /gene="polA"
FT                   /locus_tag="LSL_0488"
FT   CDS_pept        536545..539223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="LSL_0488"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0749 [L] DNA polymerase I - 3'-5' exonuclease and
FT                   polymerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99297"
FT                   /db_xref="GOA:Q1WUN8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN8"
FT                   /protein_id="ABD99297.1"
FT                   /translation="MVEEKNKLLLIDGNSVTFRAFFALHNSLSRFVNHEGLHTNAIYGF
FT                   KNMLDSILTKVNPTHILVAFDAGKTTFRTEKFTDYKGGRAKTPSELSEQFPEIKNLLEG
FT                   YGIKTYELKNYEADDIIGTLAAKAEKKNYDVVVVTGDRDLTQLTTDKITVAVTVKGVSE
FT                   IEEYTPSHVEEKIGLIPEQIVDMKALVGDTSDNYPGVTKIGEKTAIKLLKQYGTLDGIY
FT                   KNIDEMKKSKMKENLIREKEIAYLCQDLAEIRKDAPVEIDLEETEWTGKNIEKLVTLYQ
FT                   KLDFRKFLSQLKAESSEQLDIFESKSNIEFTELTEENLNDIKISDNDEIVFNLEIDGEN
FT                   YHTAEIIGFSIKIGDKYLVSDDIDLLKKKQIKNLLESDEVEVDLFDGKRQYVGLNRLGV
FT                   TLSKINFDLLLVSYLLDNSENSNDLGLLAQQHEYYDVESDEQIYGKGAKHAVPEDKEVL
FT                   FEHLVRKVKAINNLKEKLFNELEENQQLDLYTKIERPLSIILANMEIAGVKVDSNRLET
FT                   MQSELKERLSELEQEIYNEAGEEFNLNSPKQLGVILFEKLKLPVIKKTKTGYSTAVGVL
FT                   EQLRGMSPIVDNILQYRQLAKIQSTYIEGLLKVVSKKDGKAHTRYTQTLTSTGRLSSVD
FT                   PNLQNIPVRLEEGRKIRQAFVPSHPGWEIFSSDYSQIELRVLAHISKDKNMQEAFKEGM
FT                   DIHASTAMRIFNVDSPDEVTPNMRRQAKAVNFGIVYGISDYGLSQNIGISRKQAKQFID
FT                   TYLDTFSGVKDYMEKIVEFAKENGYVETIFNRRRYLPDIKSRNFNLRSFAERTAMNSPI
FT                   QGSAADIIKVAMINMQEMLKEKNLQAKMLLQVHDELIFEAPTEEIPLLEDMVPKVMDSA
FT                   VKLDVPLKVESKHGQTWFDTK"
FT   gene            539236..540066
FT                   /gene="nei"
FT                   /locus_tag="LSL_0489"
FT   CDS_pept        539236..540066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nei"
FT                   /locus_tag="LSL_0489"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="COG0266 [L] Formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99298"
FT                   /db_xref="GOA:Q1WUN7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUN7"
FT                   /protein_id="ABD99298.1"
FT                   /translation="MPELPEVETVRRGLEKLVLNKKIKDIRVLYSKTIVNEESEFIEKL
FT                   TNKTIKKIDRRGKYLLFRFSSDLTMISHLRMEGKYFVEPSTKEVEKHTHVVFDFTDGTS
FT                   LRYNDVRKFGRMQLVKTGMEIQTAGLAKLGPEPKEKTFIVEDFSKNLKRRKKAIKNALL
FT                   DQTIVAGLGNIYADEVLWMSKIHPETPANKLTEEEVKVLRDNIIKELALATEAGGTTIR
FT                   SYTDAFRHSGGFQFSLHAYQRTGDPCERCGTPIQRIVVGQRGTHFCPKCQVVKS"
FT   gene            540063..540668
FT                   /gene="coaE"
FT                   /locus_tag="LSL_0490"
FT   CDS_pept        540063..540668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="LSL_0490"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG0237 [H] Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99299"
FT                   /db_xref="GOA:Q1WUN6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN6"
FT                   /protein_id="ABD99299.1"
FT                   /translation="MKILGLTGGIASGKTTVSTYLKEMGYPIIDADKVSRKVVEPHTEG
FT                   LKEISHFFGNDILQSDGSLNRKKLGEIVFENKDKRELLNKILSKKIRTEIINQIEYYKK
FT                   QGADVLILDIPLLFEGGYDKMCDFTMVIYISKELQIERLIQRDGLTRDKALKRISAQLD
FT                   SAERNSKADIVIDNSRSIEDTHNQVIEWLERNNLMLEK"
FT   gene            540683..541156
FT                   /locus_tag="LSL_0491"
FT   CDS_pept        540683..541156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0491"
FT                   /product="Putative regulatory protein"
FT                   /note="COG1327 [K] Predicted transcriptional regulator,
FT                   consists of a Zn-ribbon and ATP-cone domains"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99300"
FT                   /db_xref="GOA:Q1WUN5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUN5"
FT                   /protein_id="ABD99300.1"
FT                   /translation="MKCPNCHKNGSRVVDSRPADNGHAIRRRRECEQCGYRFTTFERVE
FT                   VTPLLVIKKNGTREEFQREKLLRGIVRAAEKRPVGIDEITEIVDKVENKLRSVGGTEVS
FT                   SQLIGEYVMKILADVDEVAYIRYASVYREFKDMHAFADELRELMDREENNSKD"
FT   gene            541166..542512
FT                   /gene="dnaB"
FT                   /locus_tag="LSL_0492"
FT   CDS_pept        541166..542512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="LSL_0492"
FT                   /product="Chromosome replication initiation / membrane
FT                   attachment protein"
FT                   /note="COG3611 [L] Replication initiation/membrane
FT                   attachment protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99301"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN4"
FT                   /protein_id="ABD99301.1"
FT                   /translation="MDSALNKLSPKDGYLVSASTYIDNHDIEIVQVLYQPIIGIVAVAL
FT                   YSYLRFEIDSKLILSERKLNKNIIDGLGISIPELYDARLKLEATGLIKTFEGEDKLGKY
FT                   HIYELQKPLNEVKFFTDDLLSTALLEMVGNEKFKKLSLWNKFDNNYHDKKEVTKQFFDV
FT                   FNLNKDNIVLQAQLNNSKISNDESLINRQKVSLDMTVFSDFIKNSYVSSDDVMNHLDII
FT                   KSVKLVYGIDEFQLVKLLEKAINVTNNKIDYNEFKKLAQKNFDSGIRRNFKKNKIVETA
FT                   KAKDDEKDKNIDPLVNAFKAYVPLEFLEILKNELGSFVTANERYAVKTLVEKQMLPNEV
FT                   INVLIHYLLVVQDSSTILKGTFERIAADWTKKKIKNAQEAMTYVKSFTREKSLQRKATK
FT                   KDSKGRKSNVIVKEKLPEWAKEKGKNKLTDVGKKENKEIDELLKKINGK"
FT   gene            542522..543451
FT                   /gene="dnaI"
FT                   /locus_tag="LSL_0493"
FT   CDS_pept        542522..543451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="LSL_0493"
FT                   /product="Primosomal protein"
FT                   /note="COG1484 [L] DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99302"
FT                   /db_xref="GOA:Q1WUN3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN3"
FT                   /protein_id="ABD99302.1"
FT                   /translation="MEDMGKELSKRLVENKWEKKYKEIIEKSLKDDDVQLFLRENKDRL
FT                   SHQEILKGASKLYEFVDLKQKIAEGKEVFAPGYSPQLTISDHHIEVTYVPTKKLIEERR
FT                   LREINNRINIVNLPKSIRKATLENYYRDDDGRMIALKKAIEFVANYTETPNIFHKGLYL
FT                   SGSFGVGKTYLLGAIANKLAEKGIKVTLVHMPSFAVEIKNSIGKNTTMEKVDALKKAPV
FT                   LMMDDIGADQLSSWFRDDVLGVILQYRMQEELPTFFSSNIALDDLEEFYLTQNTRGELE
FT                   PLKAKRIMERIRFLVDEVVINGENRRNK"
FT   gene            543759..545708
FT                   /gene="thrS"
FT                   /locus_tag="LSL_0494"
FT   CDS_pept        543759..545708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="LSL_0494"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="COG0441 [J] Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99303"
FT                   /db_xref="GOA:Q1WUN2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUN2"
FT                   /protein_id="ABD99303.1"
FT                   /translation="MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGN
FT                   FVDLNQPLKEDGSIEIITKDSNDGLVVLWRTAAQVLANALHELYPNMKFGMGDVTEHGF
FT                   YFDTDNSESQVAETDFEKISQKMSEIIKANLPIERVEFSEEEALNLVSGDEYQEELVRD
FT                   VANKNNGRVVAYKQGDFIDITDGVVLSSTGEVKIFKLLSVAGAYWKGASSNPMLQRIYG
FT                   TAFYKQKDLDAELQRQKEARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVIE
FT                   RYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCP
FT                   SHIQVYNHHKRSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIE
FT                   DEIKTLIKLMTEVYNDFDITDYRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMG
FT                   LEYFEAEGEAAFYGPKIDVQTKTALGGEETLSTIQLDFLLPERFDLKYIGADGEEHRPV
FT                   MVHRGIVSTMERFTAYLTEMYKGAFPTWLAPHQVDIIPVKNDLHMDYVNDLSSKLRAHG
FT                   IRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTNTMTKAEFK
FT                   NLLFEDIENYSREK"
FT   gene            545916..546440
FT                   /gene="infC"
FT                   /locus_tag="LSL_0495"
FT   CDS_pept        545916..546440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="LSL_0495"
FT                   /product="Bacterial Protein Translation Initiation Factor 3
FT                   (IF-3)"
FT                   /note="COG0290 [J] Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99304"
FT                   /db_xref="GOA:Q1WUN1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUN1"
FT                   /protein_id="ABD99304.1"
FT                   /translation="MNIIAVDKMVNEGIRARELRLISDNGDQLGVKTKQEALKMAEDAN
FT                   LDLVLVAPKAKPPVAKIMDYGKYRFELQKKQREARKKQKVVNIKEVRLSPTIDTNDFNT
FT                   KMKNARKFLSKGDKVKVSIRFKGRAITHKDIGRDVLNRFAEATEDVATVESKAKMDGRS
FT                   MFLMLAPKTEK"
FT   gene            546477..546677
FT                   /gene="rpmI"
FT                   /locus_tag="LSL_0496"
FT   CDS_pept        546477..546677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="LSL_0496"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="COG0291 [J] Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99305"
FT                   /db_xref="GOA:Q1WUN0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUN0"
FT                   /protein_id="ABD99305.1"
FT                   /translation="MPKQKTHRASAKRFKRTGNGGLKRSNAYTSHRFHGKTKKQRRQLR
FT                   KASMVSASDMKRIKQMLSQMK"
FT   gene            546770..547132
FT                   /gene="rplT"
FT                   /locus_tag="LSL_0497"
FT   CDS_pept        546770..547132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="LSL_0497"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="COG0292 [J] Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99306"
FT                   /db_xref="GOA:Q1WUM9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUM9"
FT                   /protein_id="ABD99306.1"
FT                   /translation="MPRVKGGSVTRQRRKKIIKLAKGYRGAKHIQFKVAKQQVMKSYQY
FT                   AFRDRRKTKSNFRKLWIARINAAARQNDISYSKLMHGLKLANVEVNRKMLADLAITDAA
FT                   AFTALVDEAKKALAAE"
FT   gene            complement(547229..548518)
FT                   /locus_tag="LSL_0498"
FT   CDS_pept        complement(547229..548518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0498"
FT                   /product="Transposase ISLasa4i, ISL3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99307"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM8"
FT                   /protein_id="ABD99307.1"
FT                   /translation="MDNNIKLLLGITDPNLTIDPKYQYTSYIEEKIIKNSKTLLCHLYL
FT                   SYPMYCPNCKALMLHNGTKVANNVHLSSAGKKLVLSIRKQKYLCPECKKTATAKFKDTN
FT                   YHDHFSNAVKAKLVRDLSLSRPMCEIAADSFTSSNTIIRSLESVENNFKVNRNWLPSHL
FT                   SLDDFKSGKRFSSSGMSMCLINAVNHRIIDIIPERNNKFLRNYFIQYSYKARLSVLTIT
FT                   VDLYAPYRSLIKKLFPNAFIIADKFHVVAQAYTAMNKIRTRVMKEYGAGTHEYRALKRF
FT                   WKLLLKNQDNVDYHRYYPRINFKYAELSDSEVLDRLSDMSSELKTAYEYYQLLLQMYRK
FT                   NSCQSLNLLIDTSSWNLPPEMRQALKTIKKHKAEIENSFVLPRLTNGPIEGINNHIKVI
FT                   KRIAYGYNNFKHFRLRILLSLKNNVIFFST"
FT   gene            548790..549329
FT                   /locus_tag="LSL_0499"
FT   CDS_pept        548790..549329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0499"
FT                   /product="Hydrolase, haloacid dehalogenase-like family"
FT                   /note="COG2179 [R] Predicted hydrolase of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99308"
FT                   /db_xref="GOA:Q1WUM7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM7"
FT                   /protein_id="ABD99308.1"
FT                   /translation="MFKRFIPTWKIESIYDLTPQEVKNHGIKAILTDLDNTLIAWNNPD
FT                   GTPELRNWLKVMREESIPVIVVSNNNHRRIKRAVERFELPFVSRALKPFVRGINIAKKR
FT                   YNLKSDEVILVGDQLMTDIAAANNAGIRSILVKPLVKSDAWNTKPNRMLEKIIKNNLIK
FT                   NNKIEKSWRHSLDDRN"
FT   gene            549316..550437
FT                   /locus_tag="LSL_0500"
FT   CDS_pept        549316..550437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0500"
FT                   /product="GTP-binding protein"
FT                   /note="COG1160 [R] Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99309"
FT                   /db_xref="GOA:Q1WUM6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM6"
FT                   /protein_id="ABD99309.1"
FT                   /translation="MTETSNEILYCIGCGAKIQSENPNELGYTPESAVKKGLETEELYC
FT                   QRCFRLRHYNEIADVSLTDDDFLRLLNQIGESDSLIVNVVDIFDFNGSVIPGLHRFVGK
FT                   NDVLLVGNKSDLLPKSLKRSRIKDWLRQEANKQGLRPIDVALTSASKGYEIDNLLELID
FT                   KYRKGRDVYVVGVTNVGKSTLINRIIKQQTGISELITTSRFPGTTLDKIEIPFDDGKNL
FT                   IDTPGIIHKQQMAHYLTGKSLKFASPQKEIKPKVYQLNEGQTIFLGSLARFDYISGGRT
FT                   SVIAYFDNNLPLHRTKLQNADKFYEKHAGELLQPPTREELKKMPKLTRFEFKVSEKSDL
FT                   VFSGLGWISLSPNTIVAGWAPEGVGVLIRKAMI"
FT   gene            550450..550770
FT                   /locus_tag="LSL_0501"
FT   CDS_pept        550450..550770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0501"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1534 [J] Predicted RNA-binding protein containing
FT                   KH domain, possibly ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99310"
FT                   /db_xref="GOA:Q1WUM5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM5"
FT                   /protein_id="ABD99310.1"
FT                   /translation="MCNMKLRGKQKRYLRSEAHHLKPIFQIGKDGLSEVWLDEVLKALD
FT                   KRELLKVNILQNSLVEIEDVKEFIENNSDAQVIQTIGNVLVLFKKSDKAENQKISVKVA
FT                   EL"
FT   gene            550789..551421
FT                   /gene="nadD"
FT                   /locus_tag="LSL_0502"
FT   CDS_pept        550789..551421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="LSL_0502"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COG1057 [H] Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99311"
FT                   /db_xref="GOA:Q1WUM4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM4"
FT                   /protein_id="ABD99311.1"
FT                   /translation="MVKTITIPEIKVMAELITNMKHKRVGILGGTFNPPHLGHLIIAEQ
FT                   VKSQLNLDEVMFIPDYQPPHIDKKTAISAEKRLKMVKLSTMDEPGFKVSDIELRRKGVS
FT                   YTIDTIKELKLKNPEVDYYFIIGGDMVEYLPKWHRIEELIKLVKFVGVGRPGYRKESKY
FT                   PIMWVDVPMTDISSTLVRRNVKQGCSIKYLVTPEVENYIHEEGLYRE"
FT   gene            551414..552013
FT                   /locus_tag="LSL_0503"
FT   CDS_pept        551414..552013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0503"
FT                   /product="Conserved hypothetical protein, HD domain"
FT                   /note="COG1713 [H] Predicted HD superfamily hydrolase
FT                   involved in NAD metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99312"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM3"
FT                   /protein_id="ABD99312.1"
FT                   /translation="MNNLDLEYTEGIFPGTREELVKKVKESVKESRFKHILGVEKSAIE
FT                   LAKQNDYSTEKASIAALVHDYAKERTPEEFKKTILDENLSKDLLNWNNFIWHGVVGAEI
FT                   IKNELQIKNEEILNAVRRHTVGDVEMTTLDKIIYVADYIEEGRSFPGVKLARTIAKTNL
FT                   DDAVSYETKHVLEFLLSQDKVIYPKAILTYNKWVAE"
FT   gene            552036..552389
FT                   /locus_tag="LSL_0504"
FT   CDS_pept        552036..552389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0504"
FT                   /product="Iojap-related protein"
FT                   /note="COG0799 [S] Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99313"
FT                   /db_xref="GOA:Q1WUM2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM2"
FT                   /protein_id="ABD99313.1"
FT                   /translation="MDSKKLLEIVVKAADSKRAEDTVALDVQEISILADYFVITQANSE
FT                   RQVKAIADAVKEQVYEAGADVKDIEGKDGANWILLDLGDVVVHVFKTETRQFYNLEKLW
FT                   SDAPLVNIADWIK"
FT   gene            552391..553130
FT                   /pseudo
FT                   /locus_tag="LSL_0504b"
FT   misc_feature    552391..553130
FT                   /pseudo
FT                   /locus_tag="LSL_0504b"
FT                   /note="Similar to methyltransferase; nonfunctional due to
FT                   frameshift"
FT   gene            553146..554288
FT                   /locus_tag="LSL_0505"
FT   CDS_pept        553146..554288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0505"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1019 [R] Predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99314"
FT                   /db_xref="GOA:Q1WUM1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUM1"
FT                   /protein_id="ABD99314.1"
FT                   /translation="MKIIGIIAEYNPFHNGHLYQIEKVKEIYPESIIIVAMSGNFLQRG
FT                   EPAIVDKWVRAKQALLNGVDVVVEIPIAGCVQPADRFAENGVRILNNMGCEELFFGAEH
FT                   AEYDFMTYAQLVQNLDSTEFSKKNISYAEAFQEAVAAKIGHNIDSPNDVLGLAYAKANL
FT                   KFGKKLKLNPISRNVAGYHDKSLSPDSNIASATAIRKVLFSKDHNLVDKYLPSYQDLKD
FT                   EKYISWDDFWPFLRYKLISSDIDELANIYGMAEGIQYRMKKKALELKVEATFDEWLKAV
FT                   KSKRFTYTRLTRLSVATLVGMKVNDVSLYNKFPYVHLLGFTKNGQKALNIMKKNSEIPL
FT                   LAKISQQDKDDFYHVDYRAGKIYQSQNYKEQDLKRAPLIF"
FT   gene            554365..554910
FT                   /locus_tag="LSL_0506"
FT   CDS_pept        554365..554910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0506"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1399 [R] Predicted metal-binding, possibly
FT                   nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99315"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUM0"
FT                   /protein_id="ABD99315.1"
FT                   /translation="MKWSLKELNQASEAPIHFTENLDLNEALKSRRSDIIKVSTVHVDG
FT                   MFSVDELGVLGYMKVNCTVTLPSSRSFQPVDLELNFDVTEHYLSHYNPDLSSFEDTDVV
FT                   IVLKDDILNLADVIEDNILLQIPMQVLSVDEKRDDAVMPSGDDWSVIREEQLQKNNHKK
FT                   DNIDPRLAKLKNFFDEDK"
FT   gene            554993..555169
FT                   /gene="rpmF"
FT                   /locus_tag="LSL_0507"
FT   CDS_pept        554993..555169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="LSL_0507"
FT                   /product="LSU ribosomal protein L32"
FT                   /note="COG0333 [J] Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99316"
FT                   /db_xref="GOA:Q1WUL9"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUL9"
FT                   /protein_id="ABD99316.1"
FT                   /translation="MAVPARRTSKTRKRLRRTHYKLQVPGMSACPNCGELRKAHHVCPS
FT                   CGYYGDKEVVKTK"
FT   gene            complement(555328..555951)
FT                   /gene="plsC"
FT                   /locus_tag="LSL_0508"
FT   CDS_pept        complement(555328..555951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="LSL_0508"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="COG0204 [I] 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99317"
FT                   /db_xref="GOA:Q1WUL8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL8"
FT                   /protein_id="ABD99317.1"
FT                   /translation="MFYSFIRVIVRIIVYIVNGKPTYLNKEKLPTGNYILVGPHRTWFD
FT                   PLYFALAASPKKFSFMAKEELFKNPILRFILVHANAFPVNRENPGPSVIKTPVKWLKKK
FT                   DLSLIMFPSGTRHSQKLKGGAILIAKLSGVPIVPAVYQGPLTFKGLLTRKKTTVAFGDP
FT                   IYLDRKMKINDENQKIIIEKMEQQFNSLDKSINPDFKYIDVSKK"
FT   gene            556041..556799
FT                   /locus_tag="LSL_0509"
FT   CDS_pept        556041..556799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0509"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG4122 [R] Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99318"
FT                   /db_xref="GOA:Q1WUL7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL7"
FT                   /protein_id="ABD99318.1"
FT                   /translation="MHEDILLSNERIDQLYSSKIKIIQSSEVFSFSIDAVLLADFADSL
FT                   KKKNSKIVDLCAGNGAVGLFLSQKVNGKIIQVEIQKRLADMARRSILLNNLEDKITILN
FT                   EDLNNLQGLISKDSVDMVVCNPPYFANLETSKKNPNQYYAIARHEIKVTLEQVIEVTSG
FT                   LLKFGGKANFVYRPDRLLEMLDLMRKHNIAPKKIQLVYPKKDKEANIVLVQGIKAGKDG
FT                   GIRYLPPIIVSEDNGKYTNVIEELLYGKGK"
FT   gene            556783..557070
FT                   /locus_tag="LSL_0510"
FT   CDS_pept        556783..557070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0510"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG2827 [L] Predicted endonuclease containing a URI
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99319"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL6"
FT                   /protein_id="ABD99319.1"
FT                   /translation="MVKENSYYFYVLLCADNTLYGGFTTDLIRRLNQHNDGVGAKYTRL
FT                   KKRRPVEMIYHEKFSSKSMALKKEYAFKHQSREKKNKYLVEHGVDRNLIE"
FT   gene            557234..558031
FT                   /gene="rpsB"
FT                   /locus_tag="LSL_0511"
FT   CDS_pept        557234..558031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="LSL_0511"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="COG0052 [J] Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99320"
FT                   /db_xref="GOA:Q1WUL5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUL5"
FT                   /protein_id="ABD99320.1"
FT                   /translation="MAVITMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQK
FT                   TVKLIDDAYDFIKDAASDDGVVLFVGTKKQAQEAIEEEAKRAGQYYVNHRWLGGTLTNW
FT                   NTIQKRIKKLKEIKAMAEDGTFDRLPKKEVALLIKQRDRLEKFLGGIEDMPRIPDVLFI
FT                   VDPRKERIAVKEAQKLNIPIVAMVDTNADPDEIDVKIPSNDDAIRAVRLITSKMADAII
FT                   EGRQGEDDAPVTEDTFENTDDQVDSIEDIVEVVEGDNDSTDAE"
FT   gene            558125..559000
FT                   /gene="tsf"
FT                   /locus_tag="LSL_0512"
FT   CDS_pept        558125..559000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="LSL_0512"
FT                   /product="Protein Translation Elongation Factor Ts"
FT                   /note="COG0264 [J] Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99321"
FT                   /db_xref="GOA:Q1WUL4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUL4"
FT                   /protein_id="ABD99321.1"
FT                   /translation="MAKISAAQVKELRDKTGVGMMDAKKALVAVEGDMEKAIDFLREKG
FT                   MAKAAKKSDRVAAEGLANVAVNGNKAVIVEVNAETDFVAQNDQFKALVKHIADVIAENT
FT                   PADVEAALQLKTDKGTLNDELIEATQVIGEKISLRRFEVVEKADADNFGAYLHDGGRIA
FT                   VLSVVEGADEATAKDVAMHVAAINPKYVNRDEVPEAEVAHEKEVLTEEAKNEGKPEKII
FT                   EKMVAGRLNKFFAEVALDDQDFVKDPDLTVAKYVASKNGKVKSFVRYEVGEGIEKKEEN
FT                   FAEEVMSQIK"
FT   gene            559288..559608
FT                   /locus_tag="LSL_0513"
FT   CDS_pept        559288..559608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0513"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL3"
FT                   /protein_id="ABD99322.1"
FT                   /translation="MLRKTKNFLKANGVYYEKEHVNPLMVPERVYVLKFGIDEKTMNNR
FT                   FIVEYTYTWTGRIKINKISLRLHGQQHPREFRNEAQLLQYLKKHSKRYVKGKEISNKKR
FT                   SK"
FT   gene            complement(559675..560397)
FT                   /locus_tag="LSL_0514"
FT   CDS_pept        complement(559675..560397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0514"
FT                   /product="Deoxyguanosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /note="COG1428 [F] Deoxynucleoside kinases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99323"
FT                   /db_xref="GOA:Q1WUL2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL2"
FT                   /protein_id="ABD99323.1"
FT                   /translation="MITLAGIIGSGKSSLTKLLSQELNTTPFFEPVTDNPVLPLFYKGN
FT                   ELAAKKRAAGATDVTNPYTYLLQTFFLNRRFKMIKEAMRGDNNILDRSIYEDAMFMRMN
FT                   TELGNATQIEYQIYQELLKNMLDEIKLATPKNHKDLMILIKVSYPTMIKRIEKRGREYE
FT                   QVTNDPSLVDYYKRLLEFYDEWERTYDKSPLLVIDGDKYDFVENKSDRQFVLNTIADTL
FT                   LDMGKISRDEHLKLYTEN"
FT   gene            560602..561090
FT                   /gene="purE"
FT                   /locus_tag="LSL_0515"
FT   CDS_pept        560602..561090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="LSL_0515"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   carboxyltransferase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0041 [F] Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99324"
FT                   /db_xref="GOA:Q1WUL1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL1"
FT                   /protein_id="ABD99324.1"
FT                   /translation="MKREVAIVMGSISDWDTMKEAAEILENFGVNYDKKVISAHRMPKE
FT                   MFAFSETAKDKGLKVIIAGAGGAAHLPGMVAANTILPVIGVPVKSRALNGMDSLLSIVQ
FT                   MPAGIPVATTAIGASGAKNAALLALQILGINDEEIAEKLVLFRKKQHDDAEKSGEQLG"
FT   gene            561083..562204
FT                   /gene="purK"
FT                   /locus_tag="LSL_0516"
FT   CDS_pept        561083..562204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="LSL_0516"
FT                   /product="Phosphoribosylaminoimidazole carboxylase NCAIR
FT                   mutase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0026 [F] Phosphoribosylaminoimidazole carboxylase
FT                   (NCAIR synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99325"
FT                   /db_xref="GOA:Q1WUL0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUL0"
FT                   /protein_id="ABD99325.1"
FT                   /translation="MDSMIMQGKTIGIIGGGQLGQMLSFSAKKAGMRVIILDPNPTCSA
FT                   GQVSDEQIVAPYDDIEAIEELADKADVLTYEFENVDLNALENVSSKVEIPQGTELLRIT
FT                   KDRIREKTFLQKSGLKVAPFAEINKFSDLEKKINEIGYPAILKTCEGGYDGKGQLVLNS
FT                   EKDLVEADEIIKLGQCILEGKINFQMECSVMVGRNLRGEITVFPVSENIHRNQILHESI
FT                   VPARISSELQEKAKETAVKVAESLNLCGILGIEMFIGEDNEIYINELAPRPHNSGHYSI
FT                   EACNFSQFDIHNRAICNWPLPKIELLKPVVMVNVLGQHVEKTQELISKKPTWQFHDYGK
FT                   GEIRVDRKMGHVTILTDDINKTLDEIVSTHVWD"
FT   gene            562216..563511
FT                   /gene="purB"
FT                   /locus_tag="LSL_0517"
FT   CDS_pept        562216..563511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="LSL_0517"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COG0015 [F] Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99326"
FT                   /db_xref="GOA:Q1WUK9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK9"
FT                   /protein_id="ABD99326.1"
FT                   /translation="MISRYTRPEMAAIWNDEKKYECWLAVELAADEAWAKLGHIPDEDV
FT                   EKLKKNAKINVDRIAEIEEVTHHDVIAFTRALSETLGDEKKWVHYGLTSTDVVDTAYGY
FT                   QLKQVNDILRKDLQEFKEIVARKAKKYKNTVMMGRTHGVHAEPTTIGLKLARWYSEINR
FT                   DIERFEHAAKGVEAGKISGAVGTFANIDPFVEKYVCDKLGIRAQEISSQVLPRDLHAEY
FT                   LSALALIATSLEEFATEIRGLQKSETREVEEYFAKGQKGSSAMPHKRNPIGSENICGLA
FT                   RVCRGHMVTAFENVSLWHERDISHSSAERIILPDTTILIDYMLHRFGKIVENLTVFPEN
FT                   MKRNMDRTFGLIYSGRILLKLIDTGMSREEAYDLIQPKTAESWDKQVPFRPLLEQDEEI
FT                   SKRLSKEDLDDAFDYHWHLRHVDDIFKRVGLE"
FT   gene            563625..564602
FT                   /locus_tag="LSL_0518"
FT   CDS_pept        563625..564602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0518"
FT                   /product="Choloylglycine hydrolase"
FT                   /EC_number="3.5.1.24"
FT                   /note="COG3049 [M] Penicillin V acylase and related
FT                   amidases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99327"
FT                   /db_xref="GOA:Q1WUK8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK8"
FT                   /protein_id="ABD99327.1"
FT                   /translation="MCTSVSVISEDGTHVMGRTMDWYDLYVKPMYVPRGYQWKSAFDNK
FT                   KYTNKYAIVGGGFQDNNYIDLSDGVNECGLMAQKLTFSNGAQLVDDKHDDKIQLEAYEF
FT                   VTYILGNFSSVTEVEENIEKIELMSNVINNTKHGGSELHFSLSDESGRNIVVEPSQHPM
FT                   RIIDNPLGVVTNMPKFERQLAKLENYMEFTDEFKENSIKYGKFHVTTGKLGGKKTPPGS
FT                   YSPSQRFIRASYLKELVDMPKTRDEAASLAFGILDTVSIPKSKAHRPTYTVYRAVTVSE
FT                   DRTYYYQANGQATVSGIKLDEELVQNTEPIVFNLSNIWNPQMLS"
FT   gene            564956..565783
FT                   /locus_tag="LSL_0519"
FT   CDS_pept        564956..565783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0519"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99328"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK7"
FT                   /protein_id="ABD99328.1"
FT                   /translation="MNIVKAEIYSNIYCYNDKNEKHKVKKCKIWLINDRETRSEIEGFI
FT                   CDKCDRYYVSSKKFKYLKNKFHKYNFKESIEESYIIKDNLKLSSISFIEKITTVLKAAN
FT                   KHKEHILTDIYGVIPVLNHDNEIINIETPALYCNSCDRLFILESDFKKLESEGIILCQI
FT                   ITEDYWQKQIDNKMYHLNSESILHKVGYNVSDKENLSQEERRNILKNIIESGLLTRSQV
FT                   SSHLDYLIRRSKGQKRLRRAIEKWTSDRKFISELKLNLNSVEITKLKVRRKNV"
FT   gene            565776..566123
FT                   /locus_tag="LSL_0520"
FT   CDS_pept        565776..566123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0520"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99329"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK6"
FT                   /protein_id="ABD99329.1"
FT                   /translation="MYKYSEEFIERDIFLEKKLGISNLQIYAYRHKNVLKVTGKIESDG
FT                   LKKDISFALVGYDKNNDIILTEKNSGYGNFIVTSRIKPNSFFNEYPFGFSYGSKVVNKV
FT                   KKIKVYPVEED"
FT   gene            566127..566771
FT                   /locus_tag="LSL_0521"
FT   CDS_pept        566127..566771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK5"
FT                   /protein_id="ABD99330.1"
FT                   /translation="MNNRDIAKKISEVYPLNWSELQSVLNKLFINRLEKNLINICFLSG
FT                   LLQGDTDDEEILLEEFGLTMDAANWCSNFLYEFSKVMNSQERVNTVKENISLVGLEDGN
FT                   ILPKSIVIRVEDAEEELKIKDINCTVSFKESYDKEIGRINISGEIKHGYGKNRLLFLIA
FT                   YNDKNEVIDWKAETKLSDKEGTEIFNSEMSFPIDEKLLGIYIRPALNPLGS"
FT   gene            complement(567245..567318)
FT                   /locus_tag="LSL_RNA065"
FT   tRNA            complement(567245..567318)
FT                   /locus_tag="LSL_RNA065"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Arg anticodon TCT, Cove score 77.66"
FT   gene            567551..568237
FT                   /locus_tag="LSL_0522"
FT   CDS_pept        567551..568237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0522"
FT                   /product="Two-component response regulator"
FT                   /note="COG0745 [TK] Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99331"
FT                   /db_xref="GOA:Q1WUK4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK4"
FT                   /protein_id="ABD99331.1"
FT                   /translation="MSRILIIEDEKNLSRFVELELQHEEYETEVCKNGRQGLELALDED
FT                   WDAILLDLMLPELNGLDICRRVRQVKNTPIIMMTARDSVIDRVSGLDHGADDYIVKPFA
FT                   IEELLARLRAVLRRVELENEQNGNKQTTLTYRDLTIEKENRVVRRGDEIIELTKREYEL
FT                   LLTLMENINVVLARDTLLKKVWGYETQIETNVVDVYIRYLRNKIDRPGEDSYIQTVRGT
FT                   GYVMRS"
FT   gene            568257..569747
FT                   /gene="csrS"
FT                   /locus_tag="LSL_0523"
FT   CDS_pept        568257..569747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrS"
FT                   /locus_tag="LSL_0523"
FT                   /product="Transmembrane histidine kinase"
FT                   /note="COG0642 [T] Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99332"
FT                   /db_xref="GOA:Q1WUK3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK3"
FT                   /protein_id="ABD99332.1"
FT                   /translation="METTNEKKKKKFFSINLKWSLGTGLGVVIIFAVFATLLFQSFSSL
FT                   LIRQEKGHSEEAMNAVTLRLAQSSNTLTDTGVRDILSSSWNDDIQNRKQAAIYSDSVLT
FT                   ATSGKNIGISVYSVNKELLFASRGVLVDFSSKNKQKITKINGQTVYIVRRPVYSNKSNK
FT                   LIGYVQVTNKLADYDATRHKLILIFIVFGVTAGLASALVGYVLSAWLLRPIELINETIG
FT                   KINTDDERDSLANVRVPILNQNDELSELSNLFNDMLDRMERYIQQQQQFVEDVSHELRT
FT                   PVAIIQGHLDLLSRWGKDDPQILEESISASLQEITRMKSLVQEMLDLSRAEQVELQFGN
FT                   EVSDAREVGLQVFNNFKMIHPDFTFVLDNDLKNNTPVKIYRNHLEQVLIILMDNAVKYS
FT                   QDRKEVHMSISKNSKLVEFVVQDFGVGISQENIDKIFDRFYRVDKARSRDKGGNGLGLS
FT                   IARKLVEGYHGSMSVESVEGQGSLFRISLPLVDLDNKK"
FT   gene            complement(569948..570871)
FT                   /gene="yidC"
FT                   /locus_tag="LSL_0524"
FT   CDS_pept        complement(569948..570871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="LSL_0524"
FT                   /product="60 kDa inner membrane protein"
FT                   /note="COG0706 [U] Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99333"
FT                   /db_xref="GOA:Q1WUK2"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK2"
FT                   /protein_id="ABD99333.1"
FT                   /translation="MNKNKKYILLPSFLTIALLLSGCVQRTKDGKPYGFIYEKLAMPTQ
FT                   HLLEWLSGVLGGSYGWSIIVITFIVRLIMMPIMINQSKKATIQQEKIAMIRPQLAKIQE
FT                   QQKNAKTPEERNAASQAMMKLYQENNISMVGGIGCLPLLIQMPIFAALYAAIQYSPELS
FT                   KTTFMGINLGHRSFTFVVLTFVIYALQGWLSTLGLPEEQKKQMQSMIIVSPVMLTGMTY
FT                   ISPAGLGLYFFIGGIFACIQTLIINFMRPRIRKDIKKELKNKPIKEVTVESPAKKTDDE
FT                   KKVTSVSNDMHEKNRKRNAGKQNRKK"
FT   gene            complement(570979..571251)
FT                   /gene="acyP"
FT                   /locus_tag="LSL_0525"
FT   CDS_pept        complement(570979..571251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acyP"
FT                   /locus_tag="LSL_0525"
FT                   /product="Acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /note="COG1254 [C] Acylphosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99334"
FT                   /db_xref="GOA:Q1WUK1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUK1"
FT                   /protein_id="ABD99334.1"
FT                   /translation="MKNYKIIVFGTVQGVGFRYTTKAIADNMGIKGIVRNQSDGTVYIE
FT                   AQGNSLLLSQFISSIKAPKNPFAKVTKIDVSEIPVKTYNDFSVTY"
FT   gene            571364..572527
FT                   /locus_tag="LSL_0526"
FT   CDS_pept        571364..572527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0526"
FT                   /product="Hydroxymethylglutaryl-CoA synthase"
FT                   /EC_number="2.3.3.10"
FT                   /note="COG3425 [I] 3-hydroxy-3-methylglutaryl CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99335"
FT                   /db_xref="GOA:Q1WUK0"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUK0"
FT                   /protein_id="ABD99335.1"
FT                   /translation="MDIGIDKINFFTSNLYVDMTELAIARNEDPDKYLIGIGQSKMAVI
FT                   PPTQDIVTMGANAAESMLTDEDKEDIDLVIVGTESGIDNSKSAAAYIADLLGLRDDIRT
FT                   FEIKQACYGATAALQMAKAQVTLNPDSKALIIGADIAKYGLNTPGEVTQGGGAVAMLVS
FT                   ANPKLLSFEGGSTYLSRNIMDFWRPLGHSEALVDGKYSSNVYLDFFNNVYSNYKDKTGF
FT                   TIDNFEALLFHLPYTKMGLKALREAQKDADAKVSAKLAHRFEDSRLYNRQVGNLYTGSL
FT                   YLSLLSLLENNDDLKSGDRLGLFSYGSGAQGEFFAMLLRKDYRKYLMNTTNEFLQKRTC
FT                   ISVEEYEKIYLKSLHYENNSELDLDMDDAQFVLTGIKENQRQYKNRI"
FT   gene            572638..573519
FT                   /locus_tag="LSL_0527"
FT   CDS_pept        572638..573519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0527"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99336"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ9"
FT                   /protein_id="ABD99336.1"
FT                   /translation="MADSNQFNLSDHDYATKELSNSLISKIEYLKVLNDAIDEQDDRLV
FT                   YQLIDGQRYSKEILKAKHSVADIENESLILDVHDKISAFLSKKLITYLREMYPFFYFEE
FT                   IGVGRFQFYFGNWWGRRLFGELDVLNVEFKFNAEEYEKLSRAFELEVENKRYNTDEINK
FT                   ISEETDSLQELIDGQDSRDQRKDEIRKELKRQSQEKVSFWEQSKQKEQRQKLMSELSKL
FT                   TDLDEAANNAYQKIRENEEKVLNLSKEDTLLGYEKQSIITKFGTFENFIDHNNSLYRDY
FT                   IADLIARKGRVD"
FT   gene            573521..574516
FT                   /locus_tag="LSL_0528"
FT   CDS_pept        573521..574516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0528"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ8"
FT                   /protein_id="ABD99337.1"
FT                   /translation="MEKNNSNGTVTFYPNNYENSEEDVHSLSTKGRLLSYNNQLKDSLH
FT                   NGLKFTELLDELIETTDSQNLLRAAMELTLFQLDTAYLVFPQQYSQSDYYLIFLNRLLQ
FT                   LHQNEQVILQSSDRNDELYHEFPGINQNGYFTFRIDNTEEGGAYYTEKNTGEILFYLNF
FT                   QRRILHFNSRAITNLLVVDYSKTYNYETVKKFEMYLMALGEYFKKDYGFDVDFNIMDPS
FT                   NSTFYQFGNTGIPQAALDKLFIQAARENFMLVTGLHNEAILKLDNGVEVTIYDKSIEDS
FT                   SATLNKWGLVVTDDDHKVSWFDLLFQYDFIRTWYLDNLSSLEIQSNPLYF"
FT   gene            574547..574999
FT                   /locus_tag="LSL_0529"
FT   CDS_pept        574547..574999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0529"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ7"
FT                   /protein_id="ABD99338.1"
FT                   /translation="MDINEIAKKVRGREIKLFLPTKVLNPEERVAGLYVGLNIYLAKMM
FT                   ENVHNENRKELIEYFCETMVYFISIANEKKWLYLLLLNEEQISNFKSKWHSKSYNSVYL
FT                   IIQQQINKCYFSHQSTEFVHAWHMLIKFGLVELGISPEEIEDYFNQ"
FT   gene            575133..575690
FT                   /gene="efp"
FT                   /locus_tag="LSL_0530"
FT   CDS_pept        575133..575690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="LSL_0530"
FT                   /product="Protein Translation Elongation Factor P"
FT                   /note="COG0231 [J] Translation elongation factor P (EF-P);
FT                   translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99339"
FT                   /db_xref="GOA:Q1WUJ6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ6"
FT                   /protein_id="ABD99339.1"
FT                   /translation="MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLR
FT                   TGAVQEKTFRAGEKVNQAQIDRKKMQYLYADGDNYVFMDTNTYEQLELPGSQIEEELKY
FT                   MKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGIKGDTSSGGSKPATMETGLVVQVP
FT                   FFVSEGDVLTINTSDGTYISRA"
FT   gene            575707..576129
FT                   /locus_tag="LSL_0531"
FT   CDS_pept        575707..576129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0531"
FT                   /product="Alkaline shock protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99340"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ5"
FT                   /protein_id="ABD99340.1"
FT                   /translation="MADNIVLKNEETNDLGRIEMAPEVLEIIIGIAAAKVDGVYSMRGS
FT                   LANNISALLGRQNRGKGVKLSNTDTDLAVDVYTFLNYGVSVPKVANEIQEKVRQQVLFM
FT                   TGIELAAVNVHIQGMVPEKEEPTVDPNNLFEENGDE"
FT   gene            576129..576524
FT                   /gene="nusB"
FT                   /locus_tag="LSL_0532"
FT   CDS_pept        576129..576524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="LSL_0532"
FT                   /product="N utilization substance protein B"
FT                   /note="COG0781 [K] Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99341"
FT                   /db_xref="GOA:Q1WUJ4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUJ4"
FT                   /protein_id="ABD99341.1"
FT                   /translation="MSLSRHDIRKIAFQTLFALGSNPDANSEDIYQELLDEDNNDSDLS
FT                   YLNELVDGVLDHQSEIDMEITKYLRKNWNIGRLNKTDLIILRIAIFEIKYSDVASKIAV
FT                   NEAVELAKEFSDDKSYKFVNAILQNLI"
FT   gene            576669..577526
FT                   /gene="folD"
FT                   /locus_tag="LSL_0533"
FT   CDS_pept        576669..577526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="LSL_0533"
FT                   /product="Methylenetetrahydrofolate dehydrogenase (NADP+) /
FT                   Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="COG0190 [H] 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99342"
FT                   /db_xref="GOA:Q1WUJ3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUJ3"
FT                   /protein_id="ABD99342.1"
FT                   /translation="MVATILDGRMLSKKIRTNVSEKVSLLKQEGITPKLVVILVGEDPA
FT                   SQVYVRNKRKTAHALGIEAVDIRLPENVEEDELIRLIDELNSDGTVHGILVQLPLPKHI
FT                   NENKVTHRIIPEKDVDGFHPLNIGKLFMNIPGPLPCTPRGIMEFFKEYDIPVSGKRVVI
FT                   VGRSNIVGRPMAALLVNSDATVTIAHSKTKNLAEVTKQADILIVAIGKGEFIDENYVKK
FT                   GAVVIDVGMNRNNDGKLVGDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERS
FT                   VAGE"
FT   gene            577519..578859
FT                   /gene="xseA"
FT                   /locus_tag="LSL_0534"
FT   CDS_pept        577519..578859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="LSL_0534"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1570 [L] Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99343"
FT                   /db_xref="GOA:Q1WUJ2"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUJ2"
FT                   /protein_id="ABD99343.1"
FT                   /translation="MSKEYLTVSALTKYLHTKFTRDPYLRRVYLTGEISNFRRRATHQY
FT                   FSLKDDNAVISVMMFQSAFSKIKFEPEKGMKVLVSGRVDLYEKSGRYQIIIDTMQPDGV
FT                   GALYQAYEQLVKKLRIEGLFNEELKKPLVKYPKRIAVITSPSGAVIRDIITTTHRRYPI
FT                   AQLVLFPAVVQGDDAADSLVGRLKQVNEEGNFDTIIIGRGGGSIEDLWPFNEEKVARAI
FT                   SDSKIPVISSVGHETDTTIADLVADVRAATPTAAAELATPVLSEEIVKIKQYRLRIIQV
FT                   LKNKISNYQQILDKVCSSYILQQPDRLYTGYAQNLDSLINRKNQAFKNLVYQNEKQLQL
FT                   LESNLQHNNPSIRIKDEKNNLQQLLEKMHLGMLGVFNDKSYKLEKLMSSLDMLSPLKVM
FT                   NRGYSYILKDGKTVKNVKSLQPNDDVTLYFENGSAEARITKIREEKE"
FT   gene            578859..579086
FT                   /gene="xseB"
FT                   /locus_tag="LSL_0535"
FT   CDS_pept        578859..579086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="LSL_0535"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1722 [L] Exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99344"
FT                   /db_xref="GOA:Q1WUJ1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ1"
FT                   /protein_id="ABD99344.1"
FT                   /translation="MAEKVTFEQDMKNLEEIVKRLEQGDIPLEEAIEKFKQGMDLSKKL
FT                   QNTLLQAEETLTKVIDDNGDEQLFEKENED"
FT   gene            579076..579969
FT                   /gene="ispA"
FT                   /locus_tag="LSL_0536"
FT   CDS_pept        579076..579969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="LSL_0536"
FT                   /product="Geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="COG0142 [H] Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99345"
FT                   /db_xref="GOA:Q1WUJ0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUJ0"
FT                   /protein_id="ABD99345.1"
FT                   /translation="MRISNLTEFEKISLPKLENEMDLYLNSLNSNQILKESMRYSVDAG
FT                   GKRIRPLLVLISAYSLGKKISKSDYQVAGSLELLHTYSLIHDDLPEMDNDELRRGKPTN
FT                   HKKFGQAIAVLAGDGLLTTSFEWLSLTDIDNDKKIKLISQLALAAGPQGMVSGQTDDIL
FT                   GESKKYNLEELKHLHAGKTGALLRYACVAGGILSDASDNQLELLRKYGENFGLAFQIYD
FT                   DLLDVIGDAKSLGKNVHKDEIENKNTYPILLGVQGTKEALVEVLNNTENLLKEMANNDI
FT                   AIDLFEQLLDYFKVRK"
FT   gene            579972..580799
FT                   /locus_tag="LSL_0537"
FT   CDS_pept        579972..580799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0537"
FT                   /product="Hemolysin"
FT                   /note="COG1189 [J] Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99346"
FT                   /db_xref="GOA:Q1WUI9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI9"
FT                   /protein_id="ABD99346.1"
FT                   /translation="MKKERVDVLLVKQGLFSTREQAKRAVMAGEILGENEERLDKPGMK
FT                   ISVDTELHFKGTKMPYVSRGGLKLEKALKVFKVDAKNKTMLDIGSSTGGFTDVALQKGA
FT                   KLSYALDVGTNQLAWKLRQDDRVVVMENTNFRYSKLEDFTKGQPDLATIDVSFISLQLI
FT                   LPTLHEIIQNNGDVIALIKPQFEAGKEKVGKHGIVRDPKVHLEVLNKIISFAAEENYDV
FT                   VELDFSPITGGEGNIEFLVHLVSKESVGNISPSVNPELIVKQAHATLDIKKKA"
FT   gene            580824..581282
FT                   /gene="argR"
FT                   /locus_tag="LSL_0538"
FT   CDS_pept        580824..581282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="LSL_0538"
FT                   /product="Arginine repressor"
FT                   /note="COG1438 [K] Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99347"
FT                   /db_xref="GOA:Q1WUI8"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI8"
FT                   /protein_id="ABD99347.1"
FT                   /translation="MRKQVRQKLIKEILQENVIYKQEDIVEKLNARGINVTQATISRDV
FT                   KEMQLVKLPTQTGSYRYSMPTLKEINVEKKLSDTLSESYVSSAQNRELCVFKVLPGSGP
FT                   AVANLIEQAKYPEVFATLGDDATVMIFAYSEEDAIKMENKLLNLINIG"
FT   gene            581287..582954
FT                   /gene="recN"
FT                   /locus_tag="LSL_0539"
FT   CDS_pept        581287..582954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="LSL_0539"
FT                   /product="DNA repair protein"
FT                   /note="COG0419 [L] ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99348"
FT                   /db_xref="GOA:Q1WUI7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI7"
FT                   /protein_id="ABD99348.1"
FT                   /translation="MLQELSIKDFAIIDEIQISFQPKMTVLTGETGAGKSIIIDALGLL
FT                   AGGRGSTEFIRKGEKKAVIQGLFTLPREANTYNILEEYGIDSEDGQIILQRDLYRGGRN
FT                   ICRINGMMVNLATLRKVGETLIDIHGQNEHQELMKPENHIDLLDEYDKKTSQLRNQYQV
FT                   VYQNYRKLKLSMEKKEADEKAWAQRLDMLNFQVKEIEEAGLKINEEDELVEEKNKLDNF
FT                   QAIHDALELSYQILSGEKIDVVGNLGNAMNELSDVSDLSENLQEINTKISDAFYSLEDA
FT                   ARDISDELDSMEWNGERLNEIEERLELIHQLKRKYGDTIEDILHYHSRIEKELREMENA
FT                   EQNSEKQERQLSEALEKVKELAIKLSKQRKKSAKKLEKMIHEQLSALYMDKAVFEVKCL
FT                   NNSKLYSKGIDKVEFYIQTNPGEEMGPLAKIASGGELSRIMLALKTIFSQKMGVTSIIF
FT                   DEVDTGVSGRVAQAIAEKISQISNNSQVLCITHLPQVAAIADNHYYISKSVNDGRTETS
FT                   LKELDEKQKIREIARMLSGSEITELTLKHAEELIKMSK"
FT   gene            complement(583018..583638)
FT                   /gene="lexA"
FT                   /locus_tag="LSL_0540"
FT   CDS_pept        complement(583018..583638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="LSL_0540"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="COG1974 [KT] SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99349"
FT                   /db_xref="GOA:Q1WUI6"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUI6"
FT                   /protein_id="ABD99349.1"
FT                   /translation="MTKSEKRQHDILRYIFSHVSDSGYPPTVREICNAVGLSSTSTVHG
FT                   HLSKLESKGLIKRDPTKPRAIEITLAGLEMLDELPNKTQIPIVGTVTAGEPILAVEENR
FT                   DYFPLPPYFESADDLFMLSIRGESMINAGILDGDQVIVRKQSSANNGEIVIAMTEENEA
FT                   TCKRFFKEDGYYRLQPENDTMDPIILENVTILGKVVGLYRDLI"
FT   gene            583785..584039
FT                   /locus_tag="LSL_0541"
FT   CDS_pept        583785..584039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0541"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99350"
FT                   /db_xref="GOA:Q1WUI5"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI5"
FT                   /protein_id="ABD99350.1"
FT                   /translation="MADNKGIPQELIDRINELSKKKKEEGLTSEELAEQKELRETYLSL
FT                   FRENFRSHIEMLQVYDKNGKEVTPEKVKKIQRERGLRDD"
FT   gene            584166..584390
FT                   /locus_tag="LSL_0542"
FT   CDS_pept        584166..584390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0542"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99351"
FT                   /db_xref="GOA:Q1WUI4"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUI4"
FT                   /protein_id="ABD99351.1"
FT                   /translation="MSTGIWVLIVIIAAVLGFVGGFFAARKYMEDYLKKNPPINEQMMR
FT                   TMMIQMGQKPSEKKLHQMMNAMKNNYGKK"
FT   gene            584473..585063
FT                   /locus_tag="LSL_0543"
FT   CDS_pept        584473..585063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0543"
FT                   /product="GTP-binding protein"
FT                   /note="COG0218 [R] Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99352"
FT                   /db_xref="GOA:Q1WUI3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUI3"
FT                   /protein_id="ABD99352.1"
FT                   /translation="MQVHNVNLTISAVRPEQYPDAKLPEVALAGRSNVGKSSLINTLIN
FT                   RRNYARTSSQPGKTQTLNFYNIEDLLYFVDVPGYGYAKVSQKEREKWARMIETYFSTRQ
FT                   ELKGAISLVDARHEPSELDCQMIEFLHYYNIPVLVVGTKIDKIPKSKRNKSESQIRKKL
FT                   QLTKNDRLILFSAVDKIGKDEVWNWIESITKVN"
FT   gene            585081..585380
FT                   /locus_tag="LSL_0544"
FT   CDS_pept        585081..585380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0544"
FT                   /product="Hypothetical protein"
FT                   /note="COG1694 [R] Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99353"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI2"
FT                   /protein_id="ABD99353.1"
FT                   /translation="MEFNEYQEAANRTLYGNEQVLTNCALGLAGETGQVVDLVKAYTFK
FT                   GKDLDKEKLVHELGDVLWYLSQIAEWADIPFDEVAQENIETLNKRYPNGFNPAN"
FT   gene            585475..587298
FT                   /locus_tag="LSL_0545"
FT   CDS_pept        585475..587298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0545"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99354"
FT                   /db_xref="GOA:Q1WUI1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI1"
FT                   /protein_id="ABD99354.1"
FT                   /translation="MIGVSNLKKKVISLFKKNWKYCLLVILVLSIILVIKNINKRHYDI
FT                   EDYNSNIQLKNDGSIGVSTRVQYNIHGKYDLLVIPQALPKDVDTINNVEVYEIKNNKQV
FT                   LLKKGTNADISKEAKMNAGKYFVTSDLAETNTKVKVRIYQPVENERVTYKLTYNVPNAI
FT                   INYGNSNISELNWNILSNWGHKFSNIDITFDLPKKNPQILRAWVRGTTNGKITTSKKNG
FT                   KVNFNLNSLSENKSLHLRLICSKDLFAYNTNNMFKTPIPTESSIARYEYKNSDKVKRNS
FT                   KIKYTGKYISITILLIVMTIMGIFSWRVLSRNLVLSNYLKFTKYSFDIPNISVKYVRSI
FT                   LFPKRKPNRNVYAAYIVDLINKGDLVLNPLRTKNYQTIYDYELQVKDEQFIENNRLNTL
FT                   LFSNLTSDNKIKLSEIEETVNLMKISEVTETYKQWQGKIKEEVDNLFKLEHKRNLKGYF
FT                   TKKWLIYWTLFNLVGVILFFIVSKWLGIIIATILIVNDISLIYIFINVYKYKPEIFIEL
FT                   RRLKILYRSLRNIEKLELNDVGDENFWEKLLPYAIALNMGERTNRKLYQLYSESNIFMK
FT                   DSILYIGDFAEKIGEIFIRLDLNSETLNIKK"
FT   gene            587362..588741
FT                   /locus_tag="LSL_0546"
FT   CDS_pept        587362..588741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0546"
FT                   /product="Transposase ISLasa5a, IS3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99355"
FT                   /db_xref="GOA:Q1WUI0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUI0"
FT                   /protein_id="ABD99355.1"
FT                   /translation="MTKISVNTKLKAVEEYANGEVTLASVRRKYGIDKLEFRICVGIYA
FT                   KFGKQALLNPPKVTGDFRLNLVKWKQENLASIPETCIHFAFRSPGSISKWEVLYNKQGP
FT                   QALLRLRRGRKTKNGQPTQQGSSRRTTSTPKAESSLTKRKLIIKDTIRRLKKIDSLEKA
FT                   SKKELAQVIYELKAKYLLKDLIDALPIAMSTYQYWQDKFEHPDAEEVELKAVIKGLFDY
FT                   YETEYGVRRLSSQIRDYYQLIGKEAPNHKRIQRLMHEMGLKCTKYNRRVRKYDSSKGPT
FT                   GKKAKNKLNRRFMSNRKYQKMVCDITEFKAHNGRKVYLEMIKDLATNQILTWSIGDHPN
FT                   LQFALTPLKKLLQQLPHTGYQLTLHTDQGWHYQHRAWRKFLRQGRIRQSMSHRATCLDN
FT                   AACETVFSKLKAEIGPDTSYRNQEELSQAINEWIHFYNERRIQTKLGNQTPLQYEQSLI
FT                   A"
FT   gene            588945..591074
FT                   /locus_tag="LSL_0547"
FT   CDS_pept        588945..591074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0547"
FT                   /product="Hypothetical protein"
FT                   /note="COG0419 [L] ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99356"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH9"
FT                   /protein_id="ABD99356.1"
FT                   /translation="MDNKGIVQNDIADAQDKVQKPQQNLNKDIVEFTELKNEKESELDN
FT                   LLNLQISLQNEYAKLVNIKEKISNEGEESQKEELERNKKSLERVEKSLHETELQWNDNH
FT                   RKLIQAKKDLNNVEEVSNIEKKQVNAKDSSEIIKRDVERADRKVKISYEDWMRKKKEIE
FT                   STEKDIAQCKNDISSKKKQLEKEKDKLPTTDKLVKEVQKKIDKNLENIDTVQKQKDELQ
FT                   SILSKLAIAIEKEKNKIDLLPQIRIPQDYTQLLFENFNYGKISREEVADIISPGLELNN
FT                   KKLNFSEIDDKNKISDVTKLTLQELIEISTFVASLLNPLREKMGSRLIEVTPDSIQFTQ
FT                   AVVDRYNQDNWQTFYSQKSNKLGLGHDIEGLSDLWNQTPSVFEDYDSKDEELANGEEYF
FT                   NEFSDNEMTMADLKTVIYRVLVDFLFNDTKNNFGHLETLLGLNKSKDYSTHYMAVGIDN
FT                   NLAIHFEFAYNNIKANGSYVISDFGKKNIEAKINELKAEQAGNLIKLSDLNSQLENENK
FT                   NKIALEEELQNAQKGPDMTGIMKLEDDLNSLNKNISVLQDRLRGKNNLSELVREEWIKN
FT                   KGLLRREENKFEASKAAITATEIELNSIKIDLSQKEKQVEKYNKSELENSEQLNILKVN
FT                   YETIQENIQTILDDLKEYNGIDQKIEELKEKLINNEKDVAKITAVYNDLVVKVQSYQNV
FT                   LEYKEKELSDLQEYE"
FT   gene            591222..591371
FT                   /gene="rpmG"
FT                   /locus_tag="LSL_0548"
FT   CDS_pept        591222..591371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LSL_0548"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="COG0267 [J] Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99357"
FT                   /db_xref="GOA:Q1WUH8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUH8"
FT                   /protein_id="ABD99357.1"
FT                   /translation="MRVNITLECTECHEQTYLTSKNKRNNPDRIELKKYCPRDHKVTLH
FT                   RETK"
FT   gene            591426..591974
FT                   /locus_tag="LSL_0549"
FT   CDS_pept        591426..591974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0549"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="COG0212 [H] 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99358"
FT                   /db_xref="GOA:Q1WUH7"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH7"
FT                   /protein_id="ABD99358.1"
FT                   /translation="MSMNKKEFRKNQIQKLQKLSKTWEKKLDELNLYKELFKTTEWEKA
FT                   DNVAITLSEDFELDTFPIISTAQQQNKKVLVPKTFPNRMMEFVELTPDVKIVRTKFGVL
FT                   EPESENYVNKENIDLIIVPGLAFAENGARLGFGGGFYDKYLSDYRGNKVALVDRSRYFQ
FT                   EPQWDVDSFDIYITNQIRI"
FT   gene            591988..592650
FT                   /locus_tag="LSL_0550"
FT   CDS_pept        591988..592650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0550"
FT                   /product="Integral membrane protein, Rhomboid family"
FT                   /note="COG0705 [R] Uncharacterized membrane protein
FT                   (homolog of Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99359"
FT                   /db_xref="GOA:Q1WUH6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH6"
FT                   /protein_id="ABD99359.1"
FT                   /translation="MLQYLKNKPSITYTLIILNIVMYIVMTLFGGTENIANLVRFGAKY
FT                   SPYIINGQYWRLITPMFIHIGLQHLLINMITLYFLGTLLENIFGKTRFLIIYLVSGICG
FT                   NIASFAFNFSSISAGASTALFGMFGSFLMLGESFRRNPYLQTMSRQFFLLVILNIFFGM
FT                   FGNSDLAGHLGGLVSGFLLGYVVGVPNLGRVPKVKRIVSFVILLFINLIILNLGFTS"
FT   gene            592690..592929
FT                   /locus_tag="LSL_0551"
FT   CDS_pept        592690..592929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0551"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99360"
FT                   /db_xref="InterPro:IPR009256"
FT                   /db_xref="InterPro:IPR023164"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH5"
FT                   /protein_id="ABD99360.1"
FT                   /translation="MKTLYDVQQLLKNFGIFVYVGKRMWDIELMALELDHLYKAGVIDK
FT                   QTFLSAKLVLNREHGVEEKRAKSPVKFNIKENEE"
FT   gene            592926..593888
FT                   /locus_tag="LSL_0552"
FT   CDS_pept        592926..593888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0552"
FT                   /product="Glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="COG1940 [KG] Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99361"
FT                   /db_xref="GOA:Q1WUH4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH4"
FT                   /protein_id="ABD99361.1"
FT                   /translation="MNKKLIGVDLGGTTIKFAILTLDGEIQQKWSVETNILDDGKHIVP
FT                   DIVESINHHLDLYDMKPEQFVGIGMGTPGTVDIENGTVEAAFNLNWKEKQNLKEEIEKG
FT                   TGMKFAVDNDANVAALGERWKGAGENDDEVTFVTLGTGVGGGVITNGEMVHGAGAGGEI
FT                   GHINVQPNGYLCTCGNHGCLETYASATGVVRVARDMAEEFAGKSDLKKMLDDGQDISSK
FT                   IVFDLAKDGDVLAERVVDRVCYYLGFACANIGSLINPSYIVIGGGVSAAGKFLLDQVDS
FT                   YFKEFAFPSVKKSTTLKLAELGNEAGVIGAASLALKFNK"
FT   gene            593931..594344
FT                   /locus_tag="LSL_0553"
FT   CDS_pept        593931..594344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0553"
FT                   /product="Conserved hypothetical protein, rhodanese-like
FT                   domain"
FT                   /note="COG0607 [P] Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99362"
FT                   /db_xref="GOA:Q1WUH3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH3"
FT                   /protein_id="ABD99362.1"
FT                   /translation="MFLADISVWAWVNIILILLVAYLLGMQLYTYISGKRVSTMLDNEE
FT                   FKKGMKKAQVIDLREPDTFNAGHILGARNMPYSQFKIYKSSLRKDMPVYLYETGRTIAT
FT                   RAAVQLYKDGFRDLYILKSGYDRWDGKKKKSKY"
FT   gene            complement(594414..594590)
FT                   /locus_tag="LSL_0554"
FT   CDS_pept        complement(594414..594590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0554"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99363"
FT                   /db_xref="InterPro:IPR021402"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH2"
FT                   /protein_id="ABD99363.1"
FT                   /translation="MKKFNLGFLLGVTTTLGALAGAVFTFKKNVVEPIEEKEAILEEHR
FT                   RRALRKSRSAHQG"
FT   gene            594722..595645
FT                   /gene="miaA"
FT                   /locus_tag="LSL_0555"
FT   CDS_pept        594722..595645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="LSL_0555"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COG0324 [J] tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99364"
FT                   /db_xref="GOA:Q1WUH1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUH1"
FT                   /protein_id="ABD99364.1"
FT                   /translation="MTQKVIVIVGPTAVGKTALSIDIAKKYKGQIISGDSMQVYRNLDI
FT                   GTAKITPDEMGDIKHYMIDILQVQQRFSVADFIDNCRKDIKEIANDDNIPIIVGGTGFY
FT                   LQALLDGYSLGGDTFDQLSIERRKKWQLFMEKNGKEKLWEELAKLDIVAARKIPINNFR
FT                   RVIRALEVIEQTGRLFSEQHDESNEEFEPLLIGLNTQRSTLYERINKRVDIMIQTGLIE
FT                   EAKYLYNLGGATLPAGKGIGYKEFYPYFDGEISKDEAIELVKRNSRRYAKRQLTWFRNK
FT                   MNVVWFDLVNNPEDIKKIYKLIDDWI"
FT   gene            595667..596929
FT                   /locus_tag="LSL_0556"
FT   CDS_pept        595667..596929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0556"
FT                   /product="Aluminum resistance protein"
FT                   /note="COG4100 [P] Cystathionine beta-lyase family protein
FT                   involved in aluminum resistance"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99365"
FT                   /db_xref="GOA:Q1WUH0"
FT                   /db_xref="InterPro:IPR009651"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUH0"
FT                   /protein_id="ABD99365.1"
FT                   /translation="MSKWSEDLPKDLQNKIEIVDEKISSKLEDITEIVLNNQRRVLELF
FT                   RKHHVAEEDLVGSTGYGYDDIGRDKLDAMFADYFKTEDAMVRPQLTSGTHAISTAFFGV
FT                   LRPHDTLHYLTGMPYDTIQEVIGVAGDNPGTLEEHLINFSYTPLLDNGKVDYKRAKEDL
FT                   QKDSSIKMVAIQRSRGYSSRDSFVVSEIAEMIKFVKKYAPQAIIFIDNCYGEFTETEEP
FT                   TFYGADLMAGSLYKNAGGGIAKTGAFLVGNKDLIDRCGARFIVPGAGKNEGATYPFMRD
FT                   FYEGFFLAPNVTGEAIKGSIYAAALLEEMGMDVSPSWDAPRTDLVQTVNFGNPDAMVKF
FT                   CAAIQHNSPMNAYVEPVPSYMDGYEDKIIMASGSFTEGSTIELSSDGPLREPYTLYIQG
FT                   GLTYAHVKIAITKAVLETFYK"
FT   gene            597020..597406
FT                   /gene="glnR"
FT                   /locus_tag="LSL_0557"
FT   CDS_pept        597020..597406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="LSL_0557"
FT                   /product="Glutamine synthetase repressor"
FT                   /note="COG0640 [K] Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99366"
FT                   /db_xref="GOA:Q1WUG9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG9"
FT                   /protein_id="ABD99366.1"
FT                   /translation="MREKELRRSLAVLPMGTVMKLTNLTARQIRYYEEQELVIPERNAG
FT                   NRRMYSLNDIDKLLEIKDFLGEGINMAGIKHIYEEKAKKEQEKADKHNTLTDADVRRIL
FT                   RDEFVSAGGFMKDNDFSLRNNRSL"
FT   gene            597436..598779
FT                   /gene="glnA"
FT                   /locus_tag="LSL_0558"
FT   CDS_pept        597436..598779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="LSL_0558"
FT                   /product="Glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COG0174 [E] Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99367"
FT                   /db_xref="GOA:Q1WUG8"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG8"
FT                   /protein_id="ABD99367.1"
FT                   /translation="MVKFDYTKDDIRRIAKEENIRFLRLMFTDLYGTIKNVEVPISQLD
FT                   KVLDNKMMFDGSSIDGFVRIEESDMWLYPDLSTWMIFPWGGEHGKVARLICEVYNADRT
FT                   PFLGDPRNNLIRVLDEMKEMGFTEFNIGPEPEFFLFKLDEKTGRPTIHLNDKGSYFDLA
FT                   PVDLGENCRRDIVLELENMGFDVEASHHEVAPGQHEVDFKYADALHACDNIQTFKLVVK
FT                   TVARKYGLHATFMPKPLDRINGSGMHLNMSLFHKDGNAFFDTKGEEQLSQDAYYFLGGV
FT                   LKHARNFTAIMNPTVNSYKRLVPGYEAPVYVAWSGHNRSPLVRVPIARGNSTRLELRSV
FT                   DPSANPYLAVAALLEAGLDGLRNKIEPAAPVDRNIYAMDDEEREANNIQDLPSTLHNAL
FT                   KALKTDKVVQDAMGPHLYQNFLEAKRLEWDAYRQEVSQWERDQYLEMY"
FT   gene            599192..599653
FT                   /gene="ada"
FT                   /locus_tag="LSL_0559"
FT   CDS_pept        599192..599653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="LSL_0559"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG0350 [L] Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99368"
FT                   /db_xref="GOA:Q1WUG7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG7"
FT                   /protein_id="ABD99368.1"
FT                   /translation="MYKMNYDSPIGNIVLKSDGYSLVECYFSDEEENEEKNIGNVVLEE
FT                   TVQWLDDYFKGNKPLIKDLPIKFKGTEFQLKVWNELLKIPYGSTISYKELGKIIFGEKN
FT                   ISSQAIGRAVSKNKLLVIVPCHRVIGSRGDLVGYAGGIDRKKYLLDHEK"
FT   gene            599740..600117
FT                   /locus_tag="LSL_0560"
FT   CDS_pept        599740..600117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0560"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99369"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG6"
FT                   /protein_id="ABD99369.1"
FT                   /translation="MVQSINTKVDLTMAGTSYMGLSDYGKIMIGDKGFEFFNDRDVRKY
FT                   IQIPWEEVDVVIASVMFKGKWIPRFALRTKKNGMFTFSAKNSKEVLRAIREYVPADRMV
FT                   RSLTFFQVIKRNLKNLFKNKK"
FT   gene            600230..600952
FT                   /gene="pyrH"
FT                   /locus_tag="LSL_0561"
FT   CDS_pept        600230..600952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="LSL_0561"
FT                   /product="Uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="COG0528 [F] Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99370"
FT                   /db_xref="GOA:Q1WUG5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUG5"
FT                   /protein_id="ABD99370.1"
FT                   /translation="MSDIKYKRVLLKLSGEALAGDQGKGINPPEILKVAEEIKEVHDLG
FT                   VQIAIVVGGGNMWRGEAGAEIGMERAQADYIGMLGTVMNALALQDSLESVGVPTRVQTA
FT                   IEMRQVAEPYIRRKAIRHLEKGRIVIFAAGTGSPYFSTDTTAALRASELNAEVILMAKN
FT                   GVDGIYNADPKVDPTAKKYTKLTHMDIINKGLRVMDTTASSLSMDNNIALVVFNMNNRG
FT                   NIKKVVEGEEIGTTVEGK"
FT   gene            600955..601518
FT                   /gene="frr"
FT                   /locus_tag="LSL_0562"
FT   CDS_pept        600955..601518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="LSL_0562"
FT                   /product="Ribosome Recycling Factor, RRF"
FT                   /note="COG0233 [J] Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99371"
FT                   /db_xref="GOA:Q1WUG4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUG4"
FT                   /protein_id="ABD99371.1"
FT                   /translation="MKITEPIIKEAQEKMTKAEDSLRRELGNIRAGRANASLLNRINVE
FT                   YYGAPTPLNQMAQISVPEARVLLVTPYDKTSLKNIEHAIMASDLGIAPMNDGTAIRLVI
FT                   PQLTEERRKELAKQVKAVSETGKVAVRNIRRDMMDALKKAQKNGDLTEDDLRDLENQAQ
FT                   KVTDESIKNIDKITEDKEKEVLEG"
FT   gene            601653..602435
FT                   /gene="uppS"
FT                   /locus_tag="LSL_0563"
FT   CDS_pept        601653..602435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="LSL_0563"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="COG0020 [I] Undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99372"
FT                   /db_xref="GOA:Q1WUG3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG3"
FT                   /protein_id="ABD99372.1"
FT                   /translation="MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPR
FT                   IAGHKQGMETVKNITKVASNLGVKVLTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVP
FT                   ELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNCTGMVLNFALNYGGRAELVSAIQS
FT                   IASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERISNFLLWQLAYSE
FT                   FVFTDTLWPDYSEEDLLANIYTFQTRDRRFGRLKEEKK"
FT   gene            602438..603226
FT                   /gene="cdsA"
FT                   /locus_tag="LSL_0564"
FT   CDS_pept        602438..603226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="LSL_0564"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="COG0575 [I] CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99373"
FT                   /db_xref="GOA:Q1WUG2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG2"
FT                   /protein_id="ABD99373.1"
FT                   /translation="MKQRVITAVVALLIFIPLLVVGGNLFSILVVAMGLVGMSEFLTMK
FT                   RKLLISPEAIIAFMAVACLLVPSNWINFFPNGIFYSGFYFFTLVLLGYTVVSRNRFSFD
FT                   DVGAIILGAIYSGLGFHYMIYARQESLWMILYAFLITWITDSGAYLIGRQIGRTKLAPH
FT                   ISPNKTWEGSIGGTVSAVIIVGIYLFFKQGVFPYGFLTMLGITVFLSIGAQFGDLIESA
FT                   FKRHYGVKDSGKILPGHGGILDRFDSILLVLPLMHFVGLI"
FT   gene            603251..604528
FT                   /locus_tag="LSL_0565"
FT   CDS_pept        603251..604528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0565"
FT                   /product="Membrane endopeptidase, M50 family"
FT                   /note="COG0750 [M] Predicted membrane-associated
FT                   Zn-dependent proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99374"
FT                   /db_xref="GOA:Q1WUG1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUG1"
FT                   /protein_id="ABD99374.1"
FT                   /translation="MIITIIAFIIVFGVLVFVHEFGHYFFAKKAGILVREFSIGMGPKL
FT                   WFYRKNSTTYTIRLLPIGGYVRMAGAEEDDVPLKKGMTVSLLINDENKVVKINTSNKKT
FT                   LISGVPVQISDWDLEDKLWIEGYENGNDSELKVYEVDHDACIIENDGTEVQIAPKDVQF
FT                   QSAKIIQRMLTNFAGPMNNFILAIVAFLVIALVQGGVASTDNQIGKVQENSVAQKAGIK
FT                   PNDRIIAVDNIKTTTWQEASAQIQKNGNKKIILKIDRKNKIIKIKITPKVQIENGKKVG
FT                   MIGVMAKVHYDKSIVAILSYGFTQTWYIITSIIGVLGKMFTQGFSLNDLGGPVAMYSYT
FT                   SEAAHYGILSVMNLMAVLSINLGIVNLLPIPALDGGKLLLNIVEAIRRKPLDPEKEGII
FT                   TLVGFGFLMILMILVTWNDIQRYFLH"
FT   gene            604579..606294
FT                   /gene="proS"
FT                   /locus_tag="LSL_0566"
FT   CDS_pept        604579..606294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="LSL_0566"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG0442 [J] Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99375"
FT                   /db_xref="GOA:Q1WUG0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUG0"
FT                   /protein_id="ABD99375.1"
FT                   /translation="MKQSQMLIPTLKEIPSDAEVVSHQLMLRGGYIKQITAGMYAYLPL
FT                   AYRVMKKIENIIREEMDRIDAVEMLVPAVVPAELWQESGRYETYGPTLFKLKDRHERDF
FT                   ILGPTHEETFTTIVRDAIKSYKKLPLYLYQIQMKYRDENRPRFGLLRGREFLMLDGYSF
FT                   HVDDASMEKVFNDTDKAYQRIFERCGLDFRGIIADSGAMGGNRSKEFQAIAEVGEDTIA
FT                   YSDSSDYAANIEMAKNLRIPKQSHETPKDLEKVATPNAKTIVEVAEFLGTDTQNEIKTL
FT                   LFIADDEPVVVLMRGIDEVNEVKLKNHLGAIDLRPAEEEEAVKFLGANFGSLGPVGIDE
FT                   NLKVLADLDVEGMINASVGANEDGYHYINVNIDRDYHVDEFLDLREVREGELSPDGEGV
FT                   LKFTRGIEIGHIFQLGTRYSESLGADVLDENGRQVPMRMGCYGIGVSRLLSAIVEQHND
FT                   ENGIAWPREIAPFDIHVVPVNVKNDTQRELSEKVTAMLEDAGYQVLVDDRKERAGVKFA
FT                   DSDLIGLPIRITVGKKADEGIVEIKLRQNGEKIEVKLEELLNSVKILFNETITD"
FT   gene            606391..610725
FT                   /gene="dnaE"
FT                   /locus_tag="LSL_0567"
FT   CDS_pept        606391..610725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="LSL_0567"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG2176 [L] DNA polymerase III, alpha subunit
FT                   (gram-positive type)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99376"
FT                   /db_xref="GOA:Q1WUF9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF9"
FT                   /protein_id="ABD99376.1"
FT                   /translation="METNKQDLFKKLLRQINWENKHGFEEVFTNAEIQKVEVHVESKVW
FT                   NFHLQIEDILPYEVFYQFYQQLQLAFKDIAKVDITLHTKNPIITNQKLGDYWKWVVFNS
FT                   GIQSSFIQELSRSKVPYLDNNRVILLAENEIVKRFLVDQALGPLESTYHKIGFPKFSVN
FT                   TLVDETKAQEIIENIKEQKAKSDAELAQKAVEAIKKQSEQREKSKAEVPSIEGPVQLGK
FT                   KISPDQEITQMINITEEERSVTVQGYVFDKEVRELRSGRKLLILEVTDYTASFVVKKFS
FT                   RTEEDEAMFDAINSGVWIKVRGSVQEDNYMRDLVINAYDLNEIKHESRKDTAPENEKRV
FT                   ELHLHSNMSMMDATNSITEYVSKAAEWGHKAIAITDHGTLQAFPEAHAAGQKNNVKILY
FT                   GVEANIVDDGVPIAYNEQHKNLRDATYVIFDTETTGLSAQYDKVIELAAVKMEKGNVID
FT                   TFEEFIDPGHPLSQTTINLTSITDDMVRGSKSEEEVFRLFKEFCKDCIIVGHNATFDVD
FT                   FMNTGYERHNMEMIQEPWIDTLPLARYLYPEMKGFRLNTLAKKLNIKLEHHHRAIYDAE
FT                   ATGFIYYAMLKDAEEKQILYHDDFNKHVGENDAYKHEHPSHAIILAKTQEGLKNLFKLT
FT                   SESMVKYFYRVPRVPRSILEKYREGLIVGSACADGEVFTAMMQKGYTIAKQKAEFYDYL
FT                   EVQPKPLYEPLLEQELVKDNDNLEEIITNMVKLAHELDKPIVATGDVHFMNKEDAIYRK
FT                   ILIHSQAGANPLNRLKKLPDAHFRTTDEMLEEFSFLGEDIAKEIVVTNPNKLVDEISEI
FT                   TPVKDKLYTPKMEGAEQDIHDLTMNRAHAWYGDTLPEIVQKRLDKELKSVIGNGFSVIY
FT                   LISQKLVYKSNKDGYLVGSRGSVGSSLVATMTGITEVNPLPPHYRCPKCKWTHFYEKGE
FT                   YGSGYDLPDKDCPNCGTELIKDGQDIPFETFLGFKGNKVPDIDLNFSGDYQPIAHNYTK
FT                   VLFGENNVYRAGTIGTVADKTAYGYVKAYERDTEQNFRGAEIDRLAKGATGVKRTTGQH
FT                   PAGILVVPDYMDIYDFTPIQYPADDLTAAWRTTHFDFHSIHDNILKLDILGHDDPTMIR
FT                   MLQDLSGIDPKTIPTDDPGVMALFSGTDILGVTPEEIQSSTGTLGVPEFGTRFVRGMLE
FT                   ETHPKTFAELLKISGLSHGTDVWLGNAEELIKNGTVTMPDVIGCRDDIMMDLIHMGVES
FT                   DKAFKIMEHVRKGRGIPDEWQADMRAADVPEWYIGACLKIKYMFPKAHAAAYVLMALRI
FT                   AYFKVYYPLVYYAAYFSVRADDFDLVSMSRGKEAVKNAMELINSKGNEATTKEKNLLTV
FT                   LEIANEMLERGFDFSMVDINKSDAQNWTIQEDGRTLLAPFTAIPGLGLNVAKQIVAARE
FT                   EQEFISKEDLSKRGKVSQSLIDFMTENHVLDDLPDENQLSLF"
FT   gene            610934..611407
FT                   /locus_tag="LSL_0568"
FT   CDS_pept        610934..611407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0568"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99377"
FT                   /db_xref="GOA:Q1WUF8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF8"
FT                   /protein_id="ABD99377.1"
FT                   /translation="MSSVVETVTNLVTPILDENHFELVDVEFVKEGKSWYLRVYIDKPN
FT                   GINIEECALVSDKLSEKLDSCDPDPIPQAYYLEVSSPGAERPLKKEKDYERALNKYIHI
FT                   SLYQAIDGQKVYEGTMVDLNKETLTLEYRVKTRTVTKTFDRNKIAKARLAIKF"
FT   gene            611433..612560
FT                   /gene="nusA"
FT                   /locus_tag="LSL_0569"
FT   CDS_pept        611433..612560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="LSL_0569"
FT                   /product="N utilization substance protein A"
FT                   /note="COG0195 [K] Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99378"
FT                   /db_xref="GOA:Q1WUF7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUF7"
FT                   /protein_id="ABD99378.1"
FT                   /translation="MSKELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNV
FT                   EVEFDKIAGNIHVYAVKEVVNEVYDSQLEISLKSALEINRAYEIGDTIREEVTPKDFGR
FT                   IAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTGEVERRDNKFVYVNLGRIEAVLSR
FT                   QDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQEIPEIFDGTVEI
FT                   VSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPAE
FT                   YIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKS
FT                   ESDAADLNNVEADNNDIDDEDQLMSDSSSNIIEEE"
FT   gene            612563..612862
FT                   /locus_tag="LSL_0570"
FT   CDS_pept        612563..612862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG2740 [K] Predicted nucleic-acid-binding protein
FT                   implicated in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99379"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUF6"
FT                   /protein_id="ABD99379.1"
FT                   /translation="MAQRKIPMRKDIVTGEMVPKKELVRVVKNKEGEVSIDPSGKKSGR
FT                   GAYIHLNVDVAKKAKVDKTFDKTFGISISDDFYDELIAYVDHQVERAKLFGNGK"
FT   gene            612852..613157
FT                   /gene="rPL"
FT                   /locus_tag="LSL_0571"
FT   CDS_pept        612852..613157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rPL"
FT                   /locus_tag="LSL_0571"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="COG1358 [J] Ribosomal protein HS6-type
FT                   (S12/L30/L7a)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99380"
FT                   /db_xref="GOA:Q1WUF5"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUF5"
FT                   /protein_id="ABD99380.1"
FT                   /translation="MENRIKVLNLLGLARRASKLVTGQELVLSRIRSNKVNIVFVASDS
FT                   GKNSLKQFTDKCKSYNVFLCKSFTKEELSSAIGQKRSVIAVNDIGFANRMKELLSD"
FT   gene            613229..615442
FT                   /gene="infB"
FT                   /locus_tag="LSL_0572"
FT   CDS_pept        613229..615442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="LSL_0572"
FT                   /product="Bacterial Protein Translation Initiation Factor 2
FT                   (IF-2)"
FT                   /note="COG0532 [J] Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99381"
FT                   /db_xref="GOA:Q1WUF4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF4"
FT                   /protein_id="ABD99381.1"
FT                   /translation="MVKKRIYELAKELGISSERVIEIAKKYDFKVTNHMSALDENEQNK
FT                   IRGSISLKAKKKEHIQHNKNKDNFHSKKVQKSNTGSKDENNHKNVHKNNRKRSGSSMKE
FT                   NNNAKNGQRNNRNNRSNNKFKNKRNNNNKRNNNFKKGNPVPPRKNKPLPETLVYTVGMN
FT                   VADIAKKIHREPAEIIKKLFMMGVMVNQNQSLDKDTIELLAADYGINAEEKVEVDVSDI
FT                   DKFFEEEQNNTEHLEKRPPVVTIMGHVDHGKTTLLDKLRHTHVTEGEAGGITQHIGAYQ
FT                   VRHDDKIITFLDTPGHAAFTNMRARGADITDITVLVVAADDGVMPQTIEAINHAKAAGV
FT                   PIIVAVNKIDKPGANPNHVMEQLTEYELIPESWGGDTIFVEISAKFGKNLDELLDMILL
FT                   EAEMLELHANPNQRGAGSVIEARLDKGKGSVASLLVQQGTLHVGDPIVVGNTFGRVRTM
FT                   VDARGYDIKKATPATPVEITGLNEVPDSGDRFITFEDEKTARAAGEKRAERALLKERSQ
FT                   TNHVTLDNLFDTLKEGELKEVGVIIKADVQGSVEALAQSFKKIDVEGVRVNIIHQAVGA
FT                   INESDVTLAEASNAIIVGFNVRPTPLAKQQAESDNVDIRLHRVIYKAIDEIETAMKGML
FT                   EPEYQEKITGQVEIRQTYKVSKLGTIGGGYVIDGYIRRDSGVRVIRDGIVIYEGKLASL
FT                   KRFKDDVKEVKQGYECGLMIEKYNDIKVGDQIEAYIMEEVPVD"
FT   gene            615466..615825
FT                   /gene="rbfA"
FT                   /locus_tag="LSL_0573"
FT   CDS_pept        615466..615825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="LSL_0573"
FT                   /product="Ribosome-binding factor A"
FT                   /note="COG0858 [J] Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99382"
FT                   /db_xref="GOA:Q1WUF3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF3"
FT                   /protein_id="ABD99382.1"
FT                   /translation="MAQHFRVGRLSQEIQREVNDILLKRVRDPRVKDVTITGVEVSGDL
FT                   QHATIYYSILSDKASDEKKVQTGLDKATSLIRGELGHRLSIYVTPEIKFERDKSVQYGD
FT                   HINELLRKLHSTDKF"
FT   gene            615895..616803
FT                   /gene="truB"
FT                   /locus_tag="LSL_0574"
FT   CDS_pept        615895..616803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="LSL_0574"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG0130 [J] Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99383"
FT                   /db_xref="GOA:Q1WUF2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF2"
FT                   /protein_id="ABD99383.1"
FT                   /translation="MDGILPLYKERGMTSNDAVIKCRKIFKTRKIGHSGTLDPEVDGVL
FT                   PICVGKATKVVNYLMDSGKVYKGEITLGFATTTEDLEGEVISKVKLSEPFSDEKINEIL
FT                   SSFIGDIIQVPPIYSAIKVNGKKLYEYARAGEKVDIPERRVHIEYFKQIFPSKFDKEKG
FT                   QQTIYFEVGCGKGTYVRTLAVDVGKKLGVPAVMSDLTRLKSGGFQIGMAKSLSQLEKLA
FT                   HENKLSESLYPIDYAVKDLPRYDLKLEQWRIVKNGGFLSVNTFKEDYDRVNLFYDDRIR
FT                   CIYQYNKEKNRYQSERMIDLS"
FT   gene            616816..617772
FT                   /gene="ribF"
FT                   /locus_tag="LSL_0575"
FT   CDS_pept        616816..617772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="LSL_0575"
FT                   /product="Riboflavin kinase / FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="COG0196 [H] FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99384"
FT                   /db_xref="GOA:Q1WUF1"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUF1"
FT                   /protein_id="ABD99384.1"
FT                   /translation="MKIVKLKEPYDKNAIVDSPIVLALGFFDGVHRGHQEVIKRAIEKG
FT                   KSLGVKVAVMTFDRHPKIIFQNIDGEKFKYLTMLDEKLKHFKNLGVDIAYVVKFDENLA
FT                   YLSPQDFIDKYVVGLHAICVVAGQDYTYGKHDIANMDTISDFAKGRFEIITVDHLQRND
FT                   QKISSTQIRKDLDSGNVEAANLLLGYQYENHGTVEHGFKRGRKIGFPTLNVSIPKNERI
FT                   LGEGVYAVKVKIDKDNLWYEGMASIGHNETFGDDLEKTVEINLFNFDKSVYGEKVIVKW
FT                   YKFLREMVKFDSVEELIDQLNKDKRDTEVFFGDLKKN"
FT   gene            617893..618945
FT                   /gene="hrcA"
FT                   /locus_tag="LSL_0576"
FT   CDS_pept        617893..618945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="LSL_0576"
FT                   /product="Heat-inducible transcription repressor"
FT                   /note="COG1420 [K] Transcriptional regulator of heat shock
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99385"
FT                   /db_xref="GOA:Q1WUF0"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUF0"
FT                   /protein_id="ABD99385.1"
FT                   /translation="MLTERQLLILETIIRDYTDLGQPIGSKTLQEQLPIRVSSATIRNE
FT                   MAVLEKQGFITKEHSSSGRIPSLKGYRYYVDNLVKPVKIDSKSVRSIQSLFGNEYRRVD
FT                   EIIEMSAKILSDLTNYTAITLRPEASDLKLEGFRMVPLGNGQVMVILVASDGSVESQIY
FT                   NLPNNIDGESLEAVIRLINDKLVGSSLSEVTSKLQELQPLLTKYIEKSDGFIDVFGGIL
FT                   DKAIKEQFYIGGRRNLLNFANGNNLEQIKSLYSLIDDESDKIGGLVDNTTNPHDHHGIS
FT                   VKIGDEMSDRLLLDYSLVSATYNVGSHGRGMIAILGPTNMPYSKMIGLVEVFQKELTKK
FT                   LIDYYRNFDK"
FT   gene            618942..619538
FT                   /gene="grpE"
FT                   /locus_tag="LSL_0577"
FT   CDS_pept        618942..619538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="LSL_0577"
FT                   /product="GrpE protein"
FT                   /note="COG0576 [O] Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99386"
FT                   /db_xref="GOA:Q1WUE9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE9"
FT                   /protein_id="ABD99386.1"
FT                   /translation="MIIERGGDVSEEKVKVSEQNEDIEKEIKEDDKASSVENEKSVEET
FT                   DDSSKALDELQKKYDDIEDKYLRAEAEMANMTQRFKKEQEMLLKYEGQDLARDILPVID
FT                   NLNRALEIEVDNDASQQLKKGIEMVARDMEKALKNNNVTKIDSLGKVFDPTLHQAVKTV
FT                   PVEEGQEPETIVQVFQDGYMLKDRVLRPAMVVVAQ"
FT   gene            619577..621424
FT                   /gene="dnaK"
FT                   /locus_tag="LSL_0578"
FT   CDS_pept        619577..621424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="LSL_0578"
FT                   /product="Chaperone protein"
FT                   /note="COG0443 [O] Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99387"
FT                   /db_xref="GOA:Q1WUE8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUE8"
FT                   /protein_id="ABD99387.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGKDPKIITNPEGNRTTPSVVSFKNG
FT                   ETQVGEVAKRQAITNPNTVSSIKRHMGDANYKVKIEDKEYTPQEISAMILQYIKDYAES
FT                   YLGEEVSQAVITVPAYFNDSQRQATKDAGKIAGLKVERIVNEPTAAALAYGLDKLDKDE
FT                   RILVFDLGGGTFDVSILELGDGVFEVLSTNGDTHLGGDDFDNKIIDWLVENFKADNGID
FT                   LSQDKMAMQRLKDAAEKAKKDLSGTTEAQISLPFIAAGEAGPLHLETSLSRAKFNELTE
FT                   DLVERTKIPVRNALADAGLTNADIDEVILVGGSTRIPAVKEAVKAETGHTPNESVNPDE
FT                   AVALGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFST
FT                   AADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPVAPRGVPQIEVKFDIDKNGIVNVS
FT                   AKDLGTNKEQKITIKSSSGLSDEEIDRMVKEAKENEAADKKRKEEVDLRNEVDQLLFQT
FT                   DKTLKEVKDKVSADEVKSVEDARDALKKAQEQSDINEMKAKKDELTKLIQDMSVKLYQQ
FT                   AQQAQQASGAQGDTSANNSTNDDNTVDGDFKEVDPDENK"
FT   gene            621565..622698
FT                   /gene="dnaJ"
FT                   /locus_tag="LSL_0579"
FT   CDS_pept        621565..622698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="LSL_0579"
FT                   /product="Chaperone protein"
FT                   /note="COG0484 [O] DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99388"
FT                   /db_xref="GOA:Q1WUE7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE7"
FT                   /protein_id="ABD99388.1"
FT                   /translation="MNPYDVLGVSKDASDQEIKRAYRKLSKKYHPDLNHEPGAEEKFKE
FT                   VNEAYEILSDPQKKAQYDQFGTTGGQQGFGGGQGFGGFDFGGSGAGGFEDIFSSFFGGG
FT                   QSRNNNGPRQGRDLQYEMHLTFEEAIFGKKTEIKYTREENCKTCSGTGAKPGTSPVTCS
FT                   KCHGRGFIQVQRQTPLGRMMSQQECDVCHGTGKEIKEKCSTCHGSGHVNEQHAIEVTVP
FT                   AGVEDGNQMRLSGQGEAGVNGGPYGDLYIYFSVAPSDKFKRDGADIYLSLPISFVQAAL
FT                   GDEVEVDTVHGKVKMKIPAGTQTGTTFRLRGKGAPHLRAGGNGDQRVTVKIETPKNLNK
FT                   KQREALKAFADSMGEDPSGDDSFFERWSKSKKTKRKK"
FT   gene            622843..624672
FT                   /gene="lepA"
FT                   /locus_tag="LSL_0580"
FT   CDS_pept        622843..624672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="LSL_0580"
FT                   /product="GTP-binding translation elongation factor"
FT                   /note="COG0481 [M] Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99389"
FT                   /db_xref="GOA:Q1WUE6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUE6"
FT                   /protein_id="ABD99389.1"
FT                   /translation="MDLEQMKVRQKHIRNFSIVAHIDHGKSTLADRILEMTDTVTKREM
FT                   QDQLLDSMELERERGITIKLNAVELHYHAKDGETYIFHLIDTPGHVDFSYEVSRSLAAC
FT                   EGAVLVVDAAQGVEAQTLANVYLALDDDLEIVPVINKIDLPSADPERVRQEIEDVIGLD
FT                   ASEAVLASAKKGIGIEEMLEQIVQNVPAPDGDLEAPLKALIFDSVYDDYRGVVLSIRVV
FT                   EGTVKPGDKIRLMNSGAEYEVVEVGVNSPKPLKRDFLMAGDVGYLTASIKDIQDTRVGD
FT                   TVTNANNPTAKPLEGYREMNPMVYSGLYPTDNAKYNDLREALEKLQLNDAALEFEPETS
FT                   QALGFGFRCGFLGLLHMDVVQERLEREFNMDLITTAPSVTYDVELTDGTHINVSNPSEM
FT                   PETPLIKQINEPYVKAEIMVPNDYVGAVMELCQRKRGTFVTMDYLDDYRVNVIYEIPLS
FT                   EIIFDFFDKLKSSTRGYASLDYELDGTRPSDLVKIDILLNGDKVDALSFISHRQFAQAR
FT                   GRVIVDKLKTIIPRQNFEIPIQAAIGAKIIARTNIKAYRKDVTARIHTGDPDRRAKLLD
FT                   KQKRGKKRMKAVGTVDVPQAAFMAVLKTDEEIK"
FT   gene            624842..624914
FT                   /locus_tag="LSL_RNA066"
FT   tRNA            624842..624914
FT                   /locus_tag="LSL_RNA066"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA Gln anticodon CTG, Cove score 68.47"
FT   gene            625291..626748
FT                   /gene="glnP"
FT                   /locus_tag="LSL_0581"
FT   CDS_pept        625291..626748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="LSL_0581"
FT                   /product="Glutamine-binding protein / Glutamine transport
FT                   system permease protein"
FT                   /note="COG0834 [ET] ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99390"
FT                   /db_xref="GOA:Q1WUE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE5"
FT                   /protein_id="ABD99390.1"
FT                   /translation="MKKFITFLSIISSLIFLSFFVKPQSVHADEKTYTIATDVTFPPFE
FT                   YADDSNKYVGIDIDLMNAIAKEEGFKVDLKPIGFNAALQSVSAGQVDGMIAGMTITDER
FT                   KQKFDFSKPYYSSGIVMAVKPDSSIKSLKQLRGKKVAIKTGTSGADYANSIKDKYGFKT
FT                   VTFDDSDNMYNDVKNGNSVACFEDSAVLEYGISTGLGLKIVTKPANSGNFGFAVKKGTH
FT                   QELMNKFNDGLDKLKKNGKYQKIIEKYTGKSAISATKEANEKKSKDSHTVLGLLKQNKR
FT                   AFLDGIVETLKLTVVGIIGATIFGILIGMLGVVPNKFAQGISTTIIYIFRGLPLLVLAL
FT                   FIYNGIPSLTGSKIPAFIAGIITLTLNEGAYTAAFVKGGIEAVDKGQMEAARSLGLSFG
FT                   KSMRKVILPQGVKIMIPSFINQFIITLKDTSILSIIGILELTQTGKIIIARNLEGFRIW
FT                   GIIAIMYLLIITILTLLSKWIERRINN"
FT   gene            626748..627488
FT                   /gene="glnQ"
FT                   /locus_tag="LSL_0582"
FT   CDS_pept        626748..627488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="LSL_0582"
FT                   /product="Glutamine transport ATP-binding protein"
FT                   /note="COG1126 [E] ABC-type polar amino acid transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99391"
FT                   /db_xref="GOA:Q1WUE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE4"
FT                   /protein_id="ABD99391.1"
FT                   /translation="MTDLKVDVTDLKKNYGSNHVLKGINFKVKNNEVVVLIGPSGSGKS
FT                   TLLRCLNKLEEPTSGSIIIDGHDISDPKTDIDKARENIGMVFQHFNLFNNLTVGENITL
FT                   APVELGKLEKEQAEFVAKNLLETVGLADKYDAMPASLSGGQKQRVAIARALAMKPDIML
FT                   FDEPTSALDPEMVGDVLEVMKELAKDGMTMVVVTHEMGFAKEVADRVVFMADGHVMEEG
FT                   TPEEVFDNPQNERTKAFLDKVINV"
FT   gene            complement(627569..627898)
FT                   /locus_tag="LSL_0583"
FT   CDS_pept        complement(627569..627898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0583"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99392"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE3"
FT                   /protein_id="ABD99392.1"
FT                   /translation="MASNSDSLFFILSYIKRHPDDLVKAIPAYDNVIRLFISDKVKVSD
FT                   AEIYFPDNSLMVNRLKLDFISQHGKLLDDFFQMTGRQLRGYHEVWASTAHLTDRNVYLV
FT                   ELSYE"
FT   gene            627991..628992
FT                   /gene="ampC"
FT                   /locus_tag="LSL_0584"
FT   CDS_pept        627991..628992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="LSL_0584"
FT                   /product="Beta-lactamase family protein"
FT                   /note="COG1680 [V] Beta-lactamase class C and other
FT                   penicillin binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99393"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE2"
FT                   /protein_id="ABD99393.1"
FT                   /translation="MFERTCDLIENLYKDNIVPGVSYAVIKPGEVLTKVIGNSQLIPKV
FT                   EKLKAGMLYDMASLTKVVGTTTVILKLFEDNKISIDDKVKDYLPLFKDDRVTIRHLLTH
FT                   TSALNGYIPHRNELNAQELIEAMYTLKVGDWLGKKVVYTDTGLILLGEIIQKIYNKPVQ
FT                   TVIMQEILQPLQLFESTFNPDPGLCVPTEVQKNGKVLKGIVHDPKARILGKYCGSAGLF
FT                   MSLNDLIKFSNWIIHNSQNRVLKDKTISKLFNDWTPNGTLGRSLGWDLRYRNDGVPCIY
FT                   HTGYTGTFILIDRDSGCGLIVLSNRVHPSSNNQIFLDRRDIIISTFLDEIIN"
FT   gene            complement(629058..629855)
FT                   /locus_tag="LSL_0585"
FT   CDS_pept        complement(629058..629855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0585"
FT                   /product="Transposase ISLasa6a, IS3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99394"
FT                   /db_xref="GOA:Q1WUE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE1"
FT                   /protein_id="ABD99394.1"
FT                   /translation="MKVSRSGYYKWKITPKSARQVENEQISEIIRKEFHKSGDKAGYRT
FT                   ITMTLKRKYNIQCNHKRVLRLMRSMNLKSIIRRKTKGCTIVRGNEFEENILNRDFKADT
FT                   INEKWVTDVTYLKYGENHEHKAYLSAVKDLYNGEIISWVVSKTNDNPLVMKTIKAAIEA
FT                   NPGVTPILHSDRGFQYTSKEYVHEVSKVVITRSMSRVGRYIDNAPMESFWSHFKDEYYY
FT                   DHTFITYEELVVGVDSYINYYNNDRYQWNLKSLTPVEYRNQAA"
FT   gene            complement(629972..630640)
FT                   /locus_tag="LSL_0586"
FT   CDS_pept        complement(629972..630640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0586"
FT                   /product="Transposase ISLasa7, IS3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99395"
FT                   /db_xref="GOA:Q1WUE0"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUE0"
FT                   /protein_id="ABD99395.1"
FT                   /translation="MSGRTNFTWKQRLEAVEMCLSGDYSYITVAKKFNTRDSTLRNWIS
FT                   SYKNNGVDGLKESHTWRKYPLELKLAAVNDHLSRKFSLSECCDKYNISSRSVLCKWISK
FT                   YNSGKELKATNGGSTRMKAGRKTTSEERLEIALYAIEHGKNYSATAKKYNVSYQQVYNW
FT                   VKKYLSKGENGLKDNHGKRIENRDKAELTDAEKAELKLKEAEDRIRRLEAENFMLKKLH
FT                   "
FT   gene            complement(630745..631449)
FT                   /locus_tag="LSL_0587"
FT   CDS_pept        complement(630745..631449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0587"
FT                   /product="Cobyric acid synthase"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG0121 [R] Predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99396"
FT                   /db_xref="GOA:Q1WUD9"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD9"
FT                   /protein_id="ABD99396.1"
FT                   /translation="MKYSLNLAHLYGDLLNTYGDIGNILALRYYAKQMDTNLKVDIISL
FT                   NQEFNPEKYDIAFFGGGQDYEQMIVSKDIQSKKEALTKYIHDGGPMLAICGGYQLLGQY
FT                   YIGADGQKIEGIHALDHYTESQDNNRFIGDIVIKNEETNQEYHGFENHNGVTYLGKNER
FT                   PLGTVVSGHGNNGKDKTEGAIFKNTYCSYFHGPILARNGELAKRILITALQRKYPDADL
FT                   SKQQALEIKPTY"
FT   gene            complement(631452..632801)
FT                   /gene="murE"
FT                   /locus_tag="LSL_0588"
FT   CDS_pept        complement(631452..632801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="LSL_0588"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG0769 [M] UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99397"
FT                   /db_xref="GOA:Q1WUD8"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD8"
FT                   /protein_id="ABD99397.1"
FT                   /translation="MSLKSSVAITAGKTSHWFLHKFTNGGTSLPGKITLAIDPDVLKSL
FT                   AKDYEIVIITGTNGKTLTTALTVKVLGEKYSNILTNPSGSNMKQGIVSAFLTAQKTKSG
FT                   KKLAVLETDEANVPIISQYISPSIYVMTNLFRDQMDRYGEIYTTYDKILKGINMHPDAL
FT                   VIANGDAPIFNSRELKNKVIYYGFDDKADREQMAPANTDSLLCPKCQHILHYKNRSYSN
FT                   LGKYYCPNCDFKRPKLSYRMNRILSQSPQSSTFEIDNTTISLHIGGTYNIYNALAAYAV
FT                   GNELGVSPQQIAHALSSNDEKVFGRQEVIKIGDKELTLVLIKNPVGLDQVLDMIKTDTE
FT                   PFSLAVLLNANYADGIDTSWIWDGSFESLPFDKIPAILTGGERYRDITFRLRVAGVPEE
FT                   NFSQEEKLPDVLENIKKMPTKHIYVLATYTAVLQLRKLLSEQGYIKGGMD"
FT   gene            633074..633679
FT                   /gene="tdk"
FT                   /locus_tag="LSL_0589"
FT   CDS_pept        633074..633679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LSL_0589"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="COG1435 [F] Thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99398"
FT                   /db_xref="GOA:Q1WUD7"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD7"
FT                   /protein_id="ABD99398.1"
FT                   /translation="MAQLFFRYGAMNSGKTIEILKVAHNYEEQGKNVIIMTSGLDNRDG
FT                   YGYVSSRIGLKRKAIPVVSETNIKDLVEQSSIEPACILVDEAQFLEKHHVLELTQIVDE
FT                   LNIPVMTFGLKNDFMNELFEGSKYLLLYADKIEEMKTICWFCNKKAIMNLRMHDSKPVY
FT                   SGEQIMIGGNESYYPVCRKHYFNPPINNLEKDEGEING"
FT   gene            633672..634754
FT                   /gene="prfA"
FT                   /locus_tag="LSL_0590"
FT   CDS_pept        633672..634754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="LSL_0590"
FT                   /product="Bacterial Peptide Chain Release Factor 1"
FT                   /note="COG0216 [J] Protein chain release factor A; RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99399"
FT                   /db_xref="GOA:Q1WUD6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUD6"
FT                   /protein_id="ABD99399.1"
FT                   /translation="MDKLFDRLQMLEDRYEELGELLSDPDVISDTKRFTKLSKEMADLR
FT                   ETVEKYNKYKEVTQQISDDEEMLSDGLDDEMASLVKEELSNAKNEKVKLEEEIKILLLP
FT                   KDPNDDKNIIMEIRGAAGGDEASLFAADLFSMYSKYAERQGWSIEVIDKNVTEVGGFKE
FT                   IALIINGNSVWSKLKYESGAHRVQRIPVTESAGRVHTSTATVVVMPEEEDVEIELDPKD
FT                   IRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMKILKARVYD
FT                   YYAQQEQSEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLSLNKLDRIMNGELED
FT                   VIDALVLFEQTKAMEKLENE"
FT   gene            634747..635586
FT                   /locus_tag="LSL_0591"
FT   CDS_pept        634747..635586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0591"
FT                   /product="Peptide release factor-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2890 [J] Methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99400"
FT                   /db_xref="GOA:Q1WUD5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD5"
FT                   /protein_id="ABD99400.1"
FT                   /translation="MNNPTFFEVQKWAFSCIKGNGGTLEDVDYLICGQMVWDKTQLLMN
FT                   YRTRIDDKNYQELQEKIELYNQDYPLQYLIGYQDFYGLRLKVTKDTLIPRPETEELVDW
FT                   ILNDNSKNENYDVLDVGTGTGAIGLALKSIRSNWNIFLSDISEPALKVAKENAQNLNLD
FT                   VSFSTSDLFEKIEGKKDIIVSNPPYISENEKIYMDKSVLNYEPHQALFAKNNGLEIYER
FT                   IANESGKLLKQGSKIYMEIGFLQGEAVKKIFKDSFPNSEITLKKDINGNDRMICVKI"
FT   gene            635604..636614
FT                   /locus_tag="LSL_0592"
FT   CDS_pept        635604..636614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0592"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="COG0009 [J] Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99401"
FT                   /db_xref="GOA:Q1WUD4"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD4"
FT                   /protein_id="ABD99401.1"
FT                   /translation="MLITKIYKPSEFNEAAKELRLGELVAFPTETVYGLGADATNEQAV
FT                   KRVYLAKGRPSDNPLIVTVSSLEMVKRFVPSLSKEVEKIIEKFWPGSLTIVLKIKDGSL
FT                   SKTVTGGLKTAAFRMPKNETTLNLITALGNPIVGPSANSSGKPSPTTAQHVYHDLEGRI
FT                   AGILDDGPTDVGVESTIIDMSTEIPTILRPGAVTAEEIEKVIGKEVYSDKHKVKENEIP
FT                   KAPGMKYKHYAPSAQVLIVNKDNWNSALQWANENKNQVGILADDEVLSKALENKTYSLG
FT                   ENVESAAKNLFAGLRYFDDDNQIKYILAEAFPEEGVGLAYMNRLKKSAGNQFYNK"
FT   gene            636708..637337
FT                   /gene="upp"
FT                   /locus_tag="LSL_0593"
FT   CDS_pept        636708..637337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="LSL_0593"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COG0035 [F] Uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99402"
FT                   /db_xref="GOA:Q1WUD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUD3"
FT                   /protein_id="ABD99402.1"
FT                   /translation="MGKFQVLDHPLIQHKLSIIRDKNCGTREFRQCVNEIAELMVYEVS
FT                   RDMPLEDVEVETPITKATTKRLAGKKVVVVPILRAGIGMVDGILELIPAAKVGHIGMYR
FT                   DEETLQPHEYFVKMPDDLENREMIIVDPMLATGGSAIMAVDALKKRGAKSIKFVCLVAA
FT                   PEGVKAFREAHPDVDIYSASLDEYLNEDGYIVPGLGDAGDRLFGTK"
FT   gene            637568..638281
FT                   /gene="atpB"
FT                   /locus_tag="LSL_0594"
FT   CDS_pept        637568..638281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="LSL_0594"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0356 [C] F0F1-type ATP synthase, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99403"
FT                   /db_xref="GOA:Q1WUD2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD2"
FT                   /protein_id="ABD99403.1"
FT                   /translation="MNEGTQIVEFFGIPFNVGNIVSGLVSAVIVFVVLFWLSRKIQMKP
FT                   VGRQNVLEWVVDFTNGIIKNALPDEEGKQFGLLAFTLFVFIFISNQLGLIIELTFNGVE
FT                   YVKSPTSSPLTTLTLAFMILVLSHYLGVKKFGFKGYFKNTFLSPMPALLPISIFEQFTN
FT                   FITLALRLYGNIYAGEVLLKLIYNMANSKGVLTYIPAIPLEIIWQGFSVFIGSIQAYVF
FT                   VTLTMVYISQKVEKE"
FT   gene            638300..638524
FT                   /gene="atpE"
FT                   /locus_tag="LSL_0595"
FT   CDS_pept        638300..638524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="LSL_0595"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0636 [C] F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99404"
FT                   /db_xref="GOA:Q1WUD1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUD1"
FT                   /protein_id="ABD99404.1"
FT                   /translation="MSALALIGAGLAAAGAAIGGAIGNSLVISKMLEGMARQPELSNQL
FT                   RSNMFIGVGLVEATPILAIVVSFLLVAKG"
FT   gene            638577..639104
FT                   /gene="atpF"
FT                   /locus_tag="LSL_0596"
FT   CDS_pept        638577..639104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="LSL_0596"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 [C] F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99405"
FT                   /db_xref="GOA:Q1WUD0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUD0"
FT                   /protein_id="ABD99405.1"
FT                   /translation="MNTTFLLSATEQGVAWGDFIFYIVTFLILLALVKKFAWTPITDMM
FT                   EKRATKISNDIDSAEQARQKAEELVEKRDLALKNSRSEASQIIDRAKKNGEQQKANIVS
FT                   SAHEEVQTMKANAKKDIQQERQEALDSVKNDVAELSIEIASKIIRKELTADDQKALVDS
FT                   YIEGLGKQNETR"
FT   gene            639091..639633
FT                   /gene="atpH"
FT                   /locus_tag="LSL_0597"
FT   CDS_pept        639091..639633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="LSL_0597"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0712 [C] F0F1-type ATP synthase, delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99406"
FT                   /db_xref="GOA:Q1WUC9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC9"
FT                   /protein_id="ABD99406.1"
FT                   /translation="MKLDNETIVHRYGKALFELAEEMKIRNKFHSELQEYKKVLQNEPQ
FT                   LKVFMSSNQISPEAKLKIMEILKKDSSKLMTNLLDMLYDYGRITSLEGIIDEFDRLNDE
FT                   FEKTVRASVITAIELDEERKQKLASSFANVVGAKKVIIDPIVDPGIIGGVILKSESYIY
FT                   DGSIKTKIARIKRLLLK"
FT   gene            639654..641165
FT                   /gene="atpA"
FT                   /locus_tag="LSL_0598"
FT   CDS_pept        639654..641165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="LSL_0598"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0056 [C] F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99407"
FT                   /db_xref="GOA:Q1WUC8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC8"
FT                   /protein_id="ABD99407.1"
FT                   /translation="MSIKAEEISALIKQQLANYQDELTVDEVGTVTYVGDGIARANGLD
FT                   NALAGELVEFDDGTYGMAQNLESNDVGIIILGSFKGIREGDTVKRTGRIMEVPVGEELI
FT                   GRVVNPLGQPIDGLGEVKTNKTRPVERKAPGVMERQSVTEPLQTGLKAIDALVPIGRGQ
FT                   RELVIGDRKTGKTSVAIDTIINQKDQDMICIYVAIGQKDSTVRTSVETLRKFGAMDYTI
FT                   VVSAGPSSPAPLLYLAPYAGAAMGEEFMFNGKHVLIVYDDLSKQADAYRELSLILRRPP
FT                   GREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPFIETKAGDVSAYIPTNVISITDG
FT                   QIFLDSDRFYSGIRPAIDAGTSVSRVGGNAQVKAMKKVAGTLRTDLASYSELESFAQFG
FT                   SDLDEATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTHGFLDPVKVDDILPYQD
FT                   GLFDYFDANHKDLLDEIANTGKLPETEKLDAAIKEYAATFQASEK"
FT   gene            641185..642114
FT                   /gene="atpG"
FT                   /locus_tag="LSL_0599"
FT   CDS_pept        641185..642114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="LSL_0599"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0224 [C] F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99408"
FT                   /db_xref="GOA:Q1WUC7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC7"
FT                   /protein_id="ABD99408.1"
FT                   /translation="MPASLQEVKRRIESTKKTSQITSAMQMVSTAKLSQIQKHATSYQV
FT                   YATKIRSVITHLSKSHLLDSVNTTSKNSDGKVNTLGMLRQRPVKTTGIVVITSDRGLVG
FT                   SYNSNVIKETLELIENNHHSTEDVAIIAIGGTGADFFKKRGYNVAYEYRGISDIPTYKD
FT                   ARPLVEAIVSMYDKEVYDELFVCYSHFVNTLTSEFRAEKMLPVSAENMGHDDLTSNDEG
FT                   YSIEYETEPSEDAILEVVLPQYAESLVYGAILDAKTSEHASSSTAMKSASDNAKDIISS
FT                   LELQYNRARQSAITTEITEITGAQAALE"
FT   gene            642139..643545
FT                   /gene="atpD"
FT                   /locus_tag="LSL_0600"
FT   CDS_pept        642139..643545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="LSL_0600"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0055 [C] F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99409"
FT                   /db_xref="GOA:Q1WUC6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC6"
FT                   /protein_id="ABD99409.1"
FT                   /translation="MSSGKVVQVIGPVVDVQFPLSESLPDIDDALKVKREDGTELVIEV
FT                   ALELGDGIMRTVAMDSTDGLKRGAEVEGTGASISVPVGKDTLGRVFNVLGNTIDNGPEF
FT                   DEDHPRNPIHRDAPKYDQLSTGIEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLI
FT                   QELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKESGVLEKTAMVFGQMNEPPGARMR
FT                   VALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMG
FT                   QLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVD
FT                   PLASTSSALTPEIVGEEHYEVATEVQHVLQRYRELQDIISILGMDELSDEEKIIVARAR
FT                   RIQFFLSQNFHVAEQFTGNPGSYVPVEETVKGFKEILEGKYDNLPEEAFRLVGGIEDVV
FT                   EKAKKLAGNN"
FT   gene            643560..643979
FT                   /gene="atpC"
FT                   /locus_tag="LSL_0601"
FT   CDS_pept        643560..643979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="LSL_0601"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0355 [C] F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99410"
FT                   /db_xref="GOA:Q1WUC5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC5"
FT                   /protein_id="ABD99410.1"
FT                   /translation="MDEKSILTINVVTPDGSVYENTTDLVICKTTVGEIGIMPNHLPLL
FT                   ASLAIDEVRVKVDDENFDEIAVSGGFVEFSDNTLSVVASAAERKETIDVSRAERAKQRA
FT                   EKRIEEAKNENNDIDLRRAEVSLRRAINRLNISKH"
FT   gene            644116..644346
FT                   /locus_tag="LSL_0602"
FT   CDS_pept        644116..644346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0602"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99411"
FT                   /db_xref="GOA:Q1WUC4"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUC4"
FT                   /protein_id="ABD99411.1"
FT                   /translation="MYLGLMAVVTIISHFFFITLVFISFQGLRLDYFFSKEKQGKFRLA
FT                   LVLFSVAIGYLASEFFLSFIDSIRNLLFLIK"
FT   gene            644366..645691
FT                   /gene="murA"
FT                   /locus_tag="LSL_0603"
FT   CDS_pept        644366..645691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="LSL_0603"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 [M] UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99412"
FT                   /db_xref="GOA:Q1WUC3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUC3"
FT                   /protein_id="ABD99412.1"
FT                   /translation="MEKIVVRGGNKLEGEVEIEGAKNAVLPILAAAILPSEGRTILTNV
FT                   PMLSDVYTMNNVIRFLNVKVGFDENEKSVEIDATGKLSYDAPFKYVSKMRASIVVLGPL
FT                   LARLGKARVAMPGGCAIGSRPIDLHLKGLELLGAKIEQHNGYIDAHTDGRLVGANIYLD
FT                   FPSVGATQNIMMAATLAKGTTIIENVAREPEIVDLANVLNKMGAKVYGAGTEKIKIIGV
FT                   ESLHGTEHAIIQDRIEAGTFMVASALTQGNVLIKEAIAEHNIPLISKLEEMGVKVIEEN
FT                   EGIRIIGPEKLKPTTVKTLPHPGFPTDMQPQISILQLAAEGTSILTETVFENRFMHLEE
FT                   LRRMNADFKVEGNSVVLHGPTDFNGAEVAATDLRAAAALVLAGLVAKNITQVTNLKYLD
FT                   RGYYHFHQKLASLGADIKRIDDITDRSFEIKKEKLKNVNNLQ"
FT   gene            645849..646835
FT                   /gene="mreB"
FT                   /locus_tag="LSL_0604"
FT   CDS_pept        645849..646835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="LSL_0604"
FT                   /product="Rod shape-determining protein"
FT                   /note="COG1077 [D] Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99413"
FT                   /db_xref="GOA:Q1WUC2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUC2"
FT                   /protein_id="ABD99413.1"
FT                   /translation="MVKDIGIDLGTANVLINVKGRGIVLNEPSVVAIDTKSGRVLSVGS
FT                   EAYQMVGRTPSNIRAIRPLKDGVIADFDMTEQMLSYFIKKLNVKGFMSRPNILICCPTN
FT                   TTDIERKAIRQAAEKSGGGSKVYLEEEPKVAAIGAGLDVFQPHGNMVIDIGGGTSDIAV
FT                   LSLGDIVVSRSLRAAGDKLNSDIANYVRNKHNLIIGERTAEKVKMEIGSVLKGHRDETF
FT                   SVRGRNVVDGLPKTITMTSDETEEAMHDTMQAMISAAKDLLSTTPPELASDIIDRGIVI
FT                   TGGGALLDGIDMLFSEHLKVPVMISETPLDDVALGTGKLLDHIEKSN"
FT   gene            646810..647073
FT                   /locus_tag="LSL_0605"
FT   CDS_pept        646810..647073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0605"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0011 [S] Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99414"
FT                   /db_xref="GOA:Q1WUC1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUC1"
FT                   /protein_id="ABD99414.1"
FT                   /translation="MTILKNQINKGIIFLIRCYQKYISPMFPPTCRYYPTCSNYAIDAI
FT                   KKHGIVKGIIMGIFRILRCNPFVEGGVDVVPEKFTIFRNDDK"
FT   gene            647085..647306
FT                   /locus_tag="LSL_0606"
FT   CDS_pept        647085..647306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0606"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99415"
FT                   /db_xref="InterPro:IPR021351"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUC0"
FT                   /protein_id="ABD99415.1"
FT                   /translation="MSKREKNIEILEVEKIVDNNTITELTTKDQEVIGRILQDGKRYIA
FT                   ELKNGETFRVSSQAEAMEILLREYHLHR"
FT   gene            647378..648580
FT                   /gene="ftsW"
FT                   /locus_tag="LSL_0607"
FT   CDS_pept        647378..648580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="LSL_0607"
FT                   /product="Rod shape determining protein"
FT                   /note="COG0772 [D] Bacterial cell division membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99416"
FT                   /db_xref="GOA:Q1WUB9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB9"
FT                   /protein_id="ABD99416.1"
FT                   /translation="MQDRQSRERREEEDARIDWGIILSVMVLAIIGMLSIYVAASHDTS
FT                   TMSVPRTLISQAMWYAIGIGAIIFIMQFDAEQLWKVAPIAYGLGITLLVLVLIFYSRAY
FT                   ALKTGAKSWLAFGPLTFQPSEVMKPAYILMLGRVVAQHNAEFYEHTIKTDWNLIGKLAL
FT                   WTLPVAVLLKLQNDFGTMLVFFAILSGVILVSGVSWKILAPLFGGAAFLGTAGILLAVY
FT                   GRNLLMAIGFKAYQFARIEAWLNPSASTTGNSYQLWQSMKAIGSGQLFGTGFNHSNVYV
FT                   PVRESDMIFSVIGENFGFIGGCILIFIYLLLIFQMIQVTFDTRNEFYAYISTGVIMMIL
FT                   FHVFENIGMSIGLLPLTGIPLPFISQGGSALIANMIGIGLIMSMRYHNKSYMFSSSKEF
FT                   R"
FT   gene            648605..648958
FT                   /gene="arsC"
FT                   /locus_tag="LSL_0608"
FT   CDS_pept        648605..648958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="LSL_0608"
FT                   /product="Arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="COG1393 [P] Arsenate reductase and related proteins,
FT                   glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99417"
FT                   /db_xref="GOA:Q1WUB8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB8"
FT                   /protein_id="ABD99417.1"
FT                   /translation="MLKVYCYKKCSTCKKAIKWLDNHSIDYKYYEITEERPQEDLFKLW
FT                   LQDTEKKATYFFNTSGNLYRTMNLKDKLKELSIEEKAKLLADNGMLIKRPLVIKDDGSV
FT                   LCGFKEEKYKEFL"
FT   gene            complement(649111..650400)
FT                   /locus_tag="LSL_0609"
FT   CDS_pept        complement(649111..650400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0609"
FT                   /product="Transposase ISLasa4j, ISL3 family"
FT                   /note="COG0675 [L] Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99418"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WR17"
FT                   /protein_id="ABD99418.1"
FT                   /translation="MDNNIKLLLGITDPNLTIDPKYQYTSYIEEKIIKNSKTLLCHLYL
FT                   SYPMYCPNCKALMLHNGTKVANNVHLSSAGKKLVLSIRKQKYLCPECKKTATAKFKDTN
FT                   YHDHFSNAVKAKLVRDLSLSRPMCEIAADSFTSSNTIIRSLESVENNFKVNRNWLPSHL
FT                   SLDDFKSGKRFSSSGMSMCLINAVNHRIIDIIPERNNKFLRNYFIQYSYKARLSVMTIT
FT                   VDLYAPYRSLIKKLFPNAFIIADKFHVVAQAYTAMNKIRTRVMKEYGAGTHEYRALKRF
FT                   WKLLLKNQDNVDYHRYYPRINFKYAELSDSEVLDRLSDMSSELKTAYEYYQLLLQMYRK
FT                   NSCQSLNLLIDTSSWNLPPEMRQALKTIKKHKAEIENSFVLPRLTNGPIEGINNHIKVI
FT                   KRIAYGYNNFKHFRLRILLSLKNNVIFFST"
FT   gene            650629..651483
FT                   /locus_tag="LSL_0610"
FT   CDS_pept        650629..651483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0610"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99419"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB6"
FT                   /protein_id="ABD99419.1"
FT                   /translation="MDGIDFLIEFLNDYYKAKLKNIHDIAGNVHLSGYSELYKKDLFVK
FT                   IFSNKDMFYAEQHVNQVYYPEIYLDSVIFEDNYVVVLKDRQLEDTDKKKISKEQAYLYG
FT                   NLLADFHNKLTGNVSVYEDKSSLGEQIDTLVKTLQNTEYIDDINAVNKTIKERLEKAQL
FT                   EYELLPRVVLHGDFSIRNIKKYQDQVILIDFERSRIGVAYQDFVKFFFNEVKDLDLRNA
FT                   FLKGYRENRPFEIPSETLQSVLLFKTALEILNFHLSHPEKKFGRMADDMLVAIREDKGF
FT                   LEL"
FT   gene            651605..652222
FT                   /gene="gmk"
FT                   /locus_tag="LSL_0611"
FT   CDS_pept        651605..652222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="LSL_0611"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COG0194 [F] Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99420"
FT                   /db_xref="GOA:Q1WUB5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUB5"
FT                   /protein_id="ABD99420.1"
FT                   /translation="MAKRGMLIVLSGPSGVGKGTVRKEIFSQPGNKFHYSVSMTTREMR
FT                   PGEVNGKDYYFVSKEEFEQEIAAGQMLEYAQYVDNYYGTPLKYVNEMLDSGKDVFLEIE
FT                   VKGAMQVREKAPDGLFIFLTPPDLMELRQRIINRGTDDIDTINKRMKKAVDEIEMMQNY
FT                   DYAVVNDEVEKAAEKIKTIIRAERWRVKRFLPDYRKQLGELN"
FT   gene            652224..652421
FT                   /locus_tag="LSL_0612"
FT   CDS_pept        652224..652421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0612"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99421"
FT                   /db_xref="GOA:Q1WUB4"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUB4"
FT                   /protein_id="ABD99421.1"
FT                   /translation="MILYPSVDDLLEQVDSRYSLIMLAAKRAHDLDAGSPELLSNYESP
FT                   KNIGHALEEIAAGKVKIKED"
FT   gene            652566..653765
FT                   /locus_tag="LSL_0613"
FT   CDS_pept        652566..653765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0613"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COG0452 [H] Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99422"
FT                   /db_xref="GOA:Q1WUB3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB3"
FT                   /protein_id="ABD99422.1"
FT                   /translation="MERKNIAVFLTGGIAVYKAANVVRGLIKKGFKVKVAMSEASQKFI
FT                   TPYTFQALTHEKVYTDLFEITDDNPIPHIELADWADFTLIIPATANIIAKMANGIADDF
FT                   ITTTLLAIDTPKFVVPAMNEKMLLNNATKRNMQTLINDGVKIMSPDTGMLAEGYTGKGR
FT                   LPKEEEIIEWIINKINSKKDLVGKKVVISAGSTIEPIDPVRYISNYSSGKMGYALAEAA
FT                   FERGASVTLVSGPTNLLATPGVKINRIKTTKELERKMNEEFKTADIAIMAAAVSDYHVA
FT                   KVANNKIKKTGEKLTLELVQNPDILKGLGSVKEKQILVGFAAETNNLYENAQNKLLSKH
FT                   ADMIVGNDVSRKDIGFGNDDNEVTLFTLKNSPIKLPKTNKKELSHKILDVIVEKLMSKE
FT                   "
FT   gene            653814..656192
FT                   /locus_tag="LSL_0613b"
FT   CDS_pept        653814..656192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0613b"
FT                   /product="Primosomal protein n-prim"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0613b"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99423"
FT                   /db_xref="GOA:Q1WUB2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB2"
FT                   /protein_id="ABD99423.1"
FT                   /translation="MQTNKPFTYKIPENLQGQLERGMRVVVPFGKGNRLIQGFIINFKS
FT                   SSENIDNIKEIDSVLDLEPVLNEEMLEIADWLSKYTFSFKIRCLQVMLPSIMKAKYERK
FT                   FTYIGEQDEKVKELFSGKSDLLGSDKKVNSSTINKLLQLRKQGKIKVDYIVKNKAKAKL
FT                   VSVIKTKLSLQEYENELGSIAPNASKQKKLLNTLKEFPVGSKIRQSELREKYNFTNADI
FT                   KNASEKGWIDVIKVEKYRDPFANYKSYYEKKHKLTQEQSKVVKKLDDDIENDKARVSLL
FT                   QGVTGSGKTEVYLQVIDTALNQGKAAIVLVPEISLTPQMVKRFRARFGTKVAVLHSGLS
FT                   IGEKYDEWRRIEREEAQVVVGARSAIFAPLKNLGVIIVDEEHESSYKQDEMPRYNAKDV
FT                   AKWRGIYHSCPVIFGSATPSLESRARAQKGVYDWLRLTKRVNNQKLPKVQIIDMREAVK
FT                   TSPIPDFSLKMVNSIQEKLDKKEQIVLLLNRRGYSTFMMCRECGYVIKCPNCDISLTVH
FT                   LDSRSLKCHYCGYETRIPYECPSCSSKKIRYYGTGTQKIEKELKGLFPQARILRMDVDT
FT                   TRKKGAHEKLLRTFGDGKADILLGTQMIAKGLDFPNVTFVGVLNADTSLGISDFRASER
FT                   TFQLLTQVSGRAGRADKDGEVIIQTFNPDHYAIKLAQNHDYENFFYKEMELRHNLNYPP
FT                   YYYTLKITVSSNSESLTARTIFKINNEVRMNVSKGTIILGPTPQTVTKINNRYYYQIVI
FT                   KYKKETKLINYLQDLLLSSQRIEREGIQIVIDREPLKFN"
FT   gene            656210..657166
FT                   /gene="fmt"
FT                   /locus_tag="LSL_0614"
FT   CDS_pept        656210..657166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="LSL_0614"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG0223 [J] Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99424"
FT                   /db_xref="GOA:Q1WUB1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUB1"
FT                   /protein_id="ABD99424.1"
FT                   /translation="MTNIVFMGTPAFAAPILEGIIENGYNVLAVVTQPDRPVGRKRVLH
FT                   ASPVKEVALKYGIKVFQPVKLSGSDEMQEIIDLQPDLIVTAAYGQFLPTKLIESVKIAA
FT                   INVHGSLLPKYRGGAPVQYSIMNGDDKTGVTIIYMVKKMDAGDMLAQAELKIESTDDTG
FT                   TIFEKMSILGRDVLLETLPKIISGNVEAVKQDENKVVFSPNIKPEEEILHLNLEAKEID
FT                   WKTRALRPAPGAYFKNFKGKRTKLWSIKPLEEKTEFAPGYVVNVDKHELKVSAYNGTVY
FT                   SIIELQPAGKQKMDITSYLNGVGQGLKIGQRIIEDEE"
FT   gene            657156..658493
FT                   /locus_tag="LSL_0615"
FT   CDS_pept        657156..658493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0615"
FT                   /product="16S rRNA m(5)C 967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0144 [J] tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99425"
FT                   /db_xref="GOA:Q1WUB0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUB0"
FT                   /protein_id="ABD99425.1"
FT                   /translation="MKNKTVRLLAVELLTRVESQGTYSNLALNKVIEENNFSVKDTKLL
FT                   TTIVYGVIQHKLTLEYWLEPFIKKANKLQLWVKELLLVSLYQMVYLDKIPDRAVFNESI
FT                   EIAKIKGHTGIRKFVTGVLHSIRRNGLREVNEIDNDITRLSIGTSTPEWLVEELIKELG
FT                   ITKVESILDTINTSPKHSVRINTHKVNKQILVNELKNDGYTIRESEVTPDALIVDGGFL
FT                   PKSSEFRNGKMIIQDESAMLAVESMDIQKDDIVLDACAAPGGKTTQIAEKLMKGEGKVW
FT                   ALDIHKHKVKLIEENANKLGLISKVSAKQLDARKAITEFDSEKFDKILVDAPCSGLGLM
FT                   RRKPEVKYEKKLADSYSLHDIQVNILEKVAPLLKKGGYLTYSTCTILNIENQKVIDDFL
FT                   KKHPEFVQEKTYTKNKLKDERDTLSLTIYPDDYMSDGFFIATLRKK"
FT   gene            658506..659249
FT                   /locus_tag="LSL_0616"
FT   CDS_pept        658506..659249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0616"
FT                   /product="Protein phosphatase 2C"
FT                   /EC_number="3.1.3.16"
FT                   /note="COG0631 [T] Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99426"
FT                   /db_xref="GOA:Q1WUA9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA9"
FT                   /protein_id="ABD99426.1"
FT                   /translation="MEIAYLSDLGKMRKNNEDYVGKFVNKAGAVMVIVADGLGGHNGGE
FT                   VASEMAVSHLGYYFSETSFFSISQASTWLSKKVDEENSLILKNSLHYKDLRGMGTTLVV
FT                   AIIFEQEFLLAHIGDSRGYILEKGNLTRVTEDHSLVNELIKEGELSPEEAEHHPKKNII
FT                   TRSLGISKNSELDEEFFQITKNSILMLCTDGLTNMVEDTKLERLLNISESLPDKCQRLV
FT                   DEANRAGGNDNISVLLVSFDEEVKY"
FT   gene            659249..660952
FT                   /pseudo
FT                   /locus_tag="LSL_0616b"
FT   misc_feature    659249..660952
FT                   /pseudo
FT                   /locus_tag="LSL_0616b"
FT                   /note="Similar to serine/threonine protein kinase
FT                   2.7.1.37); nonfunctional due to truncation"
FT   gene            661023..661913
FT                   /locus_tag="LSL_0617"
FT   CDS_pept        661023..661913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0617"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG1160 [R] Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99427"
FT                   /db_xref="GOA:Q1WUA8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA8"
FT                   /protein_id="ABD99427.1"
FT                   /translation="MTTKGRIKQSLSGYYDVLVEDKEYRTRARGNFRKKKMTPVVGDWV
FT                   DFKIDDNGDGYILKIYPRKNQLVRPPIANIDTAIVVSACVEPDFSPNLLDRQLVMLESN
FT                   NVRPVLFFSKADLLNQEQREKFESYFNYYSKYYSCYISFENENRQNVLNNLMCDLTNEI
FT                   VVVMGQTGAGKSTLLNDLKPDLNLETGKISKALSRGKHTTRKVTLLDINGVMIADTPGF
FT                   SSFELLNITKDTLPLMYPDFVKYQDNCKFRGCLHLKEPKCAVKDAVNKGEILENRYINY
FT                   VQFQDMLANKKVRYK"
FT   gene            661910..662572
FT                   /locus_tag="LSL_0618"
FT   CDS_pept        661910..662572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0618"
FT                   /product="Thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /note="COG1564 [H] Thiamine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99428"
FT                   /db_xref="GOA:Q1WUA7"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA7"
FT                   /protein_id="ABD99428.1"
FT                   /translation="MMDNEMIINILVGGPCEELPENFWKSSFSEDHWIGADKGAVDLVK
FT                   HHQSLLFAVGDFDSSSEEEIELVKENVPELITFKPEKDYTDTELSVKLAIDKYHPKKIT
FT                   IYGATGGRIDHLLANIMFVLKPEFRFYADKIKIIDRRNIINFFLPGKYTINKEENFDYL
FT                   AFIPLEKIKNLNLYDEKYKLNNANYTYPIALASNEFVGDKASFSFESGLLCVIQSKD"
FT   gene            complement(662644..662829)
FT                   /gene="rpmB"
FT                   /locus_tag="LSL_0619"
FT   CDS_pept        complement(662644..662829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="LSL_0619"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="COG0227 [J] Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99429"
FT                   /db_xref="GOA:Q1WUA6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUA6"
FT                   /protein_id="ABD99429.1"
FT                   /translation="MAKDFVTGRKTTFGKKRSHALNQTNRSWKPNLQKVRILVDGKPKK
FT                   VWVSTRALKSGKVTRV"
FT   gene            663094..663456
FT                   /locus_tag="LSL_0620"
FT   CDS_pept        663094..663456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0620"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99430"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA5"
FT                   /protein_id="ABD99430.1"
FT                   /translation="MAVKIQNQLGNIDISNDVIATVVGGAATEIFGIVGMASKNQIRDN
FT                   LNEILRRDNYSKGVVVRQQEDGVAIDVYIIAGYGTKISEVCRNVQSKVKYNLESMLGVK
FT                   AESVNVIVQGVRVIGD"
FT   gene            663499..665199
FT                   /locus_tag="LSL_0621"
FT   CDS_pept        663499..665199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0621"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1461 [R] Predicted kinase related to
FT                   dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99431"
FT                   /db_xref="GOA:Q1WUA4"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA4"
FT                   /protein_id="ABD99431.1"
FT                   /translation="MKVAKITESEFRKMVLTSSNKLNKNAEFINSLNVFPVPDGDTGTN
FT                   MSLSLASGYKYVSESTSTKVGDLGIALAKGLLMGARGNSGVILSQIFRGFSKSMAKKEN
FT                   LTAQDLADAITSGVETAYKAVMKPTEGTILTVARKAAEAARNTVKNTDDCVEVMEATYE
FT                   AAKQALATTPELLPVLKEVGVVDSGGQGLTFVYEGFYEALSGNITDDEHVPNVEEMDEM
FT                   VNAEHHKSVQSQLHTEDIKYGYCTEIMVKLGAGRLVDQEFEYDKFRNHLAEIGDSLLVI
FT                   ADDEVVKVHVHTEHPGKVLSYGQEFGSLIKVKVDNMRLQHETILEKDEDNNKDDVEAKK
FT                   LADARKNAGDYGILTVVSGKGLKDLFISLGATDILDGGQTMNPSTQDFVDIISASSAKK
FT                   FIIFPNNKNIFLAAKQATELVDIPVKVVQSRSVLEGLSGIFAFNPDMDLEDNVTDMEEN
FT                   ISSVKSGQVTIAVRDTTLNGKEIKKDDYMGIVDGDITVTASDSKTAAISMVESMLDDDS
FT                   EVVTIIYGEDGNEAEAKEIEQAILDIDDDLEVEIHEGDQPVYPYLISVE"
FT   gene            665280..667310
FT                   /gene="recG"
FT                   /locus_tag="LSL_0622"
FT   CDS_pept        665280..667310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="LSL_0622"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG1200 [LK] RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99432"
FT                   /db_xref="GOA:Q1WUA3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA3"
FT                   /protein_id="ABD99432.1"
FT                   /translation="MNLGDSVGVLRGVGPKKIQALNKLGVNTIEDLLTFYPFRYNDIAV
FT                   KNLEEINSQEKVTLKGIVASEPVLVRFGRKKSRLNFKLLINHDVIGVTFFNQPWISKQV
FT                   TTGQELAVYGKYDALRQSLSGIKIISRKTNDFVGVYRSSKDIKESIIKQLVKQAYDEYN
FT                   SYIKDVVPESIRIKYRLENRKQMIHDIHFPSTKKEADLARRSAIFDEFFSFEAGLQLLK
FT                   RDNHKNMGLRIKYNNEKLKEFIKGLPFELTKAQKRVVNEICADMLSPNHMNRLLQGDVG
FT                   SGKTIIAAIAMYATVTAGFQAVLMAPTEILAQQHAEKLANLFEQYGISVALMTSSSLSR
FT                   VKVKRELLKHLKNGDIDIVIGTHAVIQDNIEFHNLGLAITDEQHRFGVNQRRILRKKGV
FT                   NPEILAMTATPIPRTLAITTYGEMDVSIIDELPKGRQPVKTSWVKKKQVKNVFEFVKRQ
FT                   LELGTQAYIISPLVEESELLDLQNAEEVFEKAKEYFGSEKVALLHGKMDANEKEQAMQA
FT                   FKNKEVSILVSTTVIEVGVDVPNATVMIILDADRFGLAQLHQLRGRVGRGSKESYCILV
FT                   ADPKSEYGKERMKIMTETNDGFLISQKDLELRGPGEVLGKKQSGLPEFKVGDPVVNLNI
FT                   LQVAQEEAHNVVFSPNFETKEENFELIKYLNRQFAQEEIID"
FT   gene            667323..668324
FT                   /gene="plsX"
FT                   /locus_tag="LSL_0623"
FT   CDS_pept        667323..668324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="LSL_0623"
FT                   /product="Fatty acid/phospholipid synthesis protein"
FT                   /note="COG0416 [I] Fatty acid/phospholipid biosynthesis
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99433"
FT                   /db_xref="GOA:Q1WUA2"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUA2"
FT                   /protein_id="ABD99433.1"
FT                   /translation="MKKIAVDAMGGDFAPQSVVEGVEKARNKYPDLRFMLFGDEQKIRE
FT                   ILTSDKNIEIIQTTEVIDMNDEPVKAIRRKKDSSLVRAAYAVKEGKADALFSCGNTGAL
FT                   LAAGLLIVGRIKGITRPGLLSTLPVLTKEGGAFNLLDSGANADNKPEQLYQYALLGKYY
FT                   AESVRNIKNPRIGLLNNGTEPHKGSKLTLEAHNLIAADSSINFVGNVESKDILKGVCDV
FT                   VVADGFTGNAVLKAIEGTAGTAMHLLKDTIMSAGLLGKIGGLLLKPSIMKIRNKMSASQ
FT                   YGGAVLLGAKAPVVKAHGASDAETVYYTVKQINDMLENDMLSKFTDYFNKNV"
FT   gene            668401..668643
FT                   /gene="acpP"
FT                   /locus_tag="LSL_0624"
FT   CDS_pept        668401..668643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LSL_0624"
FT                   /product="Acyl carrier protein"
FT                   /note="COG0236 [IQ] Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99434"
FT                   /db_xref="GOA:Q1WUA1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WUA1"
FT                   /protein_id="ABD99434.1"
FT                   /translation="MSEKEIFEKISEIIEDRFEIKADEITENLNFQEDLDADSIDIVEF
FT                   VLELEDVFGAEIPDEDAENIHTVGDAVKYIYSHQG"
FT   gene            668797..669495
FT                   /gene="rnc"
FT                   /locus_tag="LSL_0625"
FT   CDS_pept        668797..669495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="LSL_0625"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571 [K] dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99435"
FT                   /db_xref="GOA:Q1WUA0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WUA0"
FT                   /protein_id="ABD99435.1"
FT                   /translation="MIEGLQEMLKRDFNITFKDVDLLDAAFTHASYVNETPERKKKLKY
FT                   YERIEFLGDAVMQLCVSEYIYEHYPEMPEGKMSRLRAAMVRADSFSKFAIECHFNEYIR
FT                   LGKGEEKGNARQRPSLLCDIFESFIGALYLDQGKDEVVRFISKVIFPKLELGWFDHMMD
FT                   NKTELQEVLQQNGECKIKYNEVNVTGPDNERVYTMNVVVNNEVMGEGTGRTKKAAEQMA
FT                   AYQALKKLRK"
FT   gene            669510..673046
FT                   /gene="smc"
FT                   /locus_tag="LSL_0626"
FT   CDS_pept        669510..673046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="LSL_0626"
FT                   /product="Chromosome partition protein"
FT                   /note="COG1196 [D] Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99436"
FT                   /db_xref="GOA:Q1WU99"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WU99"
FT                   /protein_id="ABD99436.1"
FT                   /translation="MKIKSLTLNGFKSFANKTIINFQDGLTGIVGPNGSGKSNITEALR
FT                   WVLGEQSVKNLRGSKMPDIIFAGSDTRAALNRAEVTLVLDNEDGYLYNQPNEIRITRRI
FT                   FRSGDSEFFINEKKVRLKDVVDLFIDTGLGRESFSIISQGRVESIFNSKPQDRRILIEE
FT                   VAGVLKYKKEKKKAESELVETTEHLKRVADILSELSRQRDPLAQQASKAKDYLSQKEQY
FT                   DLLNRDRLVLEITQKSSEKEQKESELQKVIKILSDKERMTSEQSKQVEVLHSRQKKLES
FT                   LIDNEQNELTELVRQEEKISGQQNMSRQEEKFQKERLSELQEQYSANLDNLTEIRTGKQ
FT                   SVKEKIANLEDDREKLSKKILELEKIIDNVKEPEEILEKLKSELNRKIQEKNLVNNSNN
FT                   YIEQELEEKSQNQAETNKNIQNITNEKNKLKLQLDELKTTLNNKDNEYQEIVTTLKELK
FT                   IKEVELSKKDSELKNNRNKAWDIYQRVQTKLETLKSISDSYTGYYQGAREVLKERKNIS
FT                   GIIGSVAEEFVIPKEYAQAMEVALGGHLQDIIVTDENVAKKVIQHLTYNRLGRATFLPQ
FT                   KAVKARMLNKQYRVTLESLDGYVGIASELVKVSKENLKVSQNLLGTTVIAKNIDFATEI
FT                   AKKLNYGVRIVSLNGDVVNPGGAITGGAVKQKKSGLLEQKLQIEDLQSDIEVMKKKLED
FT                   MKIYWGKVHEEYKKIQDKIDTLQVKKNRLQTDRDKYRRKFELIKIENEHQSIKLKELKE
FT                   SSKYTNIEILSQNLEENKEKLHSLTKEIDSLEQLITQKAKAEEHNSYSIEKQREEISSY
FT                   KQREAVIIEQLRGLKLQLQELMTQEENISELLKKQQDAIAKIKNKEKIALSAKEDIKDK
FT                   QEYIRNTIDSIKKKLKDAQEERKQLHIEVKEAEKQLTRANELQRSAYEEQKKLSIRISQ
FT                   CDTILDRNLKDLSENYGVTFEEVEHQISEKDLNTIEKKLKLLKLGLDELGVVNIGAISE
FT                   YERVNERYEFLNSQQNDLLSAKEQLEVSMNEMDLEVKNRFQKTFEQVSKAFSEVFPIMF
FT                   SGGYAKLSLTNPENILETGIEIMAQPPGKKLQQLSLLSGGERALTAITLLFAILKVRPV
FT                   PFVILDEAEAALDDTNVARYAQYLQKFDNETQFIVITHRKGTMVNADVLYGVTMQESGV
FT                   SQIVSVALDNID"
FT   gene            673058..674329
FT                   /gene="ftsY"
FT                   /locus_tag="LSL_0627"
FT   CDS_pept        673058..674329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="LSL_0627"
FT                   /product="Cell division protein"
FT                   /note="COG0541 [U] Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99437"
FT                   /db_xref="GOA:Q1WU98"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WU98"
FT                   /protein_id="ABD99437.1"
FT                   /translation="MGLFDRIRKAFSSQDDEEKIKQETVDNDEESMKSKENSSDSDSDV
FT                   VSEEKTSKDVDQSVDSQEKNSDESEEDNDEILDSNGDNSEFVEEENSNDSSEQNDNLKV
FT                   EEKVSSDEEERYDKGLEKSRKGFGAMINSLLANFRHVDEDFFEELEETLIEADVGFETA
FT                   MKISDELRQEVKLRNAKKKNEISDAIIEKLVEIYENEGKEEDNNLHFSSEGPTVFLFVG
FT                   VNGVGKTTTIGKLAHRYKMEGKKVMLAAADTFRAGAIEQLAEWGRRVGVTVVKKVEKSD
FT                   PAAVVFDAVKKAKEEDYDILLVDTAGRLQNKVNLMKELEKIARVITREIPDAPHEVLLA
FT                   LDATTGQNALTQAKQFKDVTNVTGIVLTKLDGTAKGGIVLAIRNELHLPVKLVGLGEKM
FT                   DDLRDFSPEEYVVGLFKGLVTPSK"
FT   gene            674348..674686
FT                   /locus_tag="LSL_0628"
FT   CDS_pept        674348..674686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0628"
FT                   /product="Signal recognition particle associated protein"
FT                   /note="COG0718 [S] Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99438"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WU97"
FT                   /protein_id="ABD99438.1"
FT                   /translation="MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENY
FT                   EVSRQAVYDNIRRTEKILEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRI
FT                   NRLESLEE"
FT   gene            674693..676141
FT                   /gene="ffh"
FT                   /locus_tag="LSL_0629"
FT   CDS_pept        674693..676141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="LSL_0629"
FT                   /product="Signal recognition particle protein"
FT                   /note="COG0541 [U] Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99439"
FT                   /db_xref="GOA:Q1WU96"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WU96"
FT                   /protein_id="ABD99439.1"
FT                   /translation="MAIVAFEGLTERLQNAIGKLRRKGKISESDVKEVMREIRLALLEA
FT                   DVNFKVVKDFVKTVRSRAIGAEVLESLTPAQQIVKIVNEELVKVMGEEAAPLNKSAKIP
FT                   TIIMMVGLQGAGKTTTASKLANKLKKEKNARPFMIAADVYRPAAIDQLKILGKDIDVPV
FT                   FSLGVDVDPVEIVRQGLEEAKDKKNDYVIIDTAGRLQIDEKLMQELSSIKELAQPDEIL
FT                   LTVDAMTGQNAVEVAKGFNDQLDVTGVVLTKLDGDTRGGAALSIRAVTGKPIKFIGQGE
FT                   KMTDLDVFYPDRMASRILGMGDMLTLIEKAQQEYDQKQAEELAEKMRENNFDFNDFLIQ
FT                   MEQVQNMGPMEDIIKMIPGMANNPALKNLKVDPKDIEHTKAIVYSMTPQERENPDLLNP
FT                   SRRRRIAAGSGRPIQEVNRMIKQFKQMQDMMKKMSNGNFSGMEGLLGGGMQGKLAKMSM
FT                   NRMIRKNKKLKQKKLKKLLKRKGK"
FT   gene            676236..676511
FT                   /gene="rpsP"
FT                   /locus_tag="LSL_0630"
FT   CDS_pept        676236..676511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="LSL_0630"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="COG0228 [J] Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99440"
FT                   /db_xref="GOA:Q1WU95"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WU95"
FT                   /protein_id="ABD99440.1"
FT                   /translation="MSVKIRLKRMGSKKRPFYRIVVADSRSPRDGRFIETVGTYNPLTD
FT                   PETVTLKEEKVMNWLNNGAQPSDTVRNILSRNGVMKKFHEAKFSKK"
FT   gene            676521..676766
FT                   /locus_tag="LSL_0631"
FT   CDS_pept        676521..676766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0631"
FT                   /product="RNA binding protein"
FT                   /note="COG1837 [R] Predicted RNA-binding protein (contains
FT                   KH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99441"
FT                   /db_xref="GOA:Q1WU94"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WU94"
FT                   /protein_id="ABD99441.1"
FT                   /translation="MTETDVKQLILTIVQPLVAEPDEVKIETEQDDYFLNFNLSVSKED
FT                   VGRVIGKHGRIAQAIRNIVYGIRLDNNLKVRLNIVD"
FT   gene            676851..677357
FT                   /gene="rimM"
FT                   /locus_tag="LSL_0632"
FT   CDS_pept        676851..677357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="LSL_0632"
FT                   /product="16S rRNA processing protein"
FT                   /note="COG0806 [J] RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99442"
FT                   /db_xref="GOA:Q1WU93"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WU93"
FT                   /protein_id="ABD99442.1"
FT                   /translation="MNYYEVGKIVNTHGIKGELKIISKTDFPEDRFKPGNILYIRDNGK
FT                   INSYEIKSHRTHKQFEMITFKGLENINLVENLKGKILEISEEQQENLSDGNYYHHQIIG
FT                   LDVFSEDNNYIGVIKEIMSPGANDVWVVKRKGSSDLLLPAIKDVIKKIDLEQNKVIIEL
FT                   LDGLD"
FT   gene            677360..678112
FT                   /gene="trmD"
FT                   /locus_tag="LSL_0633"
FT   CDS_pept        677360..678112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="LSL_0633"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 [J] tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99443"
FT                   /db_xref="GOA:Q1WU92"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1WU92"
FT                   /protein_id="ABD99443.1"
FT                   /translation="MKIDILSLFPEMFGPLTESIVGKAVEKDILDIEVTNFRDFTTNKQ
FT                   NHVDDYPYGGGAGMLLQAQPIYDALDNIEEKNGNLGRVILLDPAGRKFDQSVAEELSKE
FT                   DHLTFICGHYEGYDERIRAKVTDEISLGDFVLTGGELGAMVVIDATVRLLPDVLGNNES
FT                   ASGDSFSMGLLEYPQYTRPSNFRGMEVPEVLLSGNHQKIAEWRKKESLRRTYQRRPDLL
FT                   EEYEFSDKEKEWLREFERDKDVKIHGKG"
FT   gene            678099..678695
FT                   /locus_tag="LSL_0634"
FT   CDS_pept        678099..678695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSL_0634"
FT                   /product="Phosphinothricin N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1247 [M] Sortase and related acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:LSL_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD99444"
FT                   /db_xref="GOA:Q1WU91"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WU91"
FT                   /protein_id="ABD99444.1"
FT                   /translation="MEKAKIRLVNLNDAERILQIYRPYVENT