(data stored in SCRATCH3701 zone)

EMBL: CP000236

ID   CP000236; SV 1; circular; genomic DNA; STD; PRO; 1176248 BP.
XX
AC   CP000236;
XX
PR   Project:PRJNA325;
XX
DT   23-FEB-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Ehrlichia chaffeensis str. Arkansas, complete genome.
XX
KW   .
XX
OS   Ehrlichia chaffeensis str. Arkansas
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Anaplasmataceae; Ehrlichia.
XX
RN   [1]
RC   Erratum:[PLoS Genet. 2006 Dec;2(12):e213. Eisen, Jonathan [corrected to
RC   Eisen, Jonathan A]]
RP   1-1176248
RX   DOI; 10.1371/journal.pgen.0020021.
RX   PUBMED; 16482227.
RA   Hotopp J.C., Lin M., Madupu R., Crabtree J., Angiuoli S.V., Eisen J.A.,
RA   Seshadri R., Ren Q., Wu M., Utterback T.R., Smith S., Lewis M., Khouri H.,
RA   Zhang C., Niu H., Lin Q., Ohashi N., Zhi N., Nelson W., Brinkac L.M.,
RA   Dodson R.J., Rosovitz M.J., Sundaram J., Daugherty S.C., Davidsen T.,
RA   Durkin A.S., Gwinn M., Haft D.H., Selengut J.D., Sullivan S.A., Zafar N.,
RA   Zhou L., Benahmed F., Forberger H., Halpin R., Mulligan S., Robinson J.,
RA   White O., Rikihisa Y., Tettelin H.;
RT   "Comparative genomics of emerging human ehrlichiosis agents";
RL   PloS Genet. 2(2):E21-E21(2006).
XX
RN   [2]
RP   1-1176248
RA   Hotopp J.D., Lin M., Madupu R., Crabtree J., Angiuoli S.V., Eisen J.A.,
RA   Seshadri R., Ren Q., Wu M., Utterback T.R., Smith S., Lewis M.R.,
RA   Khouri H.M., Zhang C., Hua N., Lin Q., Ohashi N., Zhi N., Nelson W.C.,
RA   Brinkac L.M., Dodson R.J., Rosovitz M., Sundaram J., Daugherty S.C.,
RA   Davidsen T.M., Durkin A.S., Gwinn M.L., Haft D.H., Selengut J.,
RA   Sullivan S.A., Zafar N., Zhou L., Benahmed F., Forberger H.A., Halpin R.,
RA   Mulligan S., Robinson J.M., Rikihisa Y., Tettelin H.;
RT   ;
RL   Submitted (13-DEC-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; a9ee4f6c356cd1d6261fc33a7683134f.
DR   BioSample; SAMN02604010.
DR   EnsemblGenomes-Gn; EBG00001152425.
DR   EnsemblGenomes-Gn; EBG00001152426.
DR   EnsemblGenomes-Gn; EBG00001152427.
DR   EnsemblGenomes-Gn; EBG00001152428.
DR   EnsemblGenomes-Gn; EBG00001152429.
DR   EnsemblGenomes-Gn; EBG00001152430.
DR   EnsemblGenomes-Gn; EBG00001152431.
DR   EnsemblGenomes-Gn; EBG00001152432.
DR   EnsemblGenomes-Gn; EBG00001152433.
DR   EnsemblGenomes-Gn; EBG00001152434.
DR   EnsemblGenomes-Gn; EBG00001152435.
DR   EnsemblGenomes-Gn; EBG00001152436.
DR   EnsemblGenomes-Gn; EBG00001152437.
DR   EnsemblGenomes-Gn; EBG00001152438.
DR   EnsemblGenomes-Gn; EBG00001152439.
DR   EnsemblGenomes-Gn; EBG00001152440.
DR   EnsemblGenomes-Gn; EBG00001152441.
DR   EnsemblGenomes-Gn; EBG00001152442.
DR   EnsemblGenomes-Gn; EBG00001152443.
DR   EnsemblGenomes-Gn; EBG00001152444.
DR   EnsemblGenomes-Gn; EBG00001152445.
DR   EnsemblGenomes-Gn; EBG00001152446.
DR   EnsemblGenomes-Gn; EBG00001152447.
DR   EnsemblGenomes-Gn; EBG00001152448.
DR   EnsemblGenomes-Gn; EBG00001152449.
DR   EnsemblGenomes-Gn; EBG00001152450.
DR   EnsemblGenomes-Gn; EBG00001152451.
DR   EnsemblGenomes-Gn; EBG00001152452.
DR   EnsemblGenomes-Gn; EBG00001152453.
DR   EnsemblGenomes-Gn; EBG00001152454.
DR   EnsemblGenomes-Gn; EBG00001152455.
DR   EnsemblGenomes-Gn; EBG00001152456.
DR   EnsemblGenomes-Gn; EBG00001152457.
DR   EnsemblGenomes-Gn; EBG00001152458.
DR   EnsemblGenomes-Gn; EBG00001152459.
DR   EnsemblGenomes-Gn; EBG00001152460.
DR   EnsemblGenomes-Gn; EBG00001152461.
DR   EnsemblGenomes-Gn; EBG00001152462.
DR   EnsemblGenomes-Gn; EBG00001152463.
DR   EnsemblGenomes-Gn; EBG00001152464.
DR   EnsemblGenomes-Gn; EBG00001152465.
DR   EnsemblGenomes-Gn; EBG00001152466.
DR   EnsemblGenomes-Gn; EBG00001152467.
DR   EnsemblGenomes-Gn; EBG00001152468.
DR   EnsemblGenomes-Gn; ECH_0019.
DR   EnsemblGenomes-Gn; ECH_0022.
DR   EnsemblGenomes-Gn; ECH_0046.
DR   EnsemblGenomes-Gn; ECH_0066.
DR   EnsemblGenomes-Gn; ECH_0090.
DR   EnsemblGenomes-Gn; ECH_0096.
DR   EnsemblGenomes-Gn; ECH_0151.
DR   EnsemblGenomes-Gn; ECH_0164.
DR   EnsemblGenomes-Gn; ECH_0165.
DR   EnsemblGenomes-Gn; ECH_0186.
DR   EnsemblGenomes-Gn; ECH_0209.
DR   EnsemblGenomes-Gn; ECH_0222.
DR   EnsemblGenomes-Gn; ECH_0223.
DR   EnsemblGenomes-Gn; ECH_0325.
DR   EnsemblGenomes-Gn; ECH_0405.
DR   EnsemblGenomes-Gn; ECH_0406.
DR   EnsemblGenomes-Gn; ECH_0458.
DR   EnsemblGenomes-Gn; ECH_0491.
DR   EnsemblGenomes-Gn; ECH_0534.
DR   EnsemblGenomes-Gn; ECH_0547.
DR   EnsemblGenomes-Gn; ECH_0572.
DR   EnsemblGenomes-Gn; ECH_0604.
DR   EnsemblGenomes-Gn; ECH_0647.
DR   EnsemblGenomes-Gn; ECH_0657.
DR   EnsemblGenomes-Gn; ECH_0671.
DR   EnsemblGenomes-Gn; ECH_0683.
DR   EnsemblGenomes-Gn; ECH_0729.
DR   EnsemblGenomes-Gn; ECH_0738.
DR   EnsemblGenomes-Gn; ECH_0742.
DR   EnsemblGenomes-Gn; ECH_0747.
DR   EnsemblGenomes-Gn; ECH_0812.
DR   EnsemblGenomes-Gn; ECH_0850.
DR   EnsemblGenomes-Gn; ECH_0898.
DR   EnsemblGenomes-Gn; ECH_0903.
DR   EnsemblGenomes-Gn; ECH_0904.
DR   EnsemblGenomes-Gn; ECH_0911.
DR   EnsemblGenomes-Gn; ECH_0919.
DR   EnsemblGenomes-Gn; ECH_0948.
DR   EnsemblGenomes-Gn; ECH_0959.
DR   EnsemblGenomes-Gn; ECH_1096.
DR   EnsemblGenomes-Tr; EBT00001741232.
DR   EnsemblGenomes-Tr; EBT00001741233.
DR   EnsemblGenomes-Tr; EBT00001741234.
DR   EnsemblGenomes-Tr; EBT00001741235.
DR   EnsemblGenomes-Tr; EBT00001741236.
DR   EnsemblGenomes-Tr; EBT00001741237.
DR   EnsemblGenomes-Tr; EBT00001741238.
DR   EnsemblGenomes-Tr; EBT00001741239.
DR   EnsemblGenomes-Tr; EBT00001741240.
DR   EnsemblGenomes-Tr; EBT00001741241.
DR   EnsemblGenomes-Tr; EBT00001741242.
DR   EnsemblGenomes-Tr; EBT00001741243.
DR   EnsemblGenomes-Tr; EBT00001741244.
DR   EnsemblGenomes-Tr; EBT00001741245.
DR   EnsemblGenomes-Tr; EBT00001741246.
DR   EnsemblGenomes-Tr; EBT00001741247.
DR   EnsemblGenomes-Tr; EBT00001741248.
DR   EnsemblGenomes-Tr; EBT00001741249.
DR   EnsemblGenomes-Tr; EBT00001741250.
DR   EnsemblGenomes-Tr; EBT00001741251.
DR   EnsemblGenomes-Tr; EBT00001741252.
DR   EnsemblGenomes-Tr; EBT00001741253.
DR   EnsemblGenomes-Tr; EBT00001741254.
DR   EnsemblGenomes-Tr; EBT00001741255.
DR   EnsemblGenomes-Tr; EBT00001741256.
DR   EnsemblGenomes-Tr; EBT00001741257.
DR   EnsemblGenomes-Tr; EBT00001741258.
DR   EnsemblGenomes-Tr; EBT00001741259.
DR   EnsemblGenomes-Tr; EBT00001741260.
DR   EnsemblGenomes-Tr; EBT00001741261.
DR   EnsemblGenomes-Tr; EBT00001741262.
DR   EnsemblGenomes-Tr; EBT00001741263.
DR   EnsemblGenomes-Tr; EBT00001741264.
DR   EnsemblGenomes-Tr; EBT00001741265.
DR   EnsemblGenomes-Tr; EBT00001741266.
DR   EnsemblGenomes-Tr; EBT00001741267.
DR   EnsemblGenomes-Tr; EBT00001741268.
DR   EnsemblGenomes-Tr; EBT00001741269.
DR   EnsemblGenomes-Tr; EBT00001741270.
DR   EnsemblGenomes-Tr; EBT00001741271.
DR   EnsemblGenomes-Tr; EBT00001741272.
DR   EnsemblGenomes-Tr; EBT00001741273.
DR   EnsemblGenomes-Tr; EBT00001741274.
DR   EnsemblGenomes-Tr; EBT00001741275.
DR   EnsemblGenomes-Tr; ECH_0019-1.
DR   EnsemblGenomes-Tr; ECH_0022-1.
DR   EnsemblGenomes-Tr; ECH_0046-1.
DR   EnsemblGenomes-Tr; ECH_0066-1.
DR   EnsemblGenomes-Tr; ECH_0090-1.
DR   EnsemblGenomes-Tr; ECH_0096-1.
DR   EnsemblGenomes-Tr; ECH_0151-1.
DR   EnsemblGenomes-Tr; ECH_0164-1.
DR   EnsemblGenomes-Tr; ECH_0165-1.
DR   EnsemblGenomes-Tr; ECH_0186-1.
DR   EnsemblGenomes-Tr; ECH_0209-1.
DR   EnsemblGenomes-Tr; ECH_0222-1.
DR   EnsemblGenomes-Tr; ECH_0223-1.
DR   EnsemblGenomes-Tr; ECH_0325-1.
DR   EnsemblGenomes-Tr; ECH_0405-1.
DR   EnsemblGenomes-Tr; ECH_0406-1.
DR   EnsemblGenomes-Tr; ECH_0458-1.
DR   EnsemblGenomes-Tr; ECH_0491-1.
DR   EnsemblGenomes-Tr; ECH_0534-1.
DR   EnsemblGenomes-Tr; ECH_0547-1.
DR   EnsemblGenomes-Tr; ECH_0572-1.
DR   EnsemblGenomes-Tr; ECH_0604-1.
DR   EnsemblGenomes-Tr; ECH_0647-1.
DR   EnsemblGenomes-Tr; ECH_0657-1.
DR   EnsemblGenomes-Tr; ECH_0671-1.
DR   EnsemblGenomes-Tr; ECH_0683-1.
DR   EnsemblGenomes-Tr; ECH_0729-1.
DR   EnsemblGenomes-Tr; ECH_0738-1.
DR   EnsemblGenomes-Tr; ECH_0742-1.
DR   EnsemblGenomes-Tr; ECH_0747-1.
DR   EnsemblGenomes-Tr; ECH_0812-1.
DR   EnsemblGenomes-Tr; ECH_0850-1.
DR   EnsemblGenomes-Tr; ECH_0898-1.
DR   EnsemblGenomes-Tr; ECH_0903-1.
DR   EnsemblGenomes-Tr; ECH_0904-1.
DR   EnsemblGenomes-Tr; ECH_0911-1.
DR   EnsemblGenomes-Tr; ECH_0919-1.
DR   EnsemblGenomes-Tr; ECH_0948-1.
DR   EnsemblGenomes-Tr; ECH_0959-1.
DR   EnsemblGenomes-Tr; ECH_1096-1.
DR   EuropePMC; PMC1366493; 16482227.
DR   EuropePMC; PMC1914354; 17584494.
DR   EuropePMC; PMC1932932; 17438035.
DR   EuropePMC; PMC2786583; 19946141.
DR   EuropePMC; PMC2825951; 20065028.
DR   EuropePMC; PMC2913319; 20030996.
DR   EuropePMC; PMC3167834; 21915290.
DR   EuropePMC; PMC3322032; 20202419.
DR   EuropePMC; PMC3546050; 23335965.
DR   EuropePMC; PMC3573109; 23459099.
DR   EuropePMC; PMC4003554; 23276749.
DR   EuropePMC; PMC4089936; 24984562.
DR   EuropePMC; PMC4313244; 25143580.
DR   EuropePMC; PMC4505860; 26186429.
DR   EuropePMC; PMC4734531; 26811941.
DR   EuropePMC; PMC4938664; 27194801.
DR   EuropePMC; PMC5693922; 29150636.
DR   EuropePMC; PMC5906474; 29670161.
DR   EuropePMC; PMC6431617; 30937288.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000236.
DR   SILVA-SSU; CP000236.
DR   StrainInfo; 302444; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1176248
FT                   /organism="Ehrlichia chaffeensis str. Arkansas"
FT                   /strain="Arkansas"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:205920"
FT   gene            2..847
FT                   /locus_tag="ECH_0001"
FT   CDS_pept        2..847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0001"
FT                   /product="chromosome partitioning protein, ParB family"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44773"
FT                   /db_xref="GOA:Q2GI97"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI97"
FT                   /protein_id="ABD44773.1"
FT                   /translation="MTKRLGKGIFELIGNSTLEINNNISTDTHLTMPINLLNPSTSQPR
FT                   KTFNQECLKELAESISKHGIIQPIIIRKNPHKKGYEIIAGERRWRASILAKLKSVPVIV
FT                   KEISDSQCLELSIIENIQRQDLTPIEEAEAYSNLINTFSYTHEDLASIIGKSRSHITNM
FT                   IRILSLPTSIKSMINDKLISFGHARALINIENPEAIAEKIISLNLNVRQTELLIKNLQK
FT                   PHKKKSKENLTELEQSLSEILNLQIKINGLKNKGSIVIKYNNTQQLNSILEKLKKVTQT
FT                   "
FT   gene            1005..1532
FT                   /gene="rimM"
FT                   /locus_tag="ECH_0002"
FT   CDS_pept        1005..1532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="ECH_0002"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45431"
FT                   /db_xref="GOA:Q2GI96"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI96"
FT                   /protein_id="ABD45431.1"
FT                   /translation="MENDLICLGVITSSHGISGHVKIKTFTENPEDFTSYGTLTDGINT
FT                   YEVEIISIISQNIIIAQIKGIVSRTDADLLRNKKFFVEKNKLPNPTNDDEFYYSDLIGL
FT                   NVVLENNNVYGNIKKIHNFGSCDIIEIRLSNSKKSTMLPFTKDIFPYVNVKEKYIIITL
FT                   PEVIGNNSDIQR"
FT   gene            1516..2223
FT                   /gene="trmD"
FT                   /locus_tag="ECH_0003"
FT   CDS_pept        1516..2223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="ECH_0003"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44931"
FT                   /db_xref="GOA:Q2GI95"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI95"
FT                   /protein_id="ABD44931.1"
FT                   /translation="MTFNVNVLTIFPEMFPGTLSHSIIGRALNKGLWNLNVIDIRSFAK
FT                   DKHKTVDDRPYGGGPGMIMKADVIGSAIDEVLSKNKNTKLIYMSPSGIKLNQDISGQLT
FT                   HFSNITILCGRFEGIDKRILDFYDFHEISIGDYILSGGEVACMVLIETCVRLIPGVVSN
FT                   TQSIRDESFTLDYKLEYPQYTRPAKWRGLEVPDVLLSGNHKKINLWKANQSYCITKQRR
FT                   PELTGTIDGDIYE"
FT   gene            2216..2593
FT                   /gene="rplS"
FT                   /locus_tag="ECH_0004"
FT   CDS_pept        2216..2593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="ECH_0004"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by similarity to SP:P30529; match to
FT                   protein family HMM PF01245; match to protein family HMM
FT                   TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45556"
FT                   /db_xref="GOA:Q2GI94"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI94"
FT                   /protein_id="ABD45556.1"
FT                   /translation="MSDLLKEFNEQQMKLLSNKEIPKFSSGDTLRVSMKIFDGVSERLQ
FT                   VFEGVCIKRKNNGLHSSFTLRKISYNESIQLQVFLYSPIVESIEVIKFGRVRRAKLYYM
FT                   LSLFGKSARIKERSDRTKKLS"
FT   gene            complement(2852..3337)
FT                   /locus_tag="ECH_0005"
FT   CDS_pept        complement(2852..3337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0005"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain"
FT                   /note="identified by match to protein family HMM PF02464;
FT                   match to protein family HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45156"
FT                   /db_xref="GOA:Q2GI93"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI93"
FT                   /protein_id="ABD45156.1"
FT                   /translation="MIIEQEILKKAETCVSKLIENNSKIVIAESCTAGLMSFLFSCIPG
FT                   ASKVLDSSFVVYSDESKAKFLNIDKDLISKYGAVSSEVSVLMAVGVLENSKANVSVSIT
FT                   GFAGPRVGDEQVGLVYIGYASNIERDCKKYYFSDMNRCKVQMSSASAAMDFLLHKMK"
FT   gene            3683..5584
FT                   /gene="thrS"
FT                   /locus_tag="ECH_0006"
FT   CDS_pept        3683..5584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="ECH_0006"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by similarity to SP:P00955; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF02824; match to protein family HMM PF03129; match to
FT                   protein family HMM PF07973; match to protein family HMM
FT                   TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44575"
FT                   /db_xref="GOA:Q2GI92"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI92"
FT                   /protein_id="ABD44575.1"
FT                   /translation="MINIHFSNNLCKQFHRGIKGHDIVNDLFPKLKNETIAAKVNGELY
FT                   DLSREIIENCTFEVITINSEEGLEIIRHDTAHIMAQAVKEMFPDVQITIGPTIKDGFYY
FT                   DFATNHNFSSDDLEIIEKKMIEIINKNESFIREVWSREEAIKFFSSIGEDYKVKIISNI
FT                   PSNENITVYKQGSFTDLCRGPHAPSTKTSRAFKLTKVSGSYWQGNSNNERLQRIYGTAW
FT                   RNEEELKLYLNNLIEAEKRDHRKIGRELELFHIQNEACGQIFWHTKGWTIYRIIENYIR
FT                   KKLENNGYIEVKTPILLNKELWEKSGHWDKFRENMFLSEAEDKTLAIKPMNCPCHIQIF
FT                   NSKIRSYRDLPIRMAEFGTCHRYEASGALHGLMRVRGFTQDDAHIFCTESQITSEALKF
FT                   CNLLIEIYKDFGFTDILVKFSDRPKNRAGSDEIWDKAEAALKKSVEVANLSYVLNPGDG
FT                   AFYGPKLEFTLKDAIGREWQCGTLQMDFVLPERLGAYYIGSDGKKHHPVMLHRAILGTF
FT                   ERFIGILIEHHSGKFPMWLAPIQLSILTISEDSINYANSLKIKAEEHNIRVELDTTNEK
FT                   INYKIRNHIHKKVPVFWIVGKKEVEENSVSIRYLESNKQHVMPIDKALKTLLTCASI"
FT   gene            5609..6130
FT                   /gene="infC"
FT                   /locus_tag="ECH_0007"
FT   CDS_pept        5609..6130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="ECH_0007"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by similarity to SP:P03000; match to
FT                   protein family HMM PF00707; match to protein family HMM
FT                   PF05198; match to protein family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45086"
FT                   /db_xref="GOA:Q2GI91"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI91"
FT                   /protein_id="ABD45086.1"
FT                   /translation="MKTKKFSNKNKINEMITAKKVKLVDQNSVMIGVVDIEEALSRAKA
FT                   VNLDLVEIVHDDQYPLCKIFDYSKYRYSHKKKISDSKKKQKTIIVKELKFKLNIGDNDY
FT                   NVKLNMLRGFIERGDKVKISLRFIGREILHPEVGMEIIERLIRDTADIAKPENLPKKEG
FT                   NIINMVLTAK"
FT   gene            complement(6417..6884)
FT                   /locus_tag="ECH_0008"
FT   CDS_pept        complement(6417..6884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0008"
FT                   /product="P-loop hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45213"
FT                   /db_xref="GOA:Q2GI90"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI90"
FT                   /protein_id="ABD45213.1"
FT                   /translation="MLQFKYSSVDLVFLEKLARFIALGLKKGDSISLVGDLGVGKTTFV
FT                   RFLVHALAPCEDVGSPTFSIINEYHSNKFTIYHIDLYRINSLREVYDLGIESICDDGVG
FT                   IIEWPDLLNDILDFNLKINIKYSTKENLRDVEVFIKDDDKCGIFESFVSSN"
FT   gene            complement(6904..7605)
FT                   /locus_tag="ECH_0009"
FT   CDS_pept        complement(6904..7605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0009"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44746"
FT                   /db_xref="GOA:Q2GI89"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI89"
FT                   /protein_id="ABD44746.1"
FT                   /translation="MDNYSNVQQGAYYSAGLRNYLVKVYNYMAMALGLTGIVAFFVASS
FT                   PAVISMVYNTPLHWVIVFAPMGLVFLMSYKLNVLSFQAILMIFFSFAALVGVSISYVFL
FT                   VYTAASIAKVFFISSSMFGVMAWYGNVTKKDLSQFGTFLFMGVIGIAIASLVNLFLGSG
FT                   PLHFALSVVAVVVFTGMTAYDAQRIKDMYYKFNDGTDSSVNKMAILGATTLYFNYINIF
FT                   ISLLNLQGERK"
FT   gene            complement(7674..8693)
FT                   /locus_tag="ECH_0010"
FT   CDS_pept        complement(7674..8693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44497"
FT                   /db_xref="GOA:Q2GI88"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI88"
FT                   /protein_id="ABD44497.1"
FT                   /translation="MSVEGRMFGEDRRQLEQYEGISRGDIQRKLYNSMLLKLDRQDLIR
FT                   KKIVMVTSVLYFVVFVSFAVMQSGVLDLTQNQLTLFANFMDYLALFLCVTFLIAGLYNV
FT                   LYLEREKRKVNEKLKRISQDQFDERVNPTSIKFANFCETHANKFDLAGTFCTTIMQAIA
FT                   VFSLTLPAIFDVSKIPVDTAFNLQGIVDTVGNILFTIAAGMFLCSYMIKCNKNKNKDGK
FT                   STYSVAQSLVLTSLFFGTFLILAGKVLLSFETRGGAMYTGVLGPLGMDAFPMALIVRAV
FT                   GMAIFCFGYGLMLYMSTQQHDKLSNEVRNGLPKGASVNSNMQDVEQICCETRHLLQDS"
FT   gene            8881..9888
FT                   /gene="gap"
FT                   /locus_tag="ECH_0011"
FT   CDS_pept        8881..9888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="ECH_0011"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to SP:O34425; match to
FT                   protein family HMM PF00044; match to protein family HMM
FT                   PF02800; match to protein family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44917"
FT                   /db_xref="GOA:Q2GI87"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI87"
FT                   /protein_id="ABD44917.1"
FT                   /translation="MKIGINGLGRIGRCLIRAIYENELLYKHKIELSALNGSTSPETHA
FT                   HLIQYDSVHGKFPHNVTSEEGYIIINDKKIPLSTEKEPKSIPWEKHNVDIVLECTGKFN
FT                   KKSLAEQHINSTVKKVLVSAPMQDSDATIVYGVNNEMLKKEHNIISAGSCTTNCIAPIL
FT                   KIMNDTIGINNGFMTTIHSYTNDQNLVDNNHKDVRRARACMMSIIPTTTGATKTIDLII
FT                   PELKGKLNGTAVRVPTANVSMVDLVFNSIKSTTANEINDIIKNSSQNSKVINITDKKLV
FT                   SIDFCHSTYSSIVDADETYVTNNNLCRIAAWYDNEWAFAMRMLDIVLLLSENHI"
FT   gene            complement(10164..10829)
FT                   /locus_tag="ECH_0012"
FT   CDS_pept        complement(10164..10829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0012"
FT                   /product="Es1 family protein"
FT                   /note="identified by similarity to SP:P26428; match to
FT                   protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45436"
FT                   /db_xref="GOA:Q2GI86"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:3L3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI86"
FT                   /protein_id="ABD45436.1"
FT                   /translation="MALNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKN
FT                   QKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSN
FT                   LFDEDKENDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGEDSNG
FT                   LIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYLKSK"
FT   gene            10949..11758
FT                   /locus_tag="ECH_0013"
FT   CDS_pept        10949..11758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0013"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /note="identified by similarity to GB:AAG27705.1; match to
FT                   protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44806"
FT                   /db_xref="GOA:Q2GI85"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI85"
FT                   /protein_id="ABD44806.1"
FT                   /translation="MNILLIGCGNLGSILLNKWSHSDQISKVTVVQPSLSKKDTFNNIT
FT                   KVVFVKSHEEVDKDFIPQIVVIAIKPQLVSDVMPNYRIYSESASFISLCAGIDINFLKT
FT                   CLSPTATIIRVMPNIAMSLGKSVNLSYIEEELPHEKQKVSTIFNNTGLIYWIQKEDIFD
FT                   KLSPITGSGPAYFFSLAEELVKNTIAAGINEEDAIKLVSQTFIGSAKLLETRQNTISHL
FT                   ISSITSRGGITQAALQVLNLHLPQTISSCLKAAMERLLYLKGLDKNK"
FT   gene            11920..13437
FT                   /gene="dnaX"
FT                   /locus_tag="ECH_0014"
FT   CDS_pept        11920..13437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ECH_0014"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44726"
FT                   /db_xref="GOA:Q2GI84"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI84"
FT                   /protein_id="ABD44726.1"
FT                   /translation="MGCIAHFLCYHSTMSFALKYRPSNFKDLIGQEVLVRVLHNAFHLN
FT                   KIPESILLTGISGVGKTTAARIISMCLNCISGPTSDPCNTCQNCISIKNFNHPDVIEID
FT                   AASNTSIEDVKVILENSRYMPISSKFKVYIIDEVHMLSNSAFNALLKVLEEPAPYVKFI
FT                   LATTEVKKIPVTIISRCQRFDFQRISTDKLVDHLKVVAKKENVSFDEESIKLIAYNADG
FT                   SIRNALSLLEQAAIYSNKILSENITKEMLGYVSRHTLLEIIEPLIIGNATEALNKFEEA
FT                   CNSYNSVIILDNMLQIIYEICYFSITKKDNSTSDNSIITYIKNEKILSPTFLSRLWQML
FT                   FKGIQEVKSSSCIKQAANMLIIRLCYLSSLPSPKQIIDKIQGKINNTSDINRKALLELL
FT                   KSNNMQDLYNQIYESESEVKNYKDEALNIETNQALSKDFHEDSLNFFNNSTNKKCNVPI
FT                   EQNFDINKSSNPCYNQHLDPTVCNILQEFDGAKVINIENIKKNNNKE"
FT   gene            13441..13746
FT                   /locus_tag="ECH_0015"
FT   CDS_pept        13441..13746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14718.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44972"
FT                   /db_xref="GOA:Q2GI83"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI83"
FT                   /protein_id="ABD44972.1"
FT                   /translation="MYSSDQLSNLQEMIKKKFSDFQEHQKSQIFEGSSLGGKVSVKISV
FT                   SNMVSYQVVEVKLDPSLLQEKAILIEDLIKAALNDALKKSSDYNKNLVGSLLSFGI"
FT   gene            13757..14767
FT                   /gene="asd"
FT                   /locus_tag="ECH_0016"
FT   CDS_pept        13757..14767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="ECH_0016"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44616"
FT                   /db_xref="GOA:Q2GI82"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI82"
FT                   /protein_id="ABD44616.1"
FT                   /translation="MSYKIAVVGATGNVGRVILNILASRSFPAKEVVALASKKSIGKKL
FT                   SYGDEVLESQDLDSYNFTNTDIAIFSAGSSISQQYARTAANKGCIIIDNTSLFRMEDEI
FT                   PLVVPEINPEDIAQYYKHNIIANPNCSTIQMLLALNPLHKISKIKRVVVSTYQSVSGAG
FT                   KSAMDELYSQTKGTFMNQNIAPKQFTKRIAFNCIPHIDVFMEDGSTKEEWKMAVETKKI
FT                   LDNNIEVSATCVRVPVFVSHSESLNVEFLSEISEEEAYEALENAPGVIILDRREDGGYA
FT                   TPLDSVHEDEVYVSRLRKDNTVKHGLNMWLVSDNLRKGAALNAVQIAEILVNDYL"
FT   gene            complement(14907..15029)
FT                   /locus_tag="ECH_0017"
FT   CDS_pept        complement(14907..15029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44878"
FT                   /db_xref="GOA:Q2GI81"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI81"
FT                   /protein_id="ABD44878.1"
FT                   /translation="MIIHLYDILAIRVALLVCLNVNDAVVNSSYPHNSTSILMC"
FT   gene            complement(15092..16270)
FT                   /gene="metK"
FT                   /locus_tag="ECH_0018"
FT   CDS_pept        complement(15092..16270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="ECH_0018"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P04384; match to
FT                   protein family HMM PF00438; match to protein family HMM
FT                   PF02772; match to protein family HMM PF02773; match to
FT                   protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45373"
FT                   /db_xref="GOA:Q2GI80"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI80"
FT                   /protein_id="ABD45373.1"
FT                   /translation="MFYYKNCLSDHIITSESVSNGHPDKVADQISDAILDYYISLNPLV
FT                   HTAIETLVTKNKVIISGEICGVSINKFDIECIARQVIKEIGYEQDGFHWKYVVIEILIH
FT                   EQSPDIVVGVSSGEKQGAGDQGIVYGYAINETETFMPASIFYSHLILKNIISAVKNCEI
FT                   PNLGPDAKTQITLLYKNNVPVRASNIVLSIQHSEDLSKSQIRDIVYPYVKESLPEGWMC
FT                   PDSDFLVNPAGRFVVGGPVGDCGLTGRKIMIDTYGGHVPHGGGAFSGKDPSKIDRSAAY
FT                   MARYLARNVVSAKLADQCLVQLSYAIGVSYPISFYVNTFGTGFVDDDIIKNFIQDNIDL
FT                   SPYGICKHLVLLNPIYRITSCYGHFGRIPDENGSFSWEREDLALKLKNEFHI"
FT   gene            16569..16645
FT                   /locus_tag="ECH_0019"
FT   tRNA            16569..16645
FT                   /locus_tag="ECH_0019"
FT                   /product="tRNA-Arg"
FT   gene            16706..17878
FT                   /locus_tag="ECH_0020"
FT   CDS_pept        16706..17878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0020"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="identified by match to protein family HMM PF01494;
FT                   match to protein family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44863"
FT                   /db_xref="GOA:Q2GI79"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI79"
FT                   /protein_id="ABD44863.1"
FT                   /translation="MNNSKYYDVVISGAGINGMITAIALSQLSISTALIDKNKILLSIP
FT                   KDRVFALSRRSQEILDKFNIWNNIKEHCPILDILIKDEDSSIFTHYDHKSISDNPMGYI
FT                   VESKFLCDAFKKHIKKINLYSECTYKSVNITNDLVRIELTDNTILLTSLLISAEGKNST
FT                   LRQIFDIPSINHDYSQSSIICNIKHTNHHNNLAIEHFFHGGPFAILPMYDGYRSSVVWT
FT                   NKTQISEMLMKLKKQDFMAELEKKCAPYVNDIKLDSEIKCFPLHLMFAKHLYKNRFALI
FT                   GDAAHSIHPIAGQGLNLGIRDIDKLVNHIKSAKQYGIDIGSNYVLKNFSYDRYFDNSSM
FT                   AILTTLIDGIFTKKSCTAKIARRFGLFIVQNSKSIKNYMIKHAMGIGKFN"
FT   gene            complement(17875..18429)
FT                   /locus_tag="ECH_0021"
FT   CDS_pept        complement(17875..18429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14514.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45337"
FT                   /db_xref="GOA:Q2GI78"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI78"
FT                   /protein_id="ABD45337.1"
FT                   /translation="MFFYRYMLFSFILRKMKNLLINLLFFAVFLYFSSFIFIMMKEGIR
FT                   FAFEYRDPKNVAIYIYKYLKWCYYNSDSLTYSVFFKAGVSLVIPFWAYLKISKINWNEF
FT                   FRCMFEYICSMFKKNSYGGENLEFRDKTDIDFRQADYREEMYRIKRNAMMEIEKSINKM
FT                   TVEILCMKNKKEDCDNVIDKS"
FT   gene            complement(18460..18534)
FT                   /locus_tag="ECH_0022"
FT   tRNA            complement(18460..18534)
FT                   /locus_tag="ECH_0022"
FT                   /product="tRNA-Gln"
FT   gene            18789..19631
FT                   /gene="glyQ"
FT                   /locus_tag="ECH_0023"
FT   CDS_pept        18789..19631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ECH_0023"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by similarity to SP:P00960; match to
FT                   protein family HMM PF02091; match to protein family HMM
FT                   TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45279"
FT                   /db_xref="GOA:Q2GI77"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI77"
FT                   /protein_id="ABD45279.1"
FT                   /translation="MNFQSIIRNLQSYWEDYGCTIFQPYTSELGAATLHPATSMTAISK
FT                   KPSKLAYVQPVIRPCDGRYGDNPNRLYQHHQYQVLIKPSNTDLQSDYLKSLERIGISIK
FT                   THDIKFIEDDWENPSIGAWGLGWEVTCNGMEITQFTYMQQVGGIECSLVPGEIAYGLER
FT                   IAMIIQNVDNIYKILWDDNGTTYGDVFKQREYEFSKLALDYYDVDILFKQFNEAEQTCI
FT                   SLIEKKLPLAAYDVCTKASHILNLLESRGVIGVNERASYILRVRKLANLCCSLYTQCH"
FT   gene            19647..21758
FT                   /gene="glyS"
FT                   /locus_tag="ECH_0024"
FT   CDS_pept        19647..21758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ECH_0024"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by similarity to SP:P45651; match to
FT                   protein family HMM PF02092; match to protein family HMM
FT                   PF05746; match to protein family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44644"
FT                   /db_xref="GOA:Q2GI76"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI76"
FT                   /protein_id="ABD44644.1"
FT                   /translation="MPLELLFECLSEETPPEMQSSAYAYMDSYIRKELSRCNISFESVK
FT                   VFVTSNRLTLYVKNIINNLSNNTLKIKGPKVSADKIAIEGFLKKVNKNFSDLITCKIGN
FT                   DDFYYAELNHNEETNTEHIILSIIENMLNNFPWDKKMRWGGGKTYWVRPILNIMCILDG
FT                   KVLPIKFADIEANNKSCGNRFTNKEFFEVADFNSYNSKLKKNNVILCQKERLNFILHQI
FT                   KSITEESNLICEDNQKLINKLNGTLEYPIVIMGSVDEKFSELPKELILSVMHNHQKYLA
FT                   VFKEDKITNFITISTISNDNIIKGHNNILNARLLDASFLVKKDKEYNIDYYIEKLKQIV
FT                   FHAKLGSVFEKVNRIIALSKYISIWIPHSSLIKVERAAKLSKFDLSTLAIKEFPELQGI
FT                   MGGYYASYFNESLEISESIVNHYEPTNPQKECPSSPISIAVSISDKIDNLVGMIVAGEQ
FT                   VTSSRDPFSMRRMAISIIRIIIENNLNIPIRLLIEKSVSLYSFAITERTTINKLKNVIS
FT                   RTNRKKEIISSVIEFFSNRFKIILKEDGIKEDIINAVFESRKFSNLLLIKTEAKFLNNY
FT                   IFTKNGVEIIKAYKRLSNIITKGENVNNTAKYKCNKKLFTIKEETDLYKEITYQKNNIK
FT                   RLIKDNKFEESLNNLYKLSCCVNSFMDNVKVNDQTNKELHKNRLSIVKNAFYIFDLVTD
FT                   FSKIKNTHR"
FT   gene            21822..22964
FT                   /gene="dnaJ"
FT                   /locus_tag="ECH_0025"
FT   CDS_pept        21822..22964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECH_0025"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by similarity to SP:P50018; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556; match to
FT                   protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44504"
FT                   /db_xref="GOA:Q2GI75"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI75"
FT                   /protein_id="ABD44504.1"
FT                   /translation="MSKSDYYDLLGVSKSATPEEIKKAYRKMALKYHPDKNPGNKEAEE
FT                   KFKELSEAYDVLIDQDKRAAYDKYGHNAFDSSGRGGFDFNSGFSGDFSDIFNDLFGGGF
FT                   RGGRGSSRRHDSGAVGSDLRFDIEITLEDSFNGKKVPISYVTYVKCSSCSGSGSEGSAK
FT                   SVQCSTCHGVGNVRTQQGFFTIERTCHVCNGEGEIIQNKCKKCSGSGRVRDEVNLLVTI
FT                   PKGIESGNKIRLNGKGEAGYRGARSGDLYVYSNIQKHKFFTRNGSDLYCNVPIKMTLAA
FT                   LGGHIEMPSIDGTWTKVKVPEGSQNGDKLRLKEKGMPIINSSKRGDMYIQITVETPVKL
FT                   TKKQKELLQKFDDEPNVDCNPQSTGFFQKVKSFWKDIRSN"
FT   gene            complement(23010..23849)
FT                   /gene="nadC"
FT                   /locus_tag="ECH_0026"
FT   CDS_pept        complement(23010..23849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ECH_0026"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by similarity to SP:P30011; match to
FT                   protein family HMM PF01729; match to protein family HMM
FT                   PF02749; match to protein family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45256"
FT                   /db_xref="GOA:Q2GI74"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="PDB:3L0G"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI74"
FT                   /protein_id="ABD45256.1"
FT                   /translation="MKISFSEIIHNALKEDLGDKGDITTNSILINEKVNFAINTRENLV
FT                   VCGIPILEEVFNMNKEHVKYEIHKKDGDITGKNSTLVSGEALAIYLLPIERVILNFIQH
FT                   ASGIASITRQFVDEVSGTKVKIRSTRKTTPGLRMLDKYSVCIGGGESYRDNLCDGVLIK
FT                   DNHIASCGSITLAIQRLRKNLKNEYIAIECDNISQVEESLSNNVDMILLDNMSISEIKK
FT                   AVDIVNGKSVLEVSGCVNIRNVRNIALTGVDYISIGCITNSFQNKDIGLDIEYNNNK"
FT   gene            23943..24530
FT                   /locus_tag="ECH_0027"
FT   CDS_pept        23943..24530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0027"
FT                   /product="putative membrane protein, TIGR00023"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45136"
FT                   /db_xref="GOA:Q2GI73"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI73"
FT                   /protein_id="ABD45136.1"
FT                   /translation="MNIHAVVIVLSYLIGSIPFGLILSYIGGLGDIRKVGSGNIGATNV
FT                   FRKSKKLAVMTLLLDAVKGLISVLLAKIYSTDQTFAFISAMFSIIGHMFPVWLLFKGGK
FT                   GISTLLGSMVLIEYKFVICFLFIWITLFAIFKYSSLSSIVSTIFVALLVYMYYTMNDTA
FT                   VFIAMSLLIITQHADNIARMLSGKENKLNIGL"
FT   gene            complement(24538..25008)
FT                   /gene="ruvC"
FT                   /locus_tag="ECH_0028"
FT   CDS_pept        complement(24538..25008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="ECH_0028"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="identified by similarity to SP:P24239; match to
FT                   protein family HMM PF02075; match to protein family HMM
FT                   TIGR00228"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45348"
FT                   /db_xref="GOA:Q2GI72"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI72"
FT                   /protein_id="ABD45348.1"
FT                   /translation="MKIMGLDPGLNCTGWSILSVSKDIKLIDKGTVVTNSKEDTGQRLR
FT                   KIHTDVLDILRLYQVDSASMEEIFINKNPKSSISLCYARGILLLTLSTKDIPVFEYSTN
FT                   YVKKSITGNGHAKKEQVSFMIEKILNVKCSGTYDISDSIAVALCHAYSKKSF"
FT   gene            complement(25010..25834)
FT                   /locus_tag="ECH_0029"
FT   CDS_pept        complement(25010..25834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0029"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44864"
FT                   /db_xref="GOA:Q2GI71"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI71"
FT                   /protein_id="ABD44864.1"
FT                   /translation="MKGKLHDYHLVNPSPWPLLFSLTILITALGAVGTIHGSHISKIVL
FT                   AFGMSSVSIVLYKWWKDVVTEAIRDNCHTEIVKKGIRLAMAALILSETMFFFGFFWSFF
FT                   KAWLFPVYMLENLVPSKLLSWPPSGITKLDPWSIPLLNTVILLLSGCTLTWSHYSLIND
FT                   DNKNTVKMLGMTLLLGITFSVFQAIEYLHIGFSFRETGEKAIYSSNFYMMTGFHGVHVI
FT                   VGTLFLTICWLRAKRNQLSPENHIGFECAAWYWHFVDVIWLLLFFFLYWISS"
FT   gene            complement(25934..26938)
FT                   /gene="hemE"
FT                   /locus_tag="ECH_0030"
FT   CDS_pept        complement(25934..26938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="ECH_0030"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by similarity to SP:P29680; match to
FT                   protein family HMM PF01208; match to protein family HMM
FT                   TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44754"
FT                   /db_xref="GOA:Q2GI70"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI70"
FT                   /protein_id="ABD44754.1"
FT                   /translation="MLKTITSRAKQKEIPVWFMRQAGRYLPEYRKVAEEAGSFLELCYT
FT                   PELVKEVTLQPVRRFGLDAAIIFSDILVIPDALGCKVEFTKEKGPELQLISNHSEISVP
FT                   EEAALDHLKNVFRGIKEVRKSLQRDKPLIGFAGAPWTIASYMIGRDKNFSKIREMCYSQ
FT                   TKNLEKIVEKITKVTTLYLIKQIESGVDIIQIFDSNAGIVPAGEFKKWIIDPTKEIVSS
FT                   IRKLYPEFPIIGFPKGAGVMYKQFSEETEVSVTSVDYNTPMSWAKSNIPSVLQGNIDPY
FT                   LVAYDKSKAISQTKELINIMKDKPFIFNLGHGVIPSTPIANIAALVDTIKSVV"
FT   gene            27362..28249
FT                   /gene="tlyC"
FT                   /locus_tag="ECH_0031"
FT   CDS_pept        27362..28249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="ECH_0031"
FT                   /product="hemolysin"
FT                   /note="identified by similarity to GB:AAC62436.1; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45248"
FT                   /db_xref="GOA:Q2GI69"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI69"
FT                   /protein_id="ABD45248.1"
FT                   /translation="MSDKLSDNSDSEDRLSLKESLSAKLVSFMIERMPKLKRVVENNLI
FT                   DDNECFTNSRMFYNLRKFNDCLVRDVMIPRTEIYAIDITDVPDSKNLIDKVVSGQYTRI
FT                   PAYENNLDNIIGFIHIKDIISNFHNDFNVRNIIREVMYIPPSMKAVNLFIKMQSSHIHV
FT                   AVVVDEYGGTEGLVTMADLIEEIVGDIDDEHDVPTVPSIVNISDNKIEVNARVLVKNLE
FT                   EIFNIDFRDCKEDDYVTIGGLILSMIGRVPMTNEVFKHKSGAVFSIKEADDRCIYKIVI
FT                   DLSDVKKVDLKIDY"
FT   gene            complement(28232..28765)
FT                   /locus_tag="ECH_0032"
FT   CDS_pept        complement(28232..28765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0032"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="identified by match to protein family HMM PF04586;
FT                   match to protein family HMM TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44852"
FT                   /db_xref="GOA:Q2GI68"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI68"
FT                   /protein_id="ABD44852.1"
FT                   /translation="MQQKTCNLFLSEKNIKQSGTFSGYASVFNIVDKQKHIILPGAFSN
FT                   SVKNSHKIKLLWQHNSTEPIGNITSLTEDNIGLYITANLLLDLQKGKEAYLMIKNGIIN
FT                   ALSIGYSIIDDYIDAKTGVRVLKKISLWEVSLVTFPANIYSKVTNVKDTHEDLATSFIK
FT                   AKLTLDRLSSIIDF"
FT   gene            complement(28890..30071)
FT                   /locus_tag="ECH_0033"
FT   CDS_pept        complement(28890..30071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0033"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01537"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45025"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI67"
FT                   /protein_id="ABD45025.1"
FT                   /translation="MNFFKKKSIQDNSYTFSVPIQLFTEAVWKNRSYANFAENGYIKNV
FT                   IAFRSIHMIASAAASVSLLLNKTIKNNTFQIKNHPLLKLISKPNNTTSKSEFIEGILTY
FT                   KLISGNAYILTIENHDMIPKELHLLRPDRIEITPGKDNRPYSYRYSINNYHYDYKINKS
FT                   TNYSQILHIKNFHPLNDYYGLSPIEAASYSIDQHNQAGSWNQAMLQNGARPSGALIVNA
FT                   KSNNNGNLTQEQYTRLKSQVDEFYSGPRNAGRPILLEGGLDWKEMSLSPKDMDFIESKH
FT                   SSARDIALAFGVPPQLLGIPGDNTYNNLIEARLSLWEQTILPHLDNIISHFNNWLIPRF
FT                   GSNMFLSYDKDSISVLTEKRKQLWQYVENATFMTINEKRAAFGLPPIENGNTL"
FT   gene            30192..30287
FT                   /locus_tag="ECH_0034"
FT   CDS_pept        30192..30287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44570"
FT                   /db_xref="GOA:Q2GI66"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI66"
FT                   /protein_id="ABD44570.1"
FT                   /translation="MCLSYSYVRLNIIHPMLIDVEAVFIGCVFNF"
FT   gene            30385..31134
FT                   /locus_tag="ECH_0035"
FT   CDS_pept        30385..31134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0035"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /note="identified by similarity to SP:P12999; match to
FT                   protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45055"
FT                   /db_xref="GOA:Q2GI65"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI65"
FT                   /protein_id="ABD45055.1"
FT                   /translation="MGLITQKIQKAFDNAASSYDKYSHIQDVILRELCSTVVLESCDKR
FT                   NILDVGCGTGNMSKFLNVANHNLIQVDLSREMCVLAKKKNNALSVNCHMDVMPFYENFF
FT                   DVIIASMVLQWSRDVSISLLELFRVMKSDGILYVAIPIFGTLIELNNVIEKVGGSFSQF
FT                   YKMNEFINIVNSFNVKVQYAFCCNYRQYHKSFRAFLLSMKLTGVYTKKVSDEQYNIFEI
FT                   SKIYKELYSLQNCIFNSWNIMYLVVKK"
FT   gene            31156..32100
FT                   /gene="nadA"
FT                   /locus_tag="ECH_0036"
FT   CDS_pept        31156..32100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="ECH_0036"
FT                   /product="quinolinate synthetase complex, subunit A"
FT                   /note="identified by similarity to SP:O05104; match to
FT                   protein family HMM PF02445; match to protein family HMM
FT                   TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44766"
FT                   /db_xref="GOA:O05104"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05104"
FT                   /protein_id="ABD44766.1"
FT                   /translation="MKELDVITLLQEIRHLAQESNAVILAHYYQDSEIQDIADFIGDSL
FT                   ELSRKAATTTADVIVFCGVYFMAEVAKIINPAKKVLLPDLNAGCSLADSCDAESFKKFR
FT                   ELHKDCVSITYINSLAEVKAYSDIICTSSSAEKIIRQIPEEKQILFAPDKFLGAFLEKK
FT                   TNRKMILWPGTCIVHESFSERELIDMMVRHDKAYVLAHPECPGHLLKYAHFIGSTTQLL
FT                   KFSSDNPNSEFIVLTEEGIIHQMKKVSSGSTFYIVKTSDSGGCVSCSKCPHMRLNTLEK
FT                   LYLCLKNGYPEITLDPEISSMAKRSLDAMLKMS"
FT   gene            complement(32107..32591)
FT                   /pseudo
FT                   /locus_tag="ECH_0037"
FT                   /note="putative phage portal protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to GB:AAV87098.1"
FT   gene            complement(32814..33191)
FT                   /gene="fdxA"
FT                   /locus_tag="ECH_0038"
FT   CDS_pept        complement(32814..33191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="ECH_0038"
FT                   /product="ferredoxin A"
FT                   /note="identified by similarity to GB:AAA85787.1; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45469"
FT                   /db_xref="GOA:Q2GI63"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI63"
FT                   /protein_id="ABD45469.1"
FT                   /translation="MTHFITDRCIRCKYTDCVEVCPVDCFYEGANMLVIDPDQCIDCGV
FT                   CVPECPIDAIVPDDFIRDVLECNDSALNEEQKNLKKFYEINKKFSKEWNNITSAKPPYS
FT                   DAESHKYTKNKFIYFDENLSE"
FT   gene            33455..35101
FT                   /locus_tag="ECH_0039"
FT   CDS_pept        33455..35101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0039"
FT                   /product="120 kDa immunodominant surface protein"
FT                   /note="identified by similarity to PIR:JC6174; match to
FT                   protein family HMM TIGR02202"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44969"
FT                   /db_xref="GOA:Q2GI62"
FT                   /db_xref="InterPro:IPR011736"
FT                   /db_xref="InterPro:IPR019048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI62"
FT                   /protein_id="ABD44969.1"
FT                   /translation="MDIDNSNISTADIRSNTDGLIDIIMRILGFGNKNIVQPQDLGSEI
FT                   YQQEQEDDTVSQPSLEPFVAESEVSKVEQEKTNPEVLIKDLQDVASHESGVSDQPAQVV
FT                   TERENEIESHQGETEKESGITESHQKEDEIVSQSSSEPFVAESEVSKVEQEETNPEVLI
FT                   KDLQDVASHESGVSDQPAQVVTERESEIESHQGETEKESGITESHQKEDEIVSQPSSEP
FT                   FVAESEVSKVEQEETNPEVLIKDLQDVASHESGVSDQPAQVVTERESEIESHQGETEKE
FT                   SGITESHQKEDEIVSQPSSEPFVAESEVSKVEQEETNPEVLIKDLQDVASHESGVSDQP
FT                   AQVVTERESEIESHQGETEKESGITESHQKEDEIVSQPSSEPFVAESEVSKVEQEKTNP
FT                   EILVEDLPLGQVIPVVVEKDEMFAPSFNPIVIKEEDKVCETCEQEFEIVKDSQTVKGSE
FT                   DIISPIECLESMDSIVSTIFESGMLCPMSKPGQYVCGYEMYMYGFQDVKDLLGGLLSNV
FT                   PVCCNVSLYFMEHNYFTNHENINHNVVNDIV"
FT   gene            complement(36100..38244)
FT                   /gene="virD4"
FT                   /locus_tag="ECH_0040"
FT   CDS_pept        complement(36100..38244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="ECH_0040"
FT                   /product="type IV secretion system protein VirD4"
FT                   /note="identified by similarity to GB:AAM00416.1; match to
FT                   protein family HMM PF02534"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44492"
FT                   /db_xref="GOA:Q2GI61"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI61"
FT                   /protein_id="ABD44492.1"
FT                   /translation="MDSVSANHIRNILFLVLGAFFGLEFCFYLSGVLFILMVWGPDYLD
FT                   FNAINPSFSDFPDRIWPTVFNYVEHWWHNPSSYDAILLVKLISSLCIPIGILSIVLWNL
FT                   RNILFDWRPFKKKESLHGDSRWATEKDIRKIGLRSRKGILLGKDKRGYLIADGFQHALL
FT                   FAPTGSGKGVGFVIPNLLFWEDSVIVHDIKLENYDLTSGWRKKRGQEVFVWNPAQPDGV
FT                   SHCYNPLDWISSKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVKS
FT                   FGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLE
FT                   LWANPLIDTATASSDFNIQEFKRKKVTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRTL
FT                   PSDDEPYGVLFLMDEFPTLGKMEQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMN
FT                   SFLSNSTYRITFAANNIETANLISQLIGNKTVNQESLNRPKFLDLNPASRSLHISETQR
FT                   ALLLPQEVIMLPRDEQILLIESTYPIKSKKIKYYEDKNFTKKLLKSTFVPTQEPYDPNN
FT                   VKITKKENEDPIPSIESDIPENKPNNTENNLTEEGAIYNSTETNYEDDEDEDDDFNFDD
FT                   LDEYIDEDEEYSEQPEEDYDYTDEEDEDEEEDEEDNDYNNSNEDDDYENNNISNSHHEN
FT                   DFDNHNEKPVKDQDIKNDKQ"
FT   gene            complement(38281..39279)
FT                   /gene="virB11"
FT                   /locus_tag="ECH_0041"
FT   CDS_pept        complement(38281..39279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="ECH_0041"
FT                   /product="type IV secretion system protein VirB11"
FT                   /note="identified by similarity to GB:AAM00414.1; match to
FT                   protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45167"
FT                   /db_xref="GOA:Q2GI60"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI60"
FT                   /protein_id="ABD45167.1"
FT                   /translation="MTTSYAALDTYLEPLQSIFHEDGVNEVSINQECEVWIENRGNIRC
FT                   ESIPTLNLSHLKALGRLIAQATEQKISEENPLLSATLPNGYRIQIVFPPACEATTVVMS
FT                   IRKPSAMQLSLDDYEKMGAFNQAVTETQENNTDNQLKELLKQKKIKQFLEHAIINKKNI
FT                   IISGGTSTGKTTFTNAALRSIPQNERLITVEDAREIVLSNHPNRVHLIASKGGQGRAKV
FT                   STQDLIEACLRLRPDRIIVGELRGSEAFSFLRAINTGHPGSISTLHADTPMMALEQLKL
FT                   MVMQAGLGIPPDQIINYITNIVDIVIQLKRGSEGKRYVSEILFTKSLQKNG"
FT   gene            complement(39295..40638)
FT                   /gene="virB10"
FT                   /locus_tag="ECH_0042"
FT   CDS_pept        complement(39295..40638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="ECH_0042"
FT                   /product="type IV secretion system protein VirB10"
FT                   /note="identified by similarity to GB:AAM00413.1; match to
FT                   protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44965"
FT                   /db_xref="GOA:Q2GI59"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI59"
FT                   /protein_id="ABD44965.1"
FT                   /translation="MSEENQNNQYTEIEENVNVVGVNKGKKFITIGVMLVGLGFAYYYF
FT                   FTGKKPDDSLNKPQTTEEADIEKLLKESVPPTQEVSPPINIPPQLPELPPLVSPSLPSI
FT                   PTVEKPKVLEIPKIPKIKPKQPVEIKPKPQPQPEPLPKIPLPVQNKIDIAAPIAPITTG
FT                   YDKERRATSMLAVSGGQNVASGTSENGERESNIDTTINKMNSIISLQTTSSPNVVATKV
FT                   SNLELTILQGKIIDVVLETAINSDLQGTLRGIVARDVYAEASNTVMIPKGSRLIGSYSF
FT                   DASPGKTRVQISWNRVILPHGIDITLDSNGTDELGRQGASGVVDTKIGNILTSTILLAG
FT                   VSIATSYATSKIPEINNYPILESDSKEKKDKEKDDTGDKSKSTKTTLPVKILSQAVDDF
FT                   SNSIKDIIKKYSNNNPTVYVDQGTLLKVFVNKDIVFPKSAVRGIDIVN"
FT   gene            complement(40660..41481)
FT                   /gene="virB9-1"
FT                   /locus_tag="ECH_0043"
FT   CDS_pept        complement(40660..41481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9-1"
FT                   /locus_tag="ECH_0043"
FT                   /product="type IV secretion system protein VirB9"
FT                   /note="identified by similarity to GB:AAM00415.1; match to
FT                   protein family HMM PF03524"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45573"
FT                   /db_xref="GOA:Q2GI58"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI58"
FT                   /protein_id="ABD45573.1"
FT                   /translation="MMNFYKIYTILLLVLVMMFNSSAYAINRVDNPVTVDSRIKTFVYS
FT                   NNEIYNVVFNYGYHSYIEFSKGETIKMLAMGNTVSWKVKPVGNKLFIMPLEKNGRTNML
FT                   IETNKGRSYAFDLICRSANESSDDNNDQAGYSDLIDLTYIVRFYYPKTEEDFELNQVKL
FT                   PDISVPSAVQKIKKHVVIKPNNTSNHYILETKSENQNILPVELFDDGKLTYFKFSNDNQ
FT                   IIPQIFIYNNSEKKVPCKMLLLQNYVIIKGVHKNLYLEYKSESVKITNKKL"
FT   gene            complement(41465..42178)
FT                   /gene="virB8-1"
FT                   /locus_tag="ECH_0044"
FT   CDS_pept        complement(41465..42178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8-1"
FT                   /locus_tag="ECH_0044"
FT                   /product="type IV secretion system protein VirB8"
FT                   /note="identified by similarity to GB:AAM00411.1; match to
FT                   protein family HMM PF04335"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44843"
FT                   /db_xref="GOA:Q2GI57"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI57"
FT                   /protein_id="ABD44843.1"
FT                   /translation="MIRMFNKFRKKNNKNDNNKLSNANLETTYSWHVSRYNSVVIQRNM
FT                   LLFFTMLALSAVGISVFVIFNISKNRTIEPFVVEIEKKSGITTLVNPVSVKQYSADEVL
FT                   NNHFIIEYVRSRELFDPNNFQYNYYTKVRLFSNQTTYSEFRNWIRLSNPASPLNLYANV
FT                   TSGYLKIRSLQHLRPGSVQIRFSLEFNHPSGIIKKDRIATLSFQYVTLEMNEQERQINP
FT                   LGFQITYYRADDEFL"
FT   gene            complement(42310..43407)
FT                   /locus_tag="ECH_0045"
FT   CDS_pept        complement(42310..43407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0045"
FT                   /product="putative GTP cyclohydrolase II"
FT                   /note="identified by match to protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44653"
FT                   /db_xref="GOA:Q2GI56"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI56"
FT                   /protein_id="ABD44653.1"
FT                   /translation="MENLFNRFHSNKYITEKSIAELRCGIPVLLYNSNDSLLIFPSELI
FT                   DNQLLNTLKKHFKDINILVTGNRLNFIFQSSGNQLSRIKIKESHDLEYISSLLTGQELH
FT                   KGSLVIDNVTVSTNSLDITAISLIKLTKLLPSAVVVDINDSDVLHWCTKNNITPIRQEI
FT                   IENYNKEYEIQEVCSSPLFLKDCSNAKINVYRSHTGELEHYAIIIENPDYSNPIIRIHS
FT                   SCYTGDLLNSLSCDCRCQLHTAIKLMIENKGGIILYLAQDGRGIGLANKIRTYQLQIKH
FT                   NFDTVDANRFFGFEDDERVFIPAIKILQKLGISRLQLLTNNPNKISEIQNHGIQVTKIL
FT                   PIFVDTNQHNINYINTKAKRLGHVC"
FT   gene            complement(43427..43515)
FT                   /locus_tag="ECH_0046"
FT   tRNA            complement(43427..43515)
FT                   /locus_tag="ECH_0046"
FT                   /product="tRNA-Leu"
FT   gene            43622..43765
FT                   /locus_tag="ECH_0047"
FT   CDS_pept        43622..43765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44923"
FT                   /db_xref="GOA:Q2GI55"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI55"
FT                   /protein_id="ABD44923.1"
FT                   /translation="MLIIIEIRFIVKEFIMSIDWSHYFNIVNIIHVMNFNIGHMGNVNM
FT                   IK"
FT   gene            complement(43952..45022)
FT                   /locus_tag="ECH_0048"
FT   CDS_pept        complement(43952..45022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0048"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45407"
FT                   /db_xref="GOA:Q2GI54"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI54"
FT                   /protein_id="ABD45407.1"
FT                   /translation="MKSNFFITKRNVSSLISSINKTIPKPQDISQSIKNKITSIKKEAI
FT                   LLQNKLKNLLETNIDLGLYHFYKGNISDAKFRFRLISIFKPKLPVVYYNIGRCYFTLQN
FT                   FNKAQQNFTRAIELDNNYADALYYLNKITNPESIVYVPENIIKQYFDYTSEHFVEHWLI
FT                   AKQYKAHEYVKSLIINFFGNKSSYLNILDLGCGTGICGQFLKMKSIGNHITGIDISNKM
FT                   INIARGCFVNGKQAYNELINISIFDFLKKNQNKKKYNVIILTEVLQYTGSLNPILKLLK
FT                   TMLETDGIIIGLARRKKGSGFQFINEGDFFCHSDKYIKSSIIESGLQCSYSSYCKIYGS
FT                   QVEGILFVAQSNKIEV"
FT   gene            complement(45097..45519)
FT                   /locus_tag="ECH_0049"
FT   CDS_pept        complement(45097..45519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44775"
FT                   /db_xref="GOA:Q2GI53"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI53"
FT                   /protein_id="ABD44775.1"
FT                   /translation="MVLYHKMKMLCATGVFSLEESEESNYLRSVMIGCLSVVLCCVIYI
FT                   MILIHFNIKLMLFLLSKITGKNFKVLNNVISRLIDTQIIHFIISHMHLSFLKHISHKNE
FT                   LNKKYGMYKDLAQKTNIIIQSIEHHRKLYENFILPI"
FT   gene            complement(45664..46467)
FT                   /gene="dapF"
FT                   /locus_tag="ECH_0050"
FT   CDS_pept        complement(45664..46467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="ECH_0050"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45183"
FT                   /db_xref="GOA:Q2GI52"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI52"
FT                   /protein_id="ABD45183.1"
FT                   /translation="MIDFIKMHGTSNDFVIIDCRKKSYSNINYKAIANRKTGIGCDQII
FT                   IITESEKADCFMHIYNADGSKVEMCGNAARCVGYLLSNEKQDNNITIELSDRILSCLRT
FT                   SENRVQVNIGVAKFHWTDIPTSQECDTLHLPIELEMLSDPVGINVGNPHAIFFVDSIET
FT                   IPLDKLGPKLENHHLFPKRANISIAEIVSRDKIKLRVWERGTGETASCGSGACAALVAA
FT                   IRRQYTNKTAVVCLQGGDLLISYQHDNTILMEGMVSYIFNGIYRV"
FT   gene            46685..46840
FT                   /locus_tag="ECH_0051"
FT   CDS_pept        46685..46840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45411"
FT                   /db_xref="GOA:Q2GI51"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI51"
FT                   /protein_id="ABD45411.1"
FT                   /translation="MCRSVDLFYVMVLTFYILMEFFNNCTASLCSAIKLSSMFFGSLIL
FT                   KFEMKN"
FT   gene            complement(46729..47151)
FT                   /locus_tag="ECH_0052"
FT   CDS_pept        complement(46729..47151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45180"
FT                   /db_xref="GOA:Q2GI50"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI50"
FT                   /protein_id="ABD45180.1"
FT                   /translation="MPFINNKNDTKSTKITWEIIKNQKYKQTHLLQISCLYIITIHSKD
FT                   YNISLPEDQIISNILLRINTTMESVLLNKLLNIEILKGISSYKFISKKKNNVARLQDIS
FT                   QFFISNFNIKLPKNIEESFIAEHKEAVQLLKNSISI"
FT   gene            47420..47530
FT                   /locus_tag="ECH_0053"
FT   CDS_pept        47420..47530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44706"
FT                   /db_xref="GOA:Q2GI49"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI49"
FT                   /protein_id="ABD44706.1"
FT                   /translation="MCRYLSNFIENIAIFIVVLDVMGSSIVFSLNILWHC"
FT   gene            47577..47699
FT                   /locus_tag="ECH_0054"
FT   CDS_pept        47577..47699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44997"
FT                   /db_xref="GOA:Q2GI48"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI48"
FT                   /protein_id="ABD44997.1"
FT                   /translation="MYNVVNGVNDWHSVKDINILFNKLTSIKVLIFFNFLLLIV"
FT   gene            47910..49061
FT                   /gene="pgk"
FT                   /locus_tag="ECH_0055"
FT   CDS_pept        47910..49061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="ECH_0055"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by similarity to SP:P09404; match to
FT                   protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45174"
FT                   /db_xref="GOA:Q2GI47"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI47"
FT                   /protein_id="ABD45174.1"
FT                   /translation="MKKIQDFSCSGKTVLLRADLNVPVDNGIVLDDTRIVRLTTTIKYL
FT                   LSNDAKIVIMSHYGSPKSYDKEFSLKFVVEYLNKIFATNVVFIDGVIGDYVEQTIQSVP
FT                   AGTILLLENLRFYAEEEKNDLNFAKQLALLADIYVNDAFSCLHRKHASIDAITRVMPSF
FT                   IGFNFQEEMKYLSCVVSNSEKPVAVIVGGSKISTKVHMLKNLIKKIDFLIVGGAIANNF
FT                   LLSQGLKIGKSLYEELEKDLVTEIVDLAKRYECKIIVPVDYVVAKNYICGDSTIKDNDT
FT                   LESDDMILDVGPQTVNMIAATINKCRTVLWNGPCGMFEKEPFSKGTFSVANLLSKLTKV
FT                   GKLKSIVGGGDSICAIKLSGLSNEDFTYISTGGGALLHFLSIA"
FT   gene            complement(49530..50696)
FT                   /locus_tag="ECH_0056"
FT   CDS_pept        complement(49530..50696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0056"
FT                   /product="putative exodeoxyribonuclease VII, large subunit"
FT                   /note="identified by similarity to SP:P04994; match to
FT                   protein family HMM PF01336; match to protein family HMM
FT                   PF02601; match to protein family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44857"
FT                   /db_xref="GOA:Q2GI46"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI46"
FT                   /protein_id="ABD44857.1"
FT                   /translation="MTPEFTVSEITKIFQNFVHETFTHIKVRGEISNLSQPKSGHTYFT
FT                   LKDDAAVLNAICWNNTKVEFDLKNGLEVICSGFLTTYQSKYQLITENMLLAGIGNLKIM
FT                   LEQRKAKLEKEGLFDQSNKKPLPLLPKITGVITSTTGAVINDILNRVKSRFPSHIVISP
FT                   VSVQGNESINQIIDAISKLNNADTNKPDVIIIARGGGSIEDLWIFNDESIVRAVARSSI
FT                   PIVSAIGHETDFTLIDYAADVRAPTPTAAVEIVLPTKTQLIEHINSKFNKIKTTLHYKI
FT                   NKKKERLFYLHNNLIKTKHQIKVLKLQLSEYKNKIEVLLKILLLNKKQSLNALYNKINK
FT                   FNKEKTLEAGYAVLYDTNRNHISSIKKLKSNDIISIELKDGIIEAIIK"
FT   gene            complement(50693..51358)
FT                   /locus_tag="ECH_0057"
FT   CDS_pept        complement(50693..51358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0057"
FT                   /product="zinc finger-like domain protein"
FT                   /note="identified by match to protein family HMM TIGR02098"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44730"
FT                   /db_xref="GOA:Q2GI45"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI45"
FT                   /protein_id="ABD44730.1"
FT                   /translation="MRIECKNCNAVYRVDSSKFPTSGKKVRCTNCNNTWMHVPSQDNID
FT                   HPEKDYINKEHATNPNLQSNKNTILNNSTKSSFLVKKISSIVAMILLVFSLSVMLQNNM
FT                   PYKIRKIYRIIEMYDTTNIQLANSQIKILKNNKDSIAIKVEGVIKNQSDQERFIPGIHF
FT                   VFYNKQKKAISSEKLNKHKTDIIPSKEDYKFEHIIQYVPKETDSIQIKIGNLFEIAFL"
FT   gene            51551..52390
FT                   /gene="dapD"
FT                   /locus_tag="ECH_0058"
FT   CDS_pept        51551..52390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ECH_0058"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="identified by similarity to SP:P03948; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR00965"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44774"
FT                   /db_xref="GOA:Q2GI44"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI44"
FT                   /protein_id="ABD44774.1"
FT                   /translation="MENFCNFKDAIEDAWNNLANLSSNTSIKKVVDDVMDLLDQGKIRI
FT                   CEKVGDQWVVNEWAKKAILLCFRVYDMNLAEISSADSMLGNLCWFDKVQLKFGRWSADD
FT                   FRAAKVRAVPGSMVRKSAYIAPNVVLMPSFVNVGAYVGEGTMIDTWASVGSCAQIGKHC
FT                   HISGGAGIGGVLEPLSSRPVVIEDNCFIGARSEIVEGVVVGEGSVIAMGVYIGASTRIV
FT                   DRASGEISYGKIPPYSVVVPGSYGSGDLSLYCAVIVKKVDDKTRSKVSINELLRDDS"
FT   gene            52627..52776
FT                   /locus_tag="ECH_0059"
FT   CDS_pept        52627..52776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45402"
FT                   /db_xref="GOA:Q2GI43"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI43"
FT                   /protein_id="ABD45402.1"
FT                   /translation="MIQVLNIKSSLSCFCEFVDSYLNKKDQYIDHRYMLTFLYLRKLML
FT                   FNGI"
FT   gene            52852..54171
FT                   /gene="trmE"
FT                   /locus_tag="ECH_0060"
FT   CDS_pept        52852..54171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="ECH_0060"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by similarity to SP:P25522; match to
FT                   protein family HMM PF01926; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00450; match to
FT                   protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45538"
FT                   /db_xref="GOA:Q2GI42"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI42"
FT                   /protein_id="ABD45538.1"
FT                   /translation="MTTIFALCTPWGRSGVAVIRISGEDAAKAFVHFGINSSIKPRTAT
FT                   FTPLYDKDGEVIDEAIVVYFVAPNSFTGEDVVEFHTHGSFAVIKMILAELGKIFVPAGP
FT                   GEFSLRAFLNNKVDLTRAEAIVDLINSETEMQAKQAIRQMSGVLEKLYQNWRQQLIDIL
FT                   SNIEAYIDFPEEVNSSAIANIDYLLNNLQKSLESHLNDDRRGERLRQGIYVTILGEPNS
FT                   GKSTLFNHLAKRDIAIVSEYAGTTRDPLEAHIDVAGYPIIIIDTAGIRESTDPVEQEGI
FT                   KRAKLKAENADFKIVMLPYEKRDIFNREIMSLIDDKSICILSKADNITDQKLIPVFDFS
FT                   FIPISVYCNIGIENLLNLIKQKVEKDFQFCNTDPFITSERQRKHIQNTLNIIKSVDLSL
FT                   PMEIVSEDLRLSVRELGKVVGVISDDDILDNVFGKFCIGK"
FT   gene            complement(54360..54902)
FT                   /locus_tag="ECH_0061"
FT   CDS_pept        complement(54360..54902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0061"
FT                   /product="putative flavoprotein"
FT                   /note="identified by match to protein family HMM PF02441"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45107"
FT                   /db_xref="GOA:Q2GI41"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI41"
FT                   /protein_id="ABD45107.1"
FT                   /translation="MKILLVISGSIAAYKSLDLIRKLQENNHTVTSIISKSGERFVTPL
FT                   SVASLSGNSVYTDADLFHAHKSMHHISLTRSSDIVLVAPATLDIIAKTAHGIADELATT
FT                   ALIASNIPIIMVPAMNPAMWNSKANQRNIHCLKSDNVTIIEPKEGLAICNEYGTGKMAE
FT                   VQEIVSFIENFHKTDKK"
FT   gene            55011..57050
FT                   /gene="recG"
FT                   /locus_tag="ECH_0062"
FT   CDS_pept        55011..57050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ECH_0062"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF01336; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45440"
FT                   /db_xref="GOA:Q2GI40"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI40"
FT                   /protein_id="ABD45440.1"
FT                   /translation="MHNLSIFSSMYMLPGVNNVVGSLLKKLCGGDKIIDLLFHIPQSYV
FT                   DRRTALSEDSVGKIVTFIGTVKCHGFIGRKRKSQYKIVLDTCIGEVSLIFFNYSLKYLR
FT                   SVLKVGSTCVVSGTLIRFLGCLQITHPDYIVTDIKKFQDISIIEPIYPLIRGLTSKRIS
FT                   KLVKLSVRLLPDFPEWIDEKLLRDNRWNSWKESLIKIHHPDTLEAVHLHRARLAYDELL
FT                   SHQISVKMVRKFDYQQGVSIVSKQLYYNDILNKLPFKLTEGQKEVISQITKSQASENRM
FT                   VKLLIGDVGSGKTVVALFAILNVIENGGQVAFMAPTEILAEQHYRWIRAILSDISVDVE
FT                   LLTSKVRKKQNIKKKLQLGECNVVIGTHALFQDGVDFNNLNLIIIDEQQRFGVLQRMRL
FT                   INKSNMADVLFMTATPIPRTLEQVVYGDIDCLRLKDKPHNRLPIQTSIVNIERLFEVIA
FT                   KLQLALQEGNKAYWICPYIEDSELLDIAAAEKRFFTLQEVFGKDVGLIHSRLPKIEKDE
FT                   VMMSFYNGNIKLLVATTVIEVGVDIPDATIIIIENAEQFGLSQLHQLRGRVGRSDKSSF
FT                   CILLHGNMLSKIAYKKLCILRKFQDGFYIAEQDLLLRGSGDVLGIKQSGLSNFKFADIY
FT                   KDQGLISIAVEQAGAILDANKTELGDHFNQLLHMFGYDVSTINY"
FT   gene            57435..58397
FT                   /locus_tag="ECH_0063"
FT   CDS_pept        57435..58397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0063"
FT                   /product="putative NADH-ubiquinone oxidoreductase, homolog"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF05368;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45249"
FT                   /db_xref="GOA:Q2GI39"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI39"
FT                   /protein_id="ABD45249.1"
FT                   /translation="MSIKRVVMFGGSGFIGRYLVKYFAENGYVIRIVTRYPEKAKQLKL
FT                   CGNLGQVEVISGNVANSEEVIEHIRDCNIVINLLGVLYSAKKSTFYDIHAKAAENIAKA
FT                   AKRCKVKLMIHFSAMGITETQKSDYAKSKLIGENLVKSAFPDAVIIRPNLVFGPEDKFF
FT                   NKFAQLSMIFPFLPVIGGGRAVFQPIYVDDLAKFVFSIVENSITDKLYNVCGPCTYSFK
FT                   ELLSFILNVTNRKSKLINISFGVTNILAFFCELRIISIFLKLITGTTDPILTRDQVKFI
FT                   KDMTESHDIYPMNELKEIGVKLSTIENIVPKYLKIYKSF"
FT   gene            complement(59130..59588)
FT                   /gene="dksA"
FT                   /locus_tag="ECH_0064"
FT   CDS_pept        complement(59130..59588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECH_0064"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by similarity to SP:P18274"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45491"
FT                   /db_xref="GOA:Q2GI38"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI38"
FT                   /protein_id="ABD45491.1"
FT                   /translation="MLKKNHNTAFPEDEDDSNYMNHKQLEYFRQKLIKWREVLQKESEE
FT                   LATELLRPQADADLTDMATKEHNIVLILNTRKRNEALIIEINKAIQRIDDGLYGYCEET
FT                   GEKIGIARLEANPITLYSIEEQERREKQQKLYSNDQENDYNNNFLNDN"
FT   gene            59701..60363
FT                   /locus_tag="ECH_0065"
FT   CDS_pept        59701..60363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0065"
FT                   /product="putative heme exporter protein CcmB"
FT                   /note="identified by similarity to SP:P33930; match to
FT                   protein family HMM PF03379"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44861"
FT                   /db_xref="GOA:Q2GI37"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI37"
FT                   /protein_id="ABD44861.1"
FT                   /translation="MGNSSALMYELKLSMSRKGNLLNAIILFILIISTALFTMKNVEII
FT                   KVLPTILWICSISAVHMSMCHLFENDYANGSLEQMLIQESMVELIIFFKILSHWICVGI
FT                   PVSIISMFIDFIILESNIYTTLGLGLSLGISLLVISFISAVGEALVLGRGSGIIIAQIL
FT                   TLPIMIPVLVYFSLVFDSIINGVYRENLMLLGLIIAGVVPISVIFVSFAIRVAVEYD"
FT   gene            60548..60621
FT                   /locus_tag="ECH_0066"
FT   tRNA            60548..60621
FT                   /locus_tag="ECH_0066"
FT                   /product="tRNA-Val"
FT   gene            60648..61568
FT                   /locus_tag="ECH_0067"
FT   CDS_pept        60648..61568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0067"
FT                   /product="cation diffusion facilitator transporter family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45583"
FT                   /db_xref="GOA:Q2GI36"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI36"
FT                   /protein_id="ABD45583.1"
FT                   /translation="MSLIHKNKPSNHENKLIYAIFIIIITMVVEVVGGIISNSLALLSD
FT                   AGHMFTDFISLLLSWLAYKVAMKKSDSCRSYGYHRFQVVAAFINGLTLFGIAILIILES
FT                   IKRFFSPEEVCWEIMMSVAILGLIANVVSFFLLYRKNESNLNLKSAVLHVVGDLLGSVA
FT                   AIVASVVIMFTSWQIVDPLLSVFVSIIILGGAYRIIKNSGHILLEGTPDNIDPDKIRKT
FT                   VSENIAEVLDIHHIHIWSLTTDHPIMTMHVKLDKAAVTDNLKYSQVLVSIKKLLSRDFG
FT                   IIHVTIEAEYDNCADDSVMIKTAHN"
FT   gene            complement(61470..61691)
FT                   /locus_tag="ECH_0068"
FT   CDS_pept        complement(61470..61691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45153"
FT                   /db_xref="GOA:Q2GI35"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI35"
FT                   /protein_id="ABD45153.1"
FT                   /translation="MLYDVTLPPFNILKISIKKNIIKILTYQIIVSHLITVHTVNLIMS
FT                   CLNHNTIISTIIVFSFNSNMNNTKISAQ"
FT   gene            61872..62501
FT                   /locus_tag="ECH_0069"
FT   CDS_pept        61872..62501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25655.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44970"
FT                   /db_xref="GOA:Q2GI34"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI34"
FT                   /protein_id="ABD44970.1"
FT                   /translation="MINSYICRLFVISLLFLFNNAFAYDATEACREHVRPCYFIVALKN
FT                   QVEITVRDIKDKAKMYAGIQSIVDRVLNIKDISRFVLGSYWNTMSADEQEKFISEYSKY
FT                   IKRMYSKQLCKYSVYDMNILSIKSPKADHYLINTRLSHEKDVNNFLMVEFKLINTGNGF
FT                   LLSDIKINSAISFSITQRSMIKNMISKQGIDGMISYFQLENASAKY"
FT   gene            62532..62654
FT                   /locus_tag="ECH_0070"
FT   CDS_pept        62532..62654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44652"
FT                   /db_xref="GOA:Q2GI33"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI33"
FT                   /protein_id="ABD44652.1"
FT                   /translation="MYSIQIIISTIVVICCFNFSSDNLCCCTQDTVLNIGFALL"
FT   gene            complement(62982..63269)
FT                   /gene="rpsT"
FT                   /locus_tag="ECH_0071"
FT   CDS_pept        complement(62982..63269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECH_0071"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45109"
FT                   /db_xref="GOA:Q2GI32"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI32"
FT                   /protein_id="ABD45109.1"
FT                   /translation="MANHPSAKKMIKVIKKRTMVNRMRKSRAHNYVKKFMAALAAGNKE
FT                   LMIETFKKAESNLHKCVNKKIIHRNTAARKISRMALKLKAFDLQQQAKAV"
FT   gene            complement(63477..64187)
FT                   /locus_tag="ECH_0072"
FT   CDS_pept        complement(63477..64187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0072"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45561"
FT                   /db_xref="GOA:Q2GI31"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI31"
FT                   /protein_id="ABD45561.1"
FT                   /translation="MLFYILSTLFTVLHAVIFLPLYLIFPMSLKIKCSVHGIKVILSFC
FT                   KIIDKVDYEIRGYENLPDNSPYIIASEHQSPLETLILFTIFKDPVYILKKELKHFPIFG
FT                   IYFMLLKMIFIDRKQKVQALKHILAATSLRVQEGRTVIIFPQGSRIIPGEKVTIKPGIA
FT                   AMYNKLSIPVVPIAVNTGLFWPASIFPAKKRPGKAILQILAPIYPGLTKQEFTNELETR
FT                   ISTASNLLIKEALK"
FT   gene            65137..65703
FT                   /gene="def"
FT                   /locus_tag="ECH_0073"
FT   CDS_pept        65137..65703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="ECH_0073"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45529"
FT                   /db_xref="GOA:Q2GI30"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="PDB:3OCA"
FT                   /db_xref="PDB:3U04"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI30"
FT                   /protein_id="ABD45529.1"
FT                   /translation="MSVLSIVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGL
FT                   GLAAVQVGVHKRILVMNVPEEFEDSEDIENVEDKIEGYELYGGPYCIINPKIVDISQEK
FT                   VKLKEGCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVF
FT                   LKYLSKFKRDFAIEKVKKKERTDLI"
FT   gene            65718..66503
FT                   /locus_tag="ECH_0074"
FT   CDS_pept        65718..66503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0074"
FT                   /product="uracil-DNA glycosylase, family 4"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44794"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI29"
FT                   /protein_id="ABD44794.1"
FT                   /translation="MSDLDLLEVLKFYHENGIDCTLEDVQYNVFTSKNLSLQNSSDTGY
FT                   CMKEKQASIKENTEDYYLLKAQSLAEQCNTIEQLKSAVESFDGCDIKNLATNTVFADGN
FT                   PKARVMLIGEAPGANEDLKGIPFCGASGMLLDKMLQAIGFDRTTVYISNAVFWRPPGNR
FT                   RPTDFEIAVCKPFVEKHIALIVPQMLVLVGSTACYAMLDSKNPISRLRGRFHSYSNQFL
FT                   QHSITTGIIFHPSYLLRQPMQKRLAWEDLKQIKRYFDTL"
FT   gene            66855..66980
FT                   /locus_tag="ECH_0075"
FT   CDS_pept        66855..66980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44845"
FT                   /db_xref="GOA:Q2GI28"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI28"
FT                   /protein_id="ABD44845.1"
FT                   /translation="MVNGFNISLMFCIMLKNVQGYKSFFITTGNLIVVVIACTYF"
FT   gene            complement(67044..68162)
FT                   /locus_tag="ECH_0076"
FT   CDS_pept        complement(67044..68162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0076"
FT                   /product="putative DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P49999"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45217"
FT                   /db_xref="GOA:Q2GI27"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI27"
FT                   /protein_id="ABD45217.1"
FT                   /translation="MSSIEKSYINNLRLVNFRNYINLELDTSSKSVVLLGKNGAGKTNI
FT                   LEAISLLSKGTGIRGVNTESMQNSLSNSPWSVSYQMHTQNGIYPIAISRNHNKRAILIS
FT                   NKNQSYTTLHKITSIIWLIPQLDHIFLKSQSERLRFFDRIAHIFDTKYAIHIIKYNKAK
FT                   QERSKLLYNNSIDNFWLSSLESIIAENGINIARIRFNVLQTLQNTLSQNSKSHAFFKAI
FT                   IKIQSQVFNLLDQENSIELYKEHLKNNRSKDSLSNLVNFGVHNDNFQIFHSEKNLIANY
FT                   CSTGEQKILLLSLILSSVFAKQNIGEYPILLLDDVMSHLDAYHQEKLLEIIRDIKCQVW
FT                   LTDIDLTQQNFTKHKEYFKFFHVANNTATLLQ"
FT   gene            complement(68695..69606)
FT                   /gene="argF"
FT                   /locus_tag="ECH_0077"
FT   CDS_pept        complement(68695..69606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="ECH_0077"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by similarity to SP:Q51742; match to
FT                   protein family HMM PF00185; match to protein family HMM
FT                   PF02729; match to protein family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45030"
FT                   /db_xref="GOA:Q2GI26"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI26"
FT                   /protein_id="ABD45030.1"
FT                   /translation="MNKANICSFTDLNLHTKEELRTILDYSSIIKKKPNQYSKHLLNKN
FT                   IALIFLQPSTRTRISFEVGINQLGGNAIILNEKDTQLTRGESIYDTAKVLSRYVDLIVI
FT                   RILEHNSLLELDKHSTVPVINSLTQHSHPCQVLADIMTYEEKTGPIENATVSWIGDFNN
FT                   MLVSWIHAATVLNFKLNISTLEYSKNLDLLLKSAQEKGNNITYDANPHNIISDADIITT
FT                   DSWISMGYENNIKTEFFKYQVNAKLLEKAKPNYMFLHCLPAHRGEEVTSEIIDGPNSYI
FT                   FDEAENRLHIQKAIMLWCLNLL"
FT   gene            complement(69599..69769)
FT                   /locus_tag="ECH_0078"
FT   CDS_pept        complement(69599..69769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45344"
FT                   /db_xref="GOA:Q2GI25"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI25"
FT                   /protein_id="ABD45344.1"
FT                   /translation="MRLSRLHKKAFSSEDVKQQEKQKLHLIISTNNSSSNIVFHINSKS
FT                   QILEPGYKMYE"
FT   gene            complement(69937..70341)
FT                   /locus_tag="ECH_0079"
FT   CDS_pept        complement(69937..70341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45545"
FT                   /db_xref="GOA:Q2GI24"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI24"
FT                   /protein_id="ABD45545.1"
FT                   /translation="MTTKNTPKTQKGKNTTTKPKTKKATTTSTSEFGSTNTNDTVQDTS
FT                   LTAQTHSTNTTTNNSEFWDTNTNNTTQTTSPSTQTSYGTDPTLSDMDLINLKKVESNET
FT                   EIIYESNTTKQSNFFKDLWYSLKGYFSSAQ"
FT   gene            70668..73502
FT                   /gene="polA"
FT                   /locus_tag="ECH_0080"
FT   CDS_pept        70668..73502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="ECH_0080"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P00582; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF02739; match to
FT                   protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44945"
FT                   /db_xref="GOA:Q2GI23"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI23"
FT                   /protein_id="ABD44945.1"
FT                   /translation="MRVFTIIDAYGLLFRAYYALPNLRTSYGLPIGGVYGFINIFLKYI
FT                   EKHVTDYLVVVFDTGSKNFRHNIYPEYKGNRPKLPDDLIPQFSLLREAVNAFNIASEEV
FT                   VGYEADDVIATLSKKYCKLQGVKVTVVTSDKDLLQLLKYNICIFDPIKNKYIEEEDVQS
FT                   KFGISSNQLLDFLSLTGDASDNVPGIPGIGVKTAAKLLNDFGSLDNLLLHVHEVKTNKC
FT                   RESITQYSDQAILSRQLVTLCDEVDICGDIEKYSFQISGIQELVEFLKKYELQSLMNKV
FT                   DKFFKVGNASSAVNQNTSSSDKTMGGDKVIHHEPQSSMNEVDKFFKVGNASSAVNQNAS
FT                   SSDKTMGGDKVIHHELQSSMNKVDKFFEVGNTSSTVNQNASSSDKTMGGSEVIHYSTES
FT                   LKVFLENCKGEGIMAFYMEMADNVIDSVSLSYKDDILLYIDKDHVTDALELIKPVLGLN
FT                   YVLKVIYDVKTLLKVIPDVEIVAFDDIMIMSYILSPSVHDHSLQEIINYNVKQDVVNVK
FT                   TAITLLLLHKLLKKNLFVNQLYTIYERVEKPLIRVLDSMEKVGMLIDIDILKTLSSTFS
FT                   EKVSVLENEIYRLAGTEFNIASSKQLGTVLFDKMGIKKSKKLSSGSYSTDAEVLNDLVF
FT                   NEIEIADKILQWRHFTKLKSTYTDALGKQINSNSGRIHTFYSMISTATGRLSSSNPNLQ
FT                   NIPIRSEEGNAIRRAFVARKGYKLVSADYSQIELRIMAHIAGVQAFKDAFFLDQDIHSI
FT                   TAEQIFCTQSLDKNLRRKAKSINFGIIYGMSAFGLAKQLGISRSEANAYIDNYFKSYPE
FT                   IQSYMNNIKIYAKTYGYTRTIFGRKCFIRDINSSNAAARNFSERAAINAPLQGTSADII
FT                   KMSMIHLFDKITHGSLILQVHDELLFEILEEYVDYAVEVITKVMEGIVKLSVPLKVDIR
FT                   IGTNWADLVPYSKK"
FT   gene            73739..73831
FT                   /locus_tag="ECH_0081"
FT   CDS_pept        73739..73831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44552"
FT                   /db_xref="GOA:Q2GI22"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI22"
FT                   /protein_id="ABD44552.1"
FT                   /translation="MWFSEFCALEKENVNFTEKHFFNIFNLELV"
FT   gene            74019..74705
FT                   /gene="rpe"
FT                   /locus_tag="ECH_0082"
FT   CDS_pept        74019..74705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="ECH_0082"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45303"
FT                   /db_xref="GOA:Q2GI21"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI21"
FT                   /protein_id="ABD45303.1"
FT                   /translation="MLTKKNSFNRGKVVEVSSSILSADFANLGKSVEMLTDAGVDYIHV
FT                   DVMDGNFVPNITIGPVVVSAIKKYTTIPFDVHLMINSPGNYIEAFVDAGADMITIHAES
FT                   DIHLDRIIQKIKSYKKSAGLSLVPTSHYNILEYIIFELDLVLIMTVNPGFGGQQFITSQ
FT                   LDKISCVRNLIEKYSLKTKIAVDGGVNIKNAKSVIEAGADILVVGSAIFNANNMLDYVQ
FT                   QLKSSF"
FT   gene            74724..74828
FT                   /locus_tag="ECH_0083"
FT   CDS_pept        74724..74828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44547"
FT                   /db_xref="GOA:Q2GI20"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI20"
FT                   /protein_id="ABD44547.1"
FT                   /translation="MNADVYFPFNDIIAFSYVFICNCNIELIVTFDAV"
FT   gene            75298..76125
FT                   /locus_tag="ECH_0084"
FT   CDS_pept        75298..76125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14650.1; match to
FT                   protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45228"
FT                   /db_xref="GOA:Q2GI19"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI19"
FT                   /protein_id="ABD45228.1"
FT                   /translation="MLLKSIWCIIMRFLCLHLVPFWLLETIGRYVINVIFNVGHSFIFF
FT                   VKFVYNCFVPPYYYGVILKQFIEIFFFSLPIVGITAIFTGAVLILQNSLIIHNNVSGDF
FT                   VSGVVVVAIVRELGPVLIGLIIAGRVGAAIAAEIGTMRITEQIDALFTLDTNPFKYLVV
FT                   PRIISAMVAMPILILCADLIGAYGGYIVGSYQLGYTSEMYIKGVIKFLHAKDVALGLVK
FT                   ATVFGFIISFMGCYSGYYCSGGARGVGLATTYVVVVSSMFIILFNYIITVFYS"
FT   gene            76137..76853
FT                   /locus_tag="ECH_0085"
FT   CDS_pept        76137..76853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0085"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45093"
FT                   /db_xref="GOA:Q2GI18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI18"
FT                   /protein_id="ABD45093.1"
FT                   /translation="MNYISLSDLHIDFHGHQVLKGISLDIAYGESLVIVGESGSGKSVL
FT                   TKTILGLIAPTSGKVIVSGVDIRHDKSLIKNFGVLFQNCALFDSLTVCENIAFNLHYRF
FT                   NRDKQLSRKIAASGLNLVGLSSDVLDRYPIELSGGMKKRIALARAIVSEPKIMILDEPT
FT                   SGLDPIMSDVVNEIIIKCHKEFNLTVITITHDINSAFKIASKIAVLYDGKIVACESVQD
FT                   IKNIDNQYVRNFICRN"
FT   gene            complement(76896..77051)
FT                   /locus_tag="ECH_0086"
FT   CDS_pept        complement(76896..77051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45163"
FT                   /db_xref="GOA:Q2GI17"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI17"
FT                   /protein_id="ABD45163.1"
FT                   /translation="MSSASKDSNMLINDGSKFNILLNIRGLVYLAIAILRIINILIPNY
FT                   IKLLHI"
FT   gene            76933..78783
FT                   /locus_tag="ECH_0087"
FT   CDS_pept        76933..78783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45150"
FT                   /db_xref="GOA:Q2GI16"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI16"
FT                   /protein_id="ABD45150.1"
FT                   /translation="MLIMRRMAIARYTKPLIFSKILNFDPSFINMLESLEAEDILLLKD
FT                   ELGSVFYYLIMSLYDVSGIQNDSSGAIRERLKRVLLDAIEQSNSDQSGAVGSQVSEIRE
FT                   IRDRLRSAYQSISNRVCRTLISALGNETLQEETDSNITQQSNLQRRLQMFQYVIQAVEI
FT                   LADKLNTAVVEGKVSPEQVSEYLSCTNESHDSIAPDTMSALVKLYSLTDDPQLTDLAYS
FT                   LVKTFLMKFGRYKLDGQGRNSMHYAVNMCSPERQESFLCEMIQPSIYERVSIVNEVDAS
FT                   RNNLMHYAACAPYMNYQILKYLVKNFPAMMTQQNCYGDTPLHIMSYVYFVNFAKILSSY
FT                   NITYRENMNALKEVVDRGLPLSQMRERVMSIRRNDEALSRQLKAYVDESVGTYQLLLTM
FT                   VPLRQIFEVRNNAGHTVYDIMNASMSNIGNERLEALLQDFSQASSRLPIYDCRIDSQHE
FT                   LCVNLCFSNKYRVVGKSGYGHVLYTHVKRMYDLISYKFSEISDSRMRCIKIENERGNNR
FT                   YLSMLVVMMLMALCVLNTVLHFKTRSILGIEQGLYRSVLFSAISVVFFVSICVFCIVYA
FT                   KYVDVADKKLIIEEEGYARSILLSHLDVQETDTSQRRREG"
FT   gene            complement(78843..79820)
FT                   /gene="ispB"
FT                   /locus_tag="ECH_0088"
FT   CDS_pept        complement(78843..79820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="ECH_0088"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by similarity to SP:P19641; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44545"
FT                   /db_xref="GOA:Q2GI15"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI15"
FT                   /protein_id="ABD44545.1"
FT                   /translation="MTNDFSNTFLQLKSLVQQDLDSMESLILHQNNKHITLITEIVQHL
FT                   IKSGGKRIRPIIFFIICKMLNCNNENKVPIAAAIELIHNATLLHDDVIDESELRRGEKT
FT                   SNVIWGNKASILVGDFLLAISFQWLIKCKNLNILSILSQASKDVIVGEVQQMISSHNIN
FT                   ISKEKYIEIISAKTAALFSATCESAANLAQTSNEEKEALKNFGNNFGISFQIMDDILDY
FT                   TASGEQFGKKLGNDLLTGKTTLPVIIAYQNATSKEKKFWDQISVNPNLEQAISYIKVHN
FT                   AIEKSISIATTYINQAKSCLNIFAESNYKTHLNKLLDCILYREC"
FT   gene            complement(80016..81428)
FT                   /gene="glnA"
FT                   /locus_tag="ECH_0089"
FT   CDS_pept        complement(80016..81428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="ECH_0089"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by similarity to SP:P05457; match to
FT                   protein family HMM PF00120; match to protein family HMM
FT                   PF03951; match to protein family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45316"
FT                   /db_xref="GOA:Q2GI14"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI14"
FT                   /protein_id="ABD45316.1"
FT                   /translation="MFLSIEDTLNYIKKNAINFIDLRFTDSNGKWHHITRSAETINAQV
FT                   LLAGVNFDSSSIPGWQSIEKSDMILLPDVSTAFMDPFSAQSTLVILCNIVDPYKQSQYS
FT                   KDPRYIAQKAYKYMLSTGIADKCYFGPEVEFFIFDNAQFYAGMYNSYFKIDSAEHDILF
FT                   QKREFSNNSHRPKVKGGYMPTPPIDSLHDIRSEMLTMFKEVGIIPLIHHHEVAASQCEV
FT                   GFQHDELLLSADNVQKCKYIVHGVASSYGKTATFMPKPVIKDNGSGMHCHQSLWKDNVN
FT                   IFVNPDGSISETCLYYIGGIIKYGKAINAFTNPSTNSYKRLVPHFEAPTWLTYSYENRS
FT                   SAIRIPYVPKNDLNAKRIEARFPDPLANPYLCFSAQLMAGLYGIQNKIHPGPAIDKNLY
FT                   SLDKEELQQFTSVASSLEEALDSLDNNREFLLVGDVFTNDQIDAYINLKMLEVKDLQLH
FT                   PHPIEFINYYSS"
FT   gene            81623..81695
FT                   /locus_tag="ECH_0090"
FT   tRNA            81623..81695
FT                   /locus_tag="ECH_0090"
FT                   /product="tRNA-Lys"
FT   gene            81723..82979
FT                   /gene="tyrS"
FT                   /locus_tag="ECH_0091"
FT   CDS_pept        81723..82979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ECH_0091"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by similarity to SP:P00951; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45429"
FT                   /db_xref="GOA:Q2GI13"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI13"
FT                   /protein_id="ABD45429.1"
FT                   /translation="MKLESQFLSFLYSRGYCSQCTNISMLDQLMSQQCVHAYIGFDCTA
FT                   KSLHVGSLIQVMILRHLQKFGHKPIILLGDGTTKIGDPSGKDKSRAMLSASEIEENALG
FT                   IYEVLKKFIVFGDGPHDALLVRNAEWLNGLNYIEFLRDIGKHFSVNNMLTFDSVRLRLE
FT                   REQNLSFLEFNYMLLQSYDFVELNRRYNCLLQIGGSDQWGNIVSGVELGRKLRLPELFG
FT                   LTTNLLLTSSGEKMGKTAQGAVWLDGNMYSPVDYWQYFRNVKDEDVGRFLRLFTELSLN
FT                   EIRNLELLQGHEINESKKILATEATRICHGEEIAQSVANDALKVFECNDDSGLSVFYVK
FT                   KYDVELGLPIIKLLQMCEMEKSSSSARRLINDKGCKINDVVVLDMNYKLSLKDFYNTSY
FT                   VKLSCGKKRHLKVMLESDF"
FT   gene            83016..84221
FT                   /gene="hemA"
FT                   /locus_tag="ECH_0092"
FT   CDS_pept        83016..84221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="ECH_0092"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="identified by similarity to GB:BAA35068.1; match to
FT                   protein family HMM PF00155; match to protein family HMM
FT                   TIGR01821"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45539"
FT                   /db_xref="GOA:Q2GI12"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI12"
FT                   /protein_id="ABD45539.1"
FT                   /translation="MIDYEEIFCSKIKRIKDEGRYREFTGFSRIPGQFPYAIECDVNNV
FT                   VTLWCSNDYLGMGQNEHMILAIKNYSSSVGAGGTRNISGTTKEIIELEKSLADLHKKPA
FT                   ALTFVCGYIANQTTISTVLSVIPDIVVFSDEKNHSSMIEGIRSTNRAKHIFRHNDLNHL
FT                   ETLLKSVDISVPKIIIFESLYSMDGDIAPIAKICDLADKYNAITYLDEVHAVGMYGSRG
FT                   GGISEQENISDRVTIIQGTLSKAFGVMGGYITGSKNVVDVVRSFAPGFIFTTALSPLIA
FT                   SSARISVEHLKNSSIEREKQREVVNKVKESFSKAGIDFVKTDTHIIPVIIGDSVACTEI
FT                   SRVLLKEYRIYIQSINYPTVPVGTERLRITPTPYHTDEMIDKLTQALVDVLCRFKIMNK
FT                   QN"
FT   gene            complement(84218..84586)
FT                   /locus_tag="ECH_0093"
FT   CDS_pept        complement(84218..84586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8XJQ1; match to
FT                   protein family HMM PF02021"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44964"
FT                   /db_xref="GOA:Q2GI11"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GI11"
FT                   /protein_id="ABD44964.1"
FT                   /translation="MFTKKNYKRVIYNIVGYLGEILIIWFLKCKGYYIIKHRYKCILGE
FT                   IDIIACKNKYLAFIEVKTSIFGSEIPITNKQQRSIIKAAKSFITYHTKFEEYNIRFDLY
FT                   FFSLSKGLIHIPHAWQEF"
FT   gene            84585..84725
FT                   /locus_tag="ECH_0094"
FT   CDS_pept        84585..84725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45392"
FT                   /db_xref="GOA:Q2GI10"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI10"
FT                   /protein_id="ABD45392.1"
FT                   /translation="MYGDIVSKISLVYKVFYIEKDNSIMFNAFICLRGHLYLYYKKYNA
FT                   F"
FT   gene            84942..85823
FT                   /gene="secF"
FT                   /locus_tag="ECH_0095"
FT   CDS_pept        84942..85823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECH_0095"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by similarity to SP:P19674; match to
FT                   protein family HMM PF02355; match to protein family HMM
FT                   PF07549; match to protein family HMM TIGR00916; match to
FT                   protein family HMM TIGR00966"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45091"
FT                   /db_xref="GOA:Q2GI09"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI09"
FT                   /protein_id="ABD45091.1"
FT                   /translation="MVFLSDINIDFSKYRICALSCSGVLMLISILLVLLKGICFGTDFA
FT                   GGIIIELRADQVDVKSVNLKLQENGFVGFSVQGFKNNDRELMVRFKNEKDSDQSDTVEK
FT                   IKGVLNKILGEVTYLKIDYVGPQVGYKQIFEGLCAIIFSLLGMFLYLWVRFQWRFALGG
FT                   VLALIHDVVLTLGLVSLCNIEFNLSSTAAILTVIGYSVNDSVVIYDRIRELLKKKLQKK
FT                   LSDVINISINATLSRTILTSGTTMLASVPLMLLCQGTVRELSIIVFFGIAVGTYSSIFI
FT                   ATTSLSNDINKT"
FT   gene            complement(86232..86306)
FT                   /locus_tag="ECH_0096"
FT   tRNA            complement(86232..86306)
FT                   /locus_tag="ECH_0096"
FT                   /product="tRNA-Cys"
FT   gene            complement(86306..87223)
FT                   /gene="fba"
FT                   /locus_tag="ECH_0097"
FT   CDS_pept        complement(86306..87223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="ECH_0097"
FT                   /product="fructose-biphosphate aldolase, class I"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by similarity to SP:P71295; match to
FT                   protein family HMM PF01791"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44724"
FT                   /db_xref="GOA:Q2GI08"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI08"
FT                   /protein_id="ABD44724.1"
FT                   /translation="MCRNFVLANNRIQDILGFYESENPGVKANLMRMLLHGKVAGSGKL
FT                   LILPVDQGMEHGPTKSFSKNPQSYDPHYHFLLAIEGGFSAYAAPLGMLEAGASTYAGLI
FT                   PLILKLNSSTLLSPKNSFPDQVVTSSVKDALRLGCSAIGITIYPGSHNFFSMVRETREL
FT                   IAEAKAAGLAVVIWSYPRGNDISKQGETAVDIVAYAAHIAASLGANIIKVKLPTSNIER
FT                   DSIPYDITSLKQRIEYIKLSCFSGRRLVVFSGGEAKTDEELLQEIQSIKLGGGDGSIIG
FT                   RNSFQRPKNDAISMVGKIAKIYHN"
FT   gene            87593..88843
FT                   /gene="pdhC"
FT                   /locus_tag="ECH_0098"
FT   CDS_pept        87593..88843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="ECH_0098"
FT                   /product="pyruvate dehydrogenase complex, E2 component,
FT                   dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by similarity to SP:Q9R9N3; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01349"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44627"
FT                   /db_xref="GOA:Q2GI07"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI07"
FT                   /protein_id="ABD44627.1"
FT                   /translation="MPIEVLMPALSPTMKSGTIRKWYKAEGDVVKSGDVIADIETDKAV
FT                   MECEYTDEDGIMGKIFFAEGSKNIEVNQLIALIAVDEQDLAKVHSYEKGDNVVKNELVA
FT                   LQDSQPAQDESVVLQMNQQIVNASEVLVNSSNSSERVKVSPLAKKIASNLGVDVNLVKG
FT                   TGPYGRIIKADILDVINQHGHIANSPEDASFTEISSMRRVIAERLVYSKQTIPHFYVSI
FT                   DCLVDSLLKLRLEINAENPDTKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVVFPSID
FT                   ISVAVSIDNGLITPIIFGADKKSLLEISREVKALASKAKSGKLKPEEFQGGGFTVSNLG
FT                   MFGIKEFYAIVNPPQSCIMSVGCSEKRAMVVNEQICISNVVTVTLSVDHRVIDGVLAAK
FT                   FLNCFKSYLEKPFLMLI"
FT   gene            complement(88913..89041)
FT                   /locus_tag="ECH_0099"
FT   CDS_pept        complement(88913..89041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45281"
FT                   /db_xref="GOA:Q2GI06"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI06"
FT                   /protein_id="ABD45281.1"
FT                   /translation="MYPNLHIHLYFCKFFSLNNMTEQLWPIHINNKQHNKVKNKVR"
FT   gene            89325..89423
FT                   /locus_tag="ECH_0100"
FT   CDS_pept        89325..89423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45578"
FT                   /db_xref="GOA:Q2GI05"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI05"
FT                   /protein_id="ABD45578.1"
FT                   /translation="MPLIKNSVVGGLIYLIFFQYYGVKRMKQQEFL"
FT   gene            89490..89609
FT                   /locus_tag="ECH_0101"
FT   CDS_pept        89490..89609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45193"
FT                   /db_xref="GOA:Q2GI04"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI04"
FT                   /protein_id="ABD45193.1"
FT                   /translation="MQILLWVQQHLSNFYRGYARNPRMMGQDIILCKNNLEKY"
FT   gene            89972..90157
FT                   /locus_tag="ECH_0102"
FT   CDS_pept        89972..90157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44958"
FT                   /db_xref="GOA:Q2GI03"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI03"
FT                   /protein_id="ABD44958.1"
FT                   /translation="MKFGRVHHIGFYRQLFQMLCNLISLRSSDPEFSTEILDLAMVSVS
FT                   MMLSTMCNNYRCLLNE"
FT   gene            90467..90658
FT                   /locus_tag="ECH_0103"
FT   CDS_pept        90467..90658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45311"
FT                   /db_xref="GOA:Q2GI02"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI02"
FT                   /protein_id="ABD45311.1"
FT                   /translation="MYSINDDGVICVDSIPLPRITLERCDENFAARVQQSIVDNSMNFS
FT                   VLIEDLASRVVHNIICLV"
FT   gene            90646..90771
FT                   /locus_tag="ECH_0104"
FT   CDS_pept        90646..90771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45565"
FT                   /db_xref="GOA:Q2GI01"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI01"
FT                   /protein_id="ABD45565.1"
FT                   /translation="MSSVAACEEAIEAYCALYDEVICSVKKIKLEDYKLNCYSIF"
FT   gene            91064..91249
FT                   /locus_tag="ECH_0105"
FT   CDS_pept        91064..91249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45459"
FT                   /db_xref="GOA:Q2GI00"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GI00"
FT                   /protein_id="ABD45459.1"
FT                   /translation="MFELFIVITSIVGGATALFGLMAGSDKVVKKNKRKSRRQGLIEEG
FT                   HDKLRNQAKNKLKSKM"
FT   gene            91330..93471
FT                   /locus_tag="ECH_0106"
FT   CDS_pept        91330..93471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44683"
FT                   /db_xref="GOA:Q2GHZ9"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ9"
FT                   /protein_id="ABD44683.1"
FT                   /translation="MGGVDGASGLQHVPGTYESSQLKPETGDSDTLSSELQDQYLRQGA
FT                   KPKKRAQGSMRQATVPVVSTTEEVETQSSKKDKYRVRVPYRVRVPFIPRFARLEEEQQH
FT                   LQSQQSDAGTSESVVRKREACEPEKKHVAKVKPSKPSTKPFIPRFARLEEEQQHLQSQQ
FT                   SDAGTSESVVRKREACEPEKKHVAKVKPSKPSTKPFIPRFARLEEEQQRLQSQQSDAGT
FT                   SESVVRKREACEPEKKHVAKVKPSKPSTKPFIPRFARLEEEQQRLQSQQSDAGTDKDSL
FT                   QRAEALTMREPGFPKMYTPQYPVRILQRVQHKKDDAVVSKGVVEGSAGDVEQGFARLQI
FT                   QGDEASGAVEVGGSQVSTGLESVLVSKGSSVFNVAYFPKFGRGSKSKRLSGRKYRVLQE
FT                   EYRLQLWDFTDMHLQHARFIVRKMFCLECGVVRLKKDLLSFIGNRIENPEFCILIFKVA
FT                   CLGHCMSVTNIIKFYHSLFYNEIDDQVLEECVQDIVIYAQDTELSITKIAGVFSNSYTS
FT                   YVSKNTVPHPPGFYRHVLRLLCNLVSARVSDPECPVDVLDCVIVCAAQLLGTVYNNYKS
FT                   FTKMQGVNIDNMSFFSVVENMGSTRHCCGQLGLVCYGLLNCMTYMYSVNDNGVKNVGGL
FT                   AMPKIVVERCSEHFYGVVERNMASGNMGFHVIMGDCAARVCAAVDRYNVMACEDEIAGY
FT                   EGIYNQVMRSSKEEKGPQR"
FT   gene            complement(94133..94228)
FT                   /locus_tag="ECH_0107"
FT   CDS_pept        complement(94133..94228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45441"
FT                   /db_xref="GOA:Q2GHZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ8"
FT                   /protein_id="ABD45441.1"
FT                   /translation="MTTAIAAAVTTATIENNIITHLIYMIGKRIY"
FT   gene            94233..96710
FT                   /locus_tag="ECH_0108"
FT   CDS_pept        94233..96710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44491"
FT                   /db_xref="GOA:Q2GHZ7"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ7"
FT                   /protein_id="ABD44491.1"
FT                   /translation="MSGDEIKKAASKSSGKKGRAKSSKTSSQVQKSLEPVTSAGEQAPT
FT                   VQQEEIVQLPSDSQFESSNQDIVQTEEQVVKKKEDVKSGDQSQKKAVKKKLVLRDFYSG
FT                   FKGSSEKVQVDITGGPITGQPTMLSYAERARIGISSKEKGKAVGQPITLSCSEKASSSV
FT                   KGKKGPHAVSQEGYVVQKGDPGSKYLGEEVKPKVSGIQPIKVKEESKSSSISESVVKLS
FT                   DQPSRKSLKKLVLGDSKAGSVPGVLKSPIEGDTVARPSLSYAEKVRIGISSKEKEAAVS
FT                   QPTELICSEKASSGVKEKKSPHTVSQEGSQEGYVVQKEDLESKYLREGAKPKVSGIQPL
FT                   KVQEEIKSSSISESVVKPSDQPSRKPLKKIVLEDTKTGSVPGVLKSPTEGDTVARPSLS
FT                   YAEKVRIGISSKEKEAAVARSAVLSYAEKGKVGISSEKKQSKDPDDVIVLSTSGKSVND
FT                   DLQPVPQVLIPVQVVPAQHIVSRPVIYKHLSYGSKAGYSLAIQQFREEKIWDFAKMHMA
FT                   YVHDSLNYMFFVKNGKLLLKPEIRDLLLKITNNIDLCTFLMKMVMLDHLMSRLCKFYVS
FT                   DSLKYCASHFRNPSLVDNLLIQILSKKRIDCITMSQELRYNLAMCTKGYDAEVFELHDS
FT                   IFYSEVLSLYCEFMHASVDDEQSKTLCSLVELSCALQFGQMYHVLGKSKHMVVEGMNIE
FT                   KMEKDLSEGKDVKQFIFRARIFGGYCYAMRKALRHMYIPTDKNTACAVAGLNVPSRMLK
FT                   VCSKDIAEIIDDHVKRNKMDFSVFVNNMVSSVKRFMVNRHTRFLVREDISIYQAKISSK
FT                   YKTIGPDSQVCSL"
FT   gene            96989..97150
FT                   /locus_tag="ECH_0109"
FT   CDS_pept        96989..97150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45458"
FT                   /db_xref="GOA:Q2GHZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ6"
FT                   /protein_id="ABD45458.1"
FT                   /translation="MIIPVVTTVAAAVVVVITLMNGVGLQKERQNHLRSLVNRRIKRQV
FT                   RVKRHWLM"
FT   gene            97138..97254
FT                   /locus_tag="ECH_0110"
FT   CDS_pept        97138..97254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44583"
FT                   /db_xref="GOA:Q2GHZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ5"
FT                   /protein_id="ABD44583.1"
FT                   /translation="MVDVNGQDVSEKEEKSSFVSEDIEKLSGRSLRRPLEKS"
FT   gene            97293..97403
FT                   /locus_tag="ECH_0111"
FT   CDS_pept        97293..97403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45075"
FT                   /db_xref="GOA:Q2GHZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ4"
FT                   /protein_id="ABD45075.1"
FT                   /translation="MGSRDVDGVHNVGYAKKEEATYNSELTVVHTKNLEG"
FT   gene            complement(98489..98638)
FT                   /locus_tag="ECH_0112"
FT   CDS_pept        complement(98489..98638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45188"
FT                   /db_xref="GOA:Q2GHZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ3"
FT                   /protein_id="ABD45188.1"
FT                   /translation="MYLPDDFDNFLFSPLFINLIIATTAAAAATTGIIIESTFYLLIHI
FT                   LRNI"
FT   gene            98685..101066
FT                   /locus_tag="ECH_0113"
FT   CDS_pept        98685..101066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44833"
FT                   /db_xref="GOA:Q2GHZ2"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ2"
FT                   /protein_id="ABD44833.1"
FT                   /translation="MRTGIVVGVNEQDIAGEEQEMPLSQQFPNLHPESCQDIIKAEDRR
FT                   VGVVTKKKKRKSSPVSKDMIRSSDQLSTGTLKESDEYGKKRKSKNRKTGSPLKQVKTVI
FT                   VVGTNKQDIASEEQEMPLSQQLSDLHPESCDQDIVKAEDRRVCVATKEKRRKSSPISKD
FT                   MIGSSDQLSIGTLKESDEYGKKRKSKNRKTGSPLKQVKTGIVASANEQDIAGEGQGIPL
FT                   SHQLLHFESCDQNIVKVEDRKVHVVTREERKSNPVLEDNEYLKQDAKSKVHAGQAVGQP
FT                   MSCAEKAKAKVSSVEETVGKVCTDQKVKEVSECKNDVYDTSVQHTAVSYVEKVKVGLSD
FT                   DLGKTLLPIDLKRTVSQQDLNSEYLKQSAKSKVHAGQAVGQPMSYAEKAKVSSVKEAVG
FT                   KACTGQKVKGASGFKNDVDETLSASMQHTAVPGMVTPTNIIPARHIVSGVAVFKHLQGY
FT                   SLEEYQSLVENFRKSVACFSKMHMSYAYQILHNTFIVHNGQIVLKPEIEQFLLKTTSNI
FT                   KLCTFIIKIGIVDQVMARLGNSYGCNSIKYCASYYHDSEIIDEILIRFYGTSYSSFSEV
FT                   SQQVRHDTVDCLKKRNVTNVFKLHDSSFYSEVLSVCCNFMGVSNKDIELHKLCSFVQLS
FT                   CCIQIAQMYHMMLKVKYSAGDKQDYAQQCISERLAKGPAIKDFMYRALLFGRCACNVRN
FT                   TFRHLYSPDDKNHIRTVSGLNVPYCMIRVSSKGIIPKIESYIKRNKMDFGVFVDDIVNF
FT                   VRDALYRPGERTCIKEDIKTYHTIVSSRYDNMISNCSVSR"
FT   gene            complement(100824..101192)
FT                   /locus_tag="ECH_0114"
FT   CDS_pept        complement(100824..101192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45067"
FT                   /db_xref="GOA:Q2GHZ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ1"
FT                   /protein_id="ABD45067.1"
FT                   /translation="MSFVFSSTQTPSPGDTTITYHVVYRLLIIEYMFFVLFYTNFFSSG
FT                   NATITYHIVISTTYYSVICFYVFFDTSSFTWTIQCISDKIYYIINKNTKIHFISLNITL
FT                   NFWNNSLTTYSNHTIRNV"
FT   gene            101674..102285
FT                   /locus_tag="ECH_0115"
FT   CDS_pept        101674..102285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44721"
FT                   /db_xref="GOA:Q2GHZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHZ0"
FT                   /protein_id="ABD44721.1"
FT                   /translation="MGDNEAAKESPRKKKKSKNKKTGSPLKQVETRTITIESKQSVDTE
FT                   ERTGLLSEQLSSMHLESCDQDIVKAKGQDVQHLTEKKDGETSHVLLGGTIKPRSRRSGK
FT                   LTLRNVGSASFTTQSVSDAAKVSGASNVGHVEGASCIPDQGSATVGVQSLESKYLKEGA
FT                   KPKVRVGQIVEQSVSYAKKASTGIPIVKKDVKEGGGGEEC"
FT   gene            102482..103588
FT                   /locus_tag="ECH_0116"
FT   CDS_pept        102482..103588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44944"
FT                   /db_xref="GOA:Q2GHY9"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY9"
FT                   /protein_id="ABD44944.1"
FT                   /translation="MQHAAVPGVVASANVIPAKHLVIRGKVFKHVKRYSIEEYKSQIKE
FT                   FRESIACFARMHMSYMYHMLHNTFVVNNGRIMFKPEVEQFLLGITSNMKLCTFVIKIGI
FT                   VEHVMSRICRFYGSDSIKYCASHYRDPKFIDSILVILHDASHFDFSTMSYQVRNSMANC
FT                   VRRYNITSVYELHDSSFYSELLSMCYDFVRAKSNQSVQFQELCDFIKLSSTVQLAQMYH
FT                   MILKTKCSTGNEQDNLQGLLLQERNIESLIYSSVFFGKYACRVRKAFRHLYAPSDKNPV
FT                   RTVSGLNIPYVMIQLNSKGIFAEIEHCVNAEKMDFNVFVRDIVRYINKLLSYPREEGYI
FT                   RADIGKYCAMVSSRYSTMGADIVPSSLH"
FT   gene            103958..104566
FT                   /locus_tag="ECH_0117"
FT   CDS_pept        103958..104566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44585"
FT                   /db_xref="GOA:Q2GHY8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY8"
FT                   /protein_id="ABD44585.1"
FT                   /translation="MGDNEAAKESPRKKKKSKNKKTGSPLKQVETRTITIESKQSVDTE
FT                   ERTGLLSEQLSNVHLESCDQDIVKAKGQDVQHLTEKKDGETSHVLLGGTIKPRSRRSGK
FT                   LTLRNMGSASFTTQSVSDAAKVSGASNVGHVEGASCIPDQSSATVGMQSLESKYLKEGA
FT                   KPKVRVGRTVEQSVSYAKKASTGIPIVKKDVKEGGGGEC"
FT   gene            104763..104855
FT                   /locus_tag="ECH_0118"
FT   CDS_pept        104763..104855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44838"
FT                   /db_xref="GOA:Q2GHY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY7"
FT                   /protein_id="ABD44838.1"
FT                   /translation="MQHTAVPEMVAPTSIIPAKHLVIQGRFTNM"
FT   gene            104912..105868
FT                   /locus_tag="ECH_0119"
FT   CDS_pept        104912..105868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0119"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45210"
FT                   /db_xref="GOA:Q2GHY6"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY6"
FT                   /protein_id="ABD45210.1"
FT                   /translation="MCFAKMHMSYIRRILHGTFVVNNGKIMLKPEIEQCLLGITSNMKL
FT                   CTFVIKIGIVEHVMSRICRMYGSDSIKYCASHYRDPKFIDSILVILHDASHFDFSTMSY
FT                   QVRNSMANCVREYKITNVYELHDSSFYSELLSMYYDFVRAKSNQSVQFQELCDFIKLSS
FT                   TVQLAQMYHMILKTKCSTGNEQDNLQELLLQERGIGHLIYSSVFFGKYACRVRNAFRHL
FT                   YSPDDKNPIHTISGLNVPYCVIRISSRKIIPKVESCIKANKMDFSVFVDDIVHFVKDTL
FT                   YRPGEEVRVRKDISTYCTIVSNRYSTMGADIASSSLH"
FT   gene            106236..106877
FT                   /locus_tag="ECH_0120"
FT   CDS_pept        106236..106877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44559"
FT                   /db_xref="GOA:Q2GHY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY5"
FT                   /protein_id="ABD44559.1"
FT                   /translation="MLMSGDEAAKESPRKKKKSKNKKTGSPLKQVETRTITIESKQSID
FT                   TEERTGLLSEQLSSMHLESCDQDIVKAKGQDVQHLTEKKDGGISHVLLGGTIKPRSRRS
FT                   GKLTLRNMGSASFTTQSVSYAAKVSGTYNVGHVEGASCMLDRESTTVDTQNLESKYLKE
FT                   GAKPKVRVGQTVEQSVSYAKKASTGIPIVKKDVKEGGGGRGMLVKKKLLL"
FT   gene            107054..108160
FT                   /locus_tag="ECH_0121"
FT   CDS_pept        107054..108160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44985"
FT                   /db_xref="GOA:Q2GHY4"
FT                   /db_xref="InterPro:IPR021902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY4"
FT                   /protein_id="ABD44985.1"
FT                   /translation="MQHTAVPGMVAPTSVISAKHVVIKGLVYKHVKHYSIEEYKSQIKE
FT                   FRESITCFARMHMSYMYHMLHNTFVVRNGRIMLKSEIEQCLSKITSNIRLCAFVIKIGI
FT                   VDHVMSRLCRFYGSDSIKYCASHYHDPRVIDSILIGLYGASYSDFSRMSYQVRSNIVYC
FT                   VGKHGIAGVFKLHNSGFYSELLGMCYDFVHARGKGVKLQELCDFMKLSCSIQLGQMYHM
FT                   MVKVKCSIGDEQSDIRKLVSQECSVGYLVYRSLLFGRYAYHVRKAFRHLYAPSDKNPVR
FT                   TVSGLNIPHSLIRLNHRGIFTKIEHCINAEKMSFNVFVVDIVRHIDKLLLHPREEVYIR
FT                   EDISTYCAIVSSRYSTMGPDIDSSYHIL"
FT   gene            complement(108814..109194)
FT                   /locus_tag="ECH_0122"
FT   CDS_pept        complement(108814..109194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44981"
FT                   /db_xref="GOA:Q2GHY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY3"
FT                   /protein_id="ABD44981.1"
FT                   /translation="MTIPKKSTLNKNYDFINKYIIKFKSVIILGTTIMNEELSLDKSLD
FT                   NAMSYVEKGCNTTIDPKMKACIKNEVKSAIPELNKVLTPLITSALNADQKTLSQNQQEE
FT                   LVKNFIEIMMPHMQKIMLTSEQ"
FT   gene            109470..111050
FT                   /gene="guaA"
FT                   /locus_tag="ECH_0123"
FT   CDS_pept        109470..111050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="ECH_0123"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45456"
FT                   /db_xref="GOA:Q2GHY2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHY2"
FT                   /protein_id="ABD45456.1"
FT                   /translation="MSRVAIIDFGSQFTQLLARRIRELNVYSEIFPHDIAFDYIKDSKA
FT                   FILSGGPKSVLDFTGMPPIVHDIIELNKKTSVPVLGVCYGLQLLSNYFNSTIVHGCGQE
FT                   FGKAILNVVKKSEMIKDVWKVGDQPYVWMSHADSVYDTPCGFEVIACSVVNNAIAMISN
FT                   EERRIYGVQFHPEVYHTPDGVKLLANFVRIAGCDNNWTVESFLDEQENLIKKQVGDKKV
FT                   IAALSGGVDSSVAAALTYRAIGDQLHCIFIDNGLLRYNEAEKVRQSFVDQFQMPVTIVD
FT                   RSSVFLDKLQFVTDPEQKRKIIGKTFIEVFEEEANKIGNVEFLMQGTIYPDVIESGGSV
FT                   GKESVTIKSHHNVGGLPDIMKLQLVEPLKLLFKDEVRLLGKKLGISDEILMRHPFPGPG
FT                   LAIRIIGEITQEKVNMLQAADEIYINLIKKYNLYDVIWQAFAVLLPVKTVGVMGDSRTY
FT                   GYTCALRAVTSSDGMTAECFPFGVDLETKIIFYEFLQDVSNTIVNNVQGINRVVYDTTS
FT                   KPPATIEWE"
FT   gene            111706..112956
FT                   /gene="gltA"
FT                   /locus_tag="ECH_0124"
FT   CDS_pept        111706..112956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="ECH_0124"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="identified by similarity to SP:P51033; match to
FT                   protein family HMM PF00285; match to protein family HMM
FT                   TIGR01798"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44823"
FT                   /db_xref="GOA:Q2GHY1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY1"
FT                   /protein_id="ABD44823.1"
FT                   /translation="MVKEAVLELDGQRIKLPVLYDTHGNKAVDITSLYKNTGILTYDPG
FT                   FMSTAACESRITFIDGNKGILCYRGHDIVNLVNNNKSFIEIVYLLFYGVLPGLEDLQNF
FT                   ISQISQEYNPPKIVHDVIKSFPRDSHPMSILMACFSALASCYHNQDNSADQLKCAKLAV
FT                   AKVASIIALIYRYITNQDFVESDTKLSYSENFVHMMFDISSYKFTQVVAKALDIIFVLH
FT                   ADHEQNASTATVRLSGSSGADLFACLVAGTATLWGPAHGGANEAVINMLMAIEKPSNVK
FT                   QFIQKVKDGNKSTRLMGFGHRVYKNYDPRAKIMYKICREVLNNLNVNDPLLEIALELEN
FT                   IALQDSYFIDRNLYPNVDFYSGIVLKAIGIPVRMFTTLFALARTSGWSAQWYEMVAEEN
FT                   YKICRPRQLYTGNIAEC"
FT   gene            113261..114493
FT                   /gene="gshA"
FT                   /locus_tag="ECH_0125"
FT   CDS_pept        113261..114493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="ECH_0125"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by similarity to GB:AAB41630.1; match to
FT                   protein family HMM TIGR02049"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45326"
FT                   /db_xref="GOA:Q2GHY0"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHY0"
FT                   /protein_id="ABD45326.1"
FT                   /translation="MTVIIDTLNDILTKYKLDIENWFFNKFTKYNPVLNISVDLRVSDY
FT                   KIAPVDTNIFPAGYNNFTEQSQIYASRLLREYVVNYANCSKILIIAENHTRNLKYIDSL
FT                   IVLKNIVNNAGFVVEVGICNINQNIELISSTGRVINCLCLTNDNGVLRAGCRFIPDLIL
FT                   VNNDMTSGIPEVLQGLKYQSIMPSLFLGWFNRSKSNHFSIYKKLSKEFCESFNIDPWLI
FT                   SAFFSSCSNICFFNSQGIDDIANEVDVVISKIRNKFQLYSIKEQPYVFVKADNGTYGMG
FT                   ILVAYCGDDILMLNRKKRNKMKKIKDGNVVSSVIIQEGITTREIFNGYVAEPLVYFIGH
FT                   TPSCYLYRYHSVKDRFSNLNSVGCDFIDISYKQQDILYWNIIGKIAVLAAAIEMHEISN
FT                   VNVMEQNCLLS"
FT   gene            complement(114927..115931)
FT                   /locus_tag="ECH_0126"
FT   CDS_pept        complement(114927..115931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14093.1; match to
FT                   protein family HMM PF06144; match to protein family HMM
FT                   TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44490"
FT                   /db_xref="GOA:Q2GHX9"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX9"
FT                   /protein_id="ABD44490.1"
FT                   /translation="MKITSSKLHSFFNNLQLTNNILIYGNDYGKISMYKKKIINHVNTN
FT                   SEFAISNIDFSTVNKNPSTLFIELTTISMFCQNKLIILANGEKSISQELKHVLSNNIGN
FT                   NYIIITSGELSPDSTLRQYYDNSRNAASIGCYKDDNDNLSFIISDFLTKNKVQYNATTL
FT                   QYLHNVLSQNCNALQPELEKLILYIGNNKNLTIQNIQESLLTEIDPISEDLCVSVAEKN
FT                   LENFTKFSDVLLKNKFTPIALIRILIKYFSRLEYLIRTIKNGEPINQAIKSIHPPIFFK
FT                   SIPTIKKHVSAIPYAEINNIIKKLVEIEIQCKKSDSNQEVIFKYYLTTMITRK"
FT   gene            116375..117607
FT                   /locus_tag="ECH_0127"
FT   CDS_pept        116375..117607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0127"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein, LolC/E family"
FT                   /note="identified by match to protein family HMM PF02687;
FT                   match to protein family HMM TIGR02212"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44979"
FT                   /db_xref="GOA:Q2GHX8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX8"
FT                   /protein_id="ABD44979.1"
FT                   /translation="MLLKFELMLALRYLRSSSSKFLCSMITMLSLVGITLGVATLIVVM
FT                   SVMNGFGEKLLNCVVGLNGHIVIYFNDSVDYDYRSIAESIKGISGVKDAVPITENQAMI
FT                   KSNSNVSGVVVRGIEKQDIERNNIIVNNIVRGSIDEFNDGIAIGIKLAEILHVNYGDKL
FT                   TIVSSESISTVIGNIPRMKTYKIAAVFDVGMYEYDSTLVYMPLHASQLFFHYDNRVKSI
FT                   EVSILDVNKSSEMLEIIESKTNMKGEDWKMQQGSYFHALKIESNVMFFILTLIIIVATF
FT                   NIISSLSILVQDKKGAIAIMRTLGVTRCGILRIFCMCGFFIGLIGTILGCVLGIVVSLN
FT                   IDGIKNMLEKISDSNIFDPVIYFFDTLPSVLLVEDVVKISLLSLFLSLVAAILPARKAA
FT                   CQDPADVLRHE"
FT   gene            117619..118395
FT                   /locus_tag="ECH_0128"
FT   CDS_pept        117619..118395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0128"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44634"
FT                   /db_xref="GOA:Q2GHX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX7"
FT                   /protein_id="ABD44634.1"
FT                   /translation="MLAKEVWGWFFMMLITTSCSICAVFSYLDVKKDLVVFSQQYRKVI
FT                   ENDVRSVLVQVNQNLLNSYLSKQKENCPVQRIITSENNDIISCSNEEWLAKLLLSVINL
FT                   REAFLGDISVKSIIYSIKPMLLKLDDYKINEAVAEIERLDSKKLTTFNRLKFSFKKIAR
FT                   ELHYSRSNMVQKVFFKWVVVKNQQDALLHNLKEVEIYLDDNLWSDALDLSRKELSSVAE
FT                   LELWIQQLEDVVSMEKNISLIYDQLSKYIIKLPGVS"
FT   gene            118392..119642
FT                   /locus_tag="ECH_0129"
FT   CDS_pept        118392..119642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0129"
FT                   /product="HemY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45233"
FT                   /db_xref="GOA:Q2GHX6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX6"
FT                   /protein_id="ABD45233.1"
FT                   /translation="MITSVLIFVIVALTIGLWVIDCDGIIRIDWLGYDIEVNILFTLFV
FT                   IAVVFLLLILLVRFIFCFSRCVYRYKRDLQNKKMVLLEQGYMYLNCGDVERVEKIIVKI
FT                   GNFDHPSLFLLKGRVYFDTGKYILAEKYFTQFVKVVPVIDASLGIHLLNVIMQIEDQIQ
FT                   QLSLLRKMLEIFFKQSWSAIFKLTIYRISRDWGNAIEEMKKIIKLKINLPLPYNTQEML
FT                   NVFYYALAKQCYDIQKYDDGLRVLDNIKNCSQQCSTAVTLLKAKFYIDTDKKRKAVNIL
FT                   EHEYRINPHPDIANFYLDIMQHSSHAIHKLYSFNTGYYFSIYLIAQDAINSGEYDTAMK
FT                   YLNHSFKTKTYISLYFLVLKLKVLSQNYNELLYWTDKIAKDAIADKYWSCTKCKYTPTC
FT                   WHYECDGCKSFNTIIWV"
FT   gene            119648..119902
FT                   /locus_tag="ECH_0130"
FT   CDS_pept        119648..119902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC50165.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45341"
FT                   /db_xref="GOA:Q2GHX5"
FT                   /db_xref="InterPro:IPR009935"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX5"
FT                   /protein_id="ABD45341.1"
FT                   /translation="MGIEDVVFFIISWWVVLFLILPIKVEVSDSPVIGTASSAPVKSYL
FT                   LVKSIIATVTSMLLTGLYIYLKIKGYIDFERIYDLVTFV"
FT   gene            120226..120783
FT                   /gene="atpH"
FT                   /locus_tag="ECH_0131"
FT   CDS_pept        120226..120783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="ECH_0131"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:Q02849; match to
FT                   protein family HMM PF00213; match to protein family HMM
FT                   TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44989"
FT                   /db_xref="GOA:Q2GHX4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHX4"
FT                   /protein_id="ABD44989.1"
FT                   /translation="MIQYRGGYIASCYAQALFSVSSNVNSICKNAEFVVSVLENCNDIS
FT                   LFLSNPRVSREDKVKLVEVIGDYIDSILVKFIMVVIENNRGNILLQILNTFLDLVKKHN
FT                   REVSISVTSCAVLTKQEEEGICDALFEKYGKVVSITNNIDPSILGGFIIRVNFDVIDVS
FT                   LNSYLQSLRELSKMAIRSSISE"
FT   gene            120796..122325
FT                   /gene="atpA"
FT                   /locus_tag="ECH_0132"
FT   CDS_pept        120796..122325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="ECH_0132"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:Q03265; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF00306; match to protein family HMM PF02874; match to
FT                   protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44617"
FT                   /db_xref="GOA:Q2GHX3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHX3"
FT                   /protein_id="ABD44617.1"
FT                   /translation="MNNTISPGEVLKVIKERIENFDNQVKSDSVGEVISIKDGIALIYG
FT                   LEKAKFGEVVVFANGITGIVLGLDCDTASVVVFGDERSVGEGDTAKCTGKLMDVPVGLE
FT                   LLGRVVDALGNPIDGAGSIDSKTRLPVEIKAPGIIARQSVTEPLQTGIKIIDMLIPIGR
FT                   GQRELIIGDRKTGKTAIAIDTIINQKAHNDVVSEKEKVYCIYVAIGQKNSSVARIVDKL
FT                   RVSGALEYTIVVAAGASDTVSFQYLAPYAACAMGEFFRDNGMHCLIVYDDLSKHAVAYR
FT                   QMSLLLRRPPGREAYPGDVFFLHSRLLERAAKMSDKEGGGSLTALPIIETQAGDVSAYV
FT                   PTNVISITDGQIFLESEIFYKGLRPAVNVGLSVSRVGSAAQTKSVKKVAGSVKLSLAQY
FT                   RELEDFAKFGSDIDVHSQKVLDRGRRMMELLKQKQYSPLSVPEQVAVIFAGTSGCLDGV
FT                   SVSDISRFEEMLLKELNENYPDVLSSILNNFTDDVKDLLLEIIGKVTSNFE"
FT   gene            122362..122850
FT                   /gene="greA"
FT                   /locus_tag="ECH_0133"
FT   CDS_pept        122362..122850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="ECH_0133"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by similarity to SP:P21346; match to
FT                   protein family HMM PF01272; match to protein family HMM
FT                   PF03449; match to protein family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44566"
FT                   /db_xref="GOA:Q2GHX2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX2"
FT                   /protein_id="ABD44566.1"
FT                   /translation="MNARFPITKNGFAKLELELESLKHERPKIIKSISEARELGDLSEN
FT                   AEYHAARERQGLVESKIMELESKKSRAEVIDVSNLSGDTVMFGATVTMSIYDEQTGNTD
FT                   EVVYQIVGEYEADISKQMISIKSPLVVSLLGKKEGDVVEVKTPKGDYRIYKIIKIEFI"
FT   gene            122869..123504
FT                   /gene="ribB"
FT                   /locus_tag="ECH_0134"
FT   CDS_pept        122869..123504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="ECH_0134"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45070"
FT                   /db_xref="GOA:Q2GHX1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHX1"
FT                   /protein_id="ABD45070.1"
FT                   /translation="MGIIVSENSSFISPVEHIIEDSKQGKMFILIDDEQRENEGDLVVL
FT                   AEKVTSGVINFMITHGSGIVCLSITEDLMHKLGLEFIPKRHVNCNSASFATSIDARYGI
FT                   TTGVSAHDRAHTILTVVNKNVTEDDFVTPGHIFPIVSKKGGVLERSGHTEASVEIARIA
FT                   GLAPVAVVCELMNPDGTMSRMPDIIEFSQRYNIKVTSIDKLIQYVKAN"
FT   gene            123530..123979
FT                   /gene="smpB"
FT                   /locus_tag="ECH_0135"
FT   CDS_pept        123530..123979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="ECH_0135"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45413"
FT                   /db_xref="GOA:Q2GHX0"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHX0"
FT                   /protein_id="ABD45413.1"
FT                   /translation="MDIVVENRKVRFNYFIIQEFDAGIVLIGSEVKSLRQRKVSIAEAY
FT                   VTERNMELWLCNLHISEYNQASTRNHNPTRPRKLLLRKKQIYKISGNIKNDGFTVVPLC
FT                   LYFNDKGIAKVKVVIVKGKKLHDKRETIKTRDWNREKSRILRGGN"
FT   gene            complement(124244..126670)
FT                   /gene="valS"
FT                   /locus_tag="ECH_0136"
FT   CDS_pept        complement(124244..126670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="ECH_0136"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by similarity to SP:O26861; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45291"
FT                   /db_xref="GOA:Q2GHW9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW9"
FT                   /protein_id="ABD45291.1"
FT                   /translation="MQSIFNNKYQFKNIETKYNTHWNITKLYKWKNSGNNQFIIDTPPP
FT                   TISGQLHIGHVFSYCHTDFIARYQRMLGKDVFYPIGFDDNGLPTERLVEKTKKIRATDM
FT                   SRKEFNTICTQVSNEFRIQFKQLFQSIGISYDWDLEYHTISKNIQKISQTSFINLYNKG
FT                   KLYRKLQPIFWDCIDKTAIARAEVEENEISSFMNTITFSTEAGIPINIATTRPELMPAC
FT                   VAVFFNPSDTRYQHLLGQNAIVPIFGNRVKILPDDQVKIDKGTGLVMCCTFGDEMDVYW
FT                   WNKHNLDTKIIISKSGTIFNLSSDTTQGKSVCNQLHGLPITKARALILEILDQNNLLKH
FT                   KQEIIHNVKCAERSGAPIEILLSHQWFIKVVEIKQELLKQVQKINWYPKSMRKQIEIWI
FT                   EGLNWDWCISRQRYFGVPFPVWYSKKADGEIILPDINKLPVDPINDLPEGYQDTEVEAD
FT                   TDVMDTWATSSLSTQFHNISTTHADLRAQSHEIIRSWAFYTILQAYYHNNDIPWKNIMI
FT                   SGWCLAEDKTKMSKSKGNTLTPNKLLEEYGADVVRYWAANSKLGADTTFSNDVLKLGKR
FT                   FTTKLWNASKFVSMFIGQYSEIDLQHVTETMDKWILSKLYKVIIKATESFNSFEYCIAL
FT                   NYIESFFWKDFCDNYLELSKKRAYGESTSKQEHLSAVHTLSFILRELLKMLAPFMPYIT
FT                   EEIYNTLYNNKNSIHSHNNWPIANISLYNASDELLGEDFIEILNQVRKIKANAQLSVKY
FT                   KIDKLIINSQGCNFPTSLENDLKAVCNAEHIVYTTQPVIDTNEEKFLVSLEFTNQ"
FT   gene            127065..129002
FT                   /gene="ccmF"
FT                   /locus_tag="ECH_0137"
FT   CDS_pept        127065..129002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="ECH_0137"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="identified by match to protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44546"
FT                   /db_xref="GOA:Q2GHW8"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW8"
FT                   /protein_id="ABD44546.1"
FT                   /translation="MVSLIELPLLMACVFSVVYPFVVNISFCWSKVLTMLIFILTSSAV
FT                   GLLLYIHIVDDFSFCNVYYNSHTTKHLLYKIFGIWGNYEGSILLWVWIISLYSLLLEIL
FT                   LDKDDFKRISISIQHVINFGFLLFTLVASNPFMKMPTVEYEGLGFNPILQDTGLMVHPP
FT                   ILYLGYVGFSVVFSLAVAGIILQKDSVEWAMIINKWALVAWSFLTLGIGLGSWWAYREL
FT                   GWGGFWFWDPVENVSLMPWLLGTALIHLLPLVRKFNLFYNSAVLLSICSFVMSLIGTFL
FT                   VRSGVLVSVHTFANDPEHGFYILMLIGIIISSGIISFICFTKKTQKREYDFLLLSKVTM
FT                   LLFNNVLLLTAFAIVFIGTIYPVILEFITGDVIAVGAPYYNTLFNYLIFCTLILMIITL
FT                   GLDEERNKILIKNFKFSGFVVLLIFPFMIDNNFFIVLILLLSVFLFLSVLEAYYRKIKI
FT                   FTVSFSETIKLAKSCSKKYYSMLIAHMGVAVFMFGIIGSIVWGETYELYMKDNSLINVK
FT                   NFQVVLSGLSFVKNKNYDAIRGRFLIVKSGEVLGKVFPENRFYVVEGVRNAESAIYRHW
FT                   LSDIYIVIGDIDKVKGIAVKVYYKPYINLIWMGFLLVAFGGVIGLLSSHIITKKSLVLE
FT                   TSKTNGASCT"
FT   gene            129374..130210
FT                   /locus_tag="ECH_0138"
FT   CDS_pept        129374..130210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0138"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44506"
FT                   /db_xref="GOA:Q2GHW7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW7"
FT                   /protein_id="ABD44506.1"
FT                   /translation="MSKFIILPDRSIIVFYGQDVKQLLNQTTTNNVLNLSQNKAIYSLL
FT                   LSPSGRYIYDFFIVQYGKYVLLDCCSTEKEEIIQKFLSYKLQLKIVIKEKKHYKVGVFI
FT                   GDQYDRNECGYTYCQGDTIFFQDPRLSKLGLRVMFNESQKVFSNIEYDVGKYEDYEILR
FT                   INNTVPDCRKDMIKGTSFPLQFRMAQFHAIDFNKGCYIGQETVARMYRAGVKKNIYTII
FT                   SEHQSFCDTKVMCAQQEIGRLLSNVGNIGLCLLDISSEHDFCNLKIGGAKVKILLN"
FT   gene            complement(130634..132022)
FT                   /gene="purF"
FT                   /locus_tag="ECH_0139"
FT   CDS_pept        complement(130634..132022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="ECH_0139"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by similarity to SP:P00497; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF00310; match to protein family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45246"
FT                   /db_xref="GOA:Q2GHW6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW6"
FT                   /protein_id="ABD45246.1"
FT                   /translation="MQFNEIYEECGVFAIQNNNCAAINCILGLHALQHRGQESFGIVTS
FT                   EDNKLHFHYSNEQVNSIFNQQSKIDSLLGNTAIGHIRYSTSGSKVGVQPITLDCKFGKL
FT                   AIAHNGNLTNAAQIRKSLTERGCIFSSDIDTEVIAHLIAINTENTLLDNVINALKTIKG
FT                   AYSLVILINGTIICCRDPAGIRPLVLGMLDNSYIVASETCALDIVGAQFIRDVLPGEFI
FT                   TIDQGNTLTSSFPFKKQKSSFCIFEYVYFARPDSIIDNKSIYEIRKNIGKELAIENPIP
FT                   KDTHMIVPVPDSGVPAALGFAEYTKIPFEFGIIRNHYIGRTFIQPNDHIRSMGVKLKHN
FT                   ANSSILKDKVIVLIDDSLVRGTTLKSIITLLHKAGVQQIHLRISSPPTINSCFYGIDTP
FT                   EESKLIANRLSQLEIKNALGCDSLHFLSIDGLYKAICNTKRNNSIPQYCDACFTGDYPI
FT                   GKIE"
FT   gene            132213..132443
FT                   /locus_tag="ECH_0140"
FT   CDS_pept        132213..132443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0140"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM00401.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44938"
FT                   /db_xref="GOA:Q2GHW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW5"
FT                   /protein_id="ABD44938.1"
FT                   /translation="MIVWIMCFQSSTTFNKAIKNKNINHVIYQKVIATLQNENRIQVSF
FT                   NDALFTNYNSRSPENTGILALLILIGRHSIM"
FT   gene            complement(132447..133043)
FT                   /gene="pth"
FT                   /locus_tag="ECH_0141"
FT   CDS_pept        complement(132447..133043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="ECH_0141"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45087"
FT                   /db_xref="GOA:Q2GHW4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHW4"
FT                   /protein_id="ABD45087.1"
FT                   /translation="MFYLLAGLGNPGKKYELSRHNAGFMIVDAIASEFYFPSFRERHNA
FT                   LISIGNIKSHRVILVKPWTFMNNSGAPIMSIASLYKIPLDNIIIFHDEVEINFCTIRVK
FT                   KSGGNAGHNGLKSIDNLLGKDYWRVRFGIGRPINKTNLKIDLSYYVLSQFHNIKAVNNT
FT                   ILNIVEHITLLLEKKPSMFMEKVKNLIKYEDIPTE"
FT   gene            complement(133058..133690)
FT                   /locus_tag="ECH_0142"
FT   CDS_pept        complement(133058..133690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0142"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="identified by similarity to SP:P14194; match to
FT                   protein family HMM PF01386; match to protein family HMM
FT                   TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45505"
FT                   /db_xref="GOA:Q2GHW3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHW3"
FT                   /protein_id="ABD45505.1"
FT                   /translation="MTDQGIVKINASLRKNVGTGPSRALRLSGEIPAVIYGKGRDSLSI
FT                   SLSNREFVSKYRSAALSTHLIELEIDNKKEYVLMRDVQKHPVTDRIQHVDFQFIDYGTE
FT                   IKIEVPLIFTNEQKCIGIKRGGVLNILHRTLSIKCSPKAILQNIEIDLSGLTTGHSIHV
FT                   SDLKLPPEVNVTMKEHNPAIVTISSASTEKEAESNQESTSTTPSSES"
FT   gene            complement(134076..134768)
FT                   /locus_tag="ECH_0143"
FT   CDS_pept        complement(134076..134768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0143"
FT                   /product="putative competence protein F"
FT                   /note="identified by similarity to SP:P31773"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45219"
FT                   /db_xref="GOA:Q2GHW2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW2"
FT                   /protein_id="ABD45219.1"
FT                   /translation="MLGKIFNIIFPKTCANCECVISSNHDLCSTCKSNINFLCDNYCIA
FT                   CGCSLPNKVSICGKCVPNPPKFTKLESVFSYNKHSKNMILNLKFSDNTLHVKTYGKWMY
FT                   NQNPDLFNNVTTIIPIPVHKKRLRQRKYNQATLLARALSKYCNIPIETFVLERIVDTIP
FT                   QYNLSSKMREKNITKSFTVKNQHLINNKIILLVDDVITTGITVRTCTHKLIESGAKEVR
FT                   VITLARTL"
FT   gene            complement(134773..135918)
FT                   /gene="dapE"
FT                   /locus_tag="ECH_0144"
FT   CDS_pept        complement(134773..135918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="ECH_0144"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01246"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45523"
FT                   /db_xref="GOA:Q2GHW1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHW1"
FT                   /protein_id="ABD45523.1"
FT                   /translation="MAIDPVILSQELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTF
FT                   GNDEVQVCNLYAQLGNGHPNLCFAGHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVD
FT                   MKSAICAFIAAVSRIDFNQVNGAISLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCL
FT                   VGEPTSKSSVGDTIKIGRRGSINFKIVCNGVQGHVAYPHLAQNPINDMINILHKINNTV
FT                   LDEGNEYFQPSNCEITSVDVGNTANNVIPGTVTAHLNIRYNNIHTSESLFNIINNICAE
FT                   TTQKYQIFTSLSGDPFINYPDKYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPV
FT                   IELGLKNDTAHKINENTSVDDINKLANIYEEFIKQFFNISQ"
FT   gene            136171..136281
FT                   /locus_tag="ECH_0145"
FT   CDS_pept        136171..136281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45138"
FT                   /db_xref="GOA:Q2GHW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHW0"
FT                   /protein_id="ABD45138.1"
FT                   /translation="MWQRLWWTLCYMEWLIVLYALTFTLELTVKLLYVSG"
FT   gene            complement(136360..138066)
FT                   /locus_tag="ECH_0146"
FT   CDS_pept        complement(136360..138066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0146"
FT                   /product="putative glutathione-regulated potassium-efflux
FT                   system protein KefB"
FT                   /note="identified by similarity to SP:P45522; match to
FT                   protein family HMM PF00999; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44790"
FT                   /db_xref="GOA:Q2GHV9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV9"
FT                   /protein_id="ABD44790.1"
FT                   /translation="MHDSKYLLDIITLLSAAIVIVVLFWKLNISPVLGYFVAGTLIGSN
FT                   GLNLVESSVIIQNLGEFGVVFLLFLIGIELTFERLIAMRLHVFGFGTLQVIVTALAIWY
FT                   ISSQFGVDSKGSIIIGGALALSSTAIVLQVLQEKGYQSTQVGRLSIAVLLLQDFAVVPL
FT                   IVLLPLLTGESHHSIPISLLYSFVKAAIALTLIFITGRLLLRPLFNTIAAMKSNEIFIA
FT                   TTLLIVLGAAFITENFNLSMALGAFVSGLLVAETEYRHDVEQVVLPFKRLLLGLFFMTV
FT                   GMSIDIKFVLNKLPIITLASISLIALKSFIIFILCRFFRFQLAAAIQAGLLLSQGGEFA
FT                   FILFGLAAEKNVLSSDLAQTLMMITTVTMAFTPLLATLGDWISKLITKKKISLNSQELI
FT                   LDTKDLDQHVIVVGFGRVGRMVAKVLVAEHVNYIASDIQPKIVKDGIDEGFPVYLGDLT
FT                   KLNTLQSMAISRARMIIIAINNEVTIKKIISLVAKNFPHIIIIVRLPDLSNVEIYKELG
FT                   AHYLIPETYEVGLQLGAVALSNNGFSNHAISLLKDRFRMVNYDAVKNKEDE"
FT   gene            complement(138080..138661)
FT                   /locus_tag="ECH_0147"
FT   CDS_pept        complement(138080..138661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14896.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45527"
FT                   /db_xref="GOA:Q2GHV8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV8"
FT                   /protein_id="ABD45527.1"
FT                   /translation="MVALNTPPVNKKFIAKDFLLKSIDGNLYNLSSCHKGNGLLIMFIC
FT                   NHCPYVKAIINNLVYDVNTLKNDYNIYTVAIMPNDTITYPEDSFDNMINFAQEHSIDFP
FT                   YLIDENQTVARNYGAVCTPDFFGFNNKLELCYRGRFDASGKNQMNSKQEDRDLFNAMKL
FT                   ISKTGESPENQKPSIGCSIKWKSQDYKFVT"
FT   gene            complement(138763..139197)
FT                   /locus_tag="ECH_0148"
FT   CDS_pept        complement(138763..139197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0148"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03653"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45305"
FT                   /db_xref="GOA:Q2GHV7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV7"
FT                   /protein_id="ABD45305.1"
FT                   /translation="MIDYEHWVEAFHIISIITWMAGMLYLPRLYVYHVQVALHSDSYSL
FT                   LNTMEKRLLFYIINPSMISSIVLGVILAFMTEAYHFLWFKIKVTCVILMCIIHMMLFKH
FT                   RRDFVTKSNTKSLLYFKCLNESVTLLIIVIVIMVVVKPFM"
FT   gene            complement(139712..140710)
FT                   /locus_tag="ECH_0149"
FT   CDS_pept        complement(139712..140710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0149"
FT                   /product="putative pyruvate dehydrogenase complex, E1
FT                   component, beta subunit"
FT                   /note="identified by similarity to SP:Q9R9N4; match to
FT                   protein family HMM PF02779; match to protein family HMM
FT                   PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44682"
FT                   /db_xref="GOA:Q2GHV6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV6"
FT                   /protein_id="ABD44682.1"
FT                   /translation="MRTLTVREALCEAIREEMERDHTVLIMGEEVGEYQGAYKVTQGLL
FT                   EQFGPDRVIDTPITEHGFAGIGVGAAFAGLKPIVEFMTFNFAMQAIDQIINSAAKTSYM
FT                   SGGQLNCPIVFRGPNGAAARVGAQHSQCYASWYAHIPGLKVVSPYFAADCKGLLKAAIR
FT                   DLNPVVFLENEIAYGHKHEIPNEVSTSDYITEIGKAAIVKEGTDITITAFSLQVKFALE
FT                   AAELLAKEGINAEVIDLRTLRPLDTETILRSIKKTNKIISIEEGWPYSGIGSEIAALIM
FT                   EYAFDDLDAPMIRITGKDVPLPYATNLEKLALPQIEDILEAARALCIRNYR"
FT   gene            complement(141202..143220)
FT                   /locus_tag="ECH_0150"
FT   CDS_pept        complement(141202..143220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45267"
FT                   /db_xref="GOA:Q2GHV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV5"
FT                   /protein_id="ABD45267.1"
FT                   /translation="MLTSPELQESNTINPDNSIVIAALGESILPEFSHNISHKVHQDSL
FT                   KISYTLHHVEENKPITISRISQALCNFLEFYVTKNFILPYYSNSAGDAPSLTQQPLHFK
FT                   IRVNNTTESETILPSTILSQTSFDKITITSALKSIISSLLSNELSKHPIIGLNQQLTLS
FT                   FDTIFNIPFDINTLNNNLATNLPTVKGIYKLYSIIELYNNSPTTTLIPDSQPKDLKLAV
FT                   IHVKDPQNKKSNASISACITTSDPQCRTSATDFIKRLCSTQYNYLDLFTIYKIDSQAFN
FT                   TLPDPQECSLTCHKQPTASSDAVTYKITCHNLTEETFCNQIHNYIFTFSTLYGTQHLAL
FT                   SLEFSLKKDITITHNTTLEPRFEFPDLNTHTNIKKLLCTVCNISYHSVSRAFSKKNTSD
FT                   IVKACLNSYDIYLHIIPSQNISQQISTVNSISFATQDDQITTPESTQHPELITRHKLTK
FT                   HTSQPSLQTTTQLQTTDLLSHPTTSRPSQIQPLTPISDDITPTTEDTSLSTTTPTLSQV
FT                   QASTSGATSSTIEPDIQRQREFLPSIVQDNSYIARIQEDISALRKTIKPVKRTQIYRST
FT                   NIQHSKRNLIIAYITISTLTICSIIGVLFPLRCYVSSEMENIKSITVISIFCIAAIAFI
FT                   GAMLYYHIKTPNNLVETTVSNPTDIAATRNMPGTYTS"
FT   gene            complement(143252..143335)
FT                   /locus_tag="ECH_0151"
FT   tRNA            complement(143252..143335)
FT                   /locus_tag="ECH_0151"
FT                   /product="tRNA-Leu"
FT   gene            143429..144832
FT                   /gene="tldD"
FT                   /locus_tag="ECH_0152"
FT   CDS_pept        143429..144832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="ECH_0152"
FT                   /product="tldD protein"
FT                   /note="identified by similarity to SP:P46473; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45035"
FT                   /db_xref="GOA:Q2GHV4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV4"
FT                   /protein_id="ABD45035.1"
FT                   /translation="MLLAHNQVNESTVNRIVRDCLCVADGGELFLEMCVSESLGLENGI
FT                   LKYADFNSHQGFGLRSFCKELTAFVCSSEITEQEIENAAALVKSINNSNSGGIVHLNKA
FT                   KPILYPETNPLQKMDFDLKVKLLQQVDDYLHSKSPYVRQVKSSLSGQWQIVYIILPTGD
FT                   RVYDVRPLIRFNVCVILEKDGRKESGSSGHGGRASYEEFIGDGKWQMVADEALRQALVN
FT                   LESVPTPAGEMTVVLGPGWPGVLLHEAVGHGLEGDFNRKKVSAFSTSIGKKVAAKGVTV
FT                   VDDGTIPGRRGSINIDDEGVSSGYNVLIQDGILVNYMQDRMNANLMGTTSTGNGRRQSY
FT                   QDVVMPRMTNTYMLPGSYCPEEIIASVKKGVYAVHFSGGQVDITSGKFVFSASEGYLIE
FT                   DGKVTCPVKGATIIGNGPDVLTKVSMVGDDLKLDPGIGTCSKNGQDVPVGVGQPTLKID
FT                   SIIVGGTEV"
FT   gene            145008..145133
FT                   /locus_tag="ECH_0153"
FT   CDS_pept        145008..145133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44930"
FT                   /db_xref="GOA:Q2GHV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV3"
FT                   /protein_id="ABD44930.1"
FT                   /translation="MIGKNRMNNCYGRCNVGCIIYNLEEKNKRLLQQYWKYSIIV"
FT   gene            complement(145220..146308)
FT                   /gene="ychF"
FT                   /locus_tag="ECH_0154"
FT   CDS_pept        complement(145220..146308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="ECH_0154"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45401"
FT                   /db_xref="GOA:Q2GHV2"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV2"
FT                   /protein_id="ABD45401.1"
FT                   /translation="MGLNCGIVGLPNVGKSTLFNALTQTMVAEVANYPFCTIEPNIGKA
FT                   IVQDHRLKTLANIASSKKIIYNQVECVDIAGLVSGASQGEGLGNKFLSHIREVDAIIHV
FT                   LRCFGDQNISHVNQTVDPISDAEIVEMELILADIESLKRRLPATEKAVKANKEPRKKLD
FT                   TILEVLSVLEAGNLAKSAKHLGDDLKQLQLITTKPMMYVCNVEESNVTTGNALSEKVKL
FT                   MAEKKHNKFCCISAKLEADVSSLETEEEKQIFLAEFNLQESGTTSVVKTMYDLLDMITF
FT                   FTLGPQEARAWPIKRFSTASSAAGVIHTDFEKGFIKAELISFDDYIKYNGEAKCKEAGK
FT                   VRFEGRDYIVQDGDIIHFRHNK"
FT   gene            complement(146674..146766)
FT                   /locus_tag="ECH_0155"
FT   CDS_pept        complement(146674..146766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0155"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44813"
FT                   /db_xref="GOA:Q2GHV1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHV1"
FT                   /protein_id="ABD44813.1"
FT                   /translation="MGLNCGIVGLPNVGKSTLHYKHINTFSLNL"
FT   gene            complement(147096..147617)
FT                   /gene="ispF"
FT                   /locus_tag="ECH_0156"
FT   CDS_pept        complement(147096..147617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="ECH_0156"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by similarity to SP:P36663; match to
FT                   protein family HMM PF02542; match to protein family HMM
FT                   TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45293"
FT                   /db_xref="GOA:Q2GHV0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHV0"
FT                   /protein_id="ABD45293.1"
FT                   /translation="MNQHPNKPIFKVGIGYDVHKFDNTCYNDANTFITICGIKINYHKK
FT                   IIAHSDGDVGLHALTDAILGAVGCGSIGQHFPNTDNTWKNIKSDYFLIEAQKKAQEKGY
FT                   SISNADITIICEQPKIMPHALEMQEYIANLICIDPSCINVKATTTEKLGFLGRKEGIAA
FT                   QAIVLCCLQN"
FT   gene            complement(147705..148415)
FT                   /gene="ispD"
FT                   /locus_tag="ECH_0157"
FT   CDS_pept        complement(147705..148415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="ECH_0157"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by similarity to GB:AAF61714.1; match to
FT                   protein family HMM PF01128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44639"
FT                   /db_xref="GOA:Q2GHU9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU9"
FT                   /protein_id="ABD44639.1"
FT                   /translation="MHKFTLLIVAAGNSNRFKWSAIPKQYCSLGNHNILCSTINNMISH
FT                   PKINYVKVVIRKEHQHLYDNCLQKIQNDKLLPPTYGGKRRQDSVRMGLESIQNINPYFV
FT                   IIHDACRPFIDLKILDTMESILTHYAGVVPVLSITDTIHVVHENKTVIQNVDRNSIKLI
FT                   QTPQAYKYSEILLHHRIAYNTEPNREFPDESSLMIHYNIPIMTTEGDYNNFKITTIEDL
FT                   HRAILYTKHIDHNY"
FT   gene            148656..149978
FT                   /locus_tag="ECH_0158"
FT   CDS_pept        148656..149978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45110"
FT                   /db_xref="GOA:Q2GHU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU8"
FT                   /protein_id="ABD45110.1"
FT                   /translation="MIGGNTQTPNDYVPIRRHQLSHNSIKSLTKKLFLLNTSIGIVSVI
FT                   HASFLIMLFDAMCLQKKPKHTILTLAALIAVISVVSLLLFYVRYTVSKKNKRHLESMHA
FT                   NAESFVSLLQDRQLLDNLSHKVHHLQHLAHELESIDEKGVFIEHASQRISASRVDVEKQ
FT                   LRNFVKHCEDDISKMYRELEGVTVDMSEVSGILLNPSFFKENEAGLMSLSERRKLMSQK
FT                   EHEINLLMKGYCSEILAKIVCIIEMMKLHQSSSVENKKVSLFSEDDSKVKELIRILVNT
FT                   KCVLEELDGEEIKYPTFEMLCNVMWNIGSFLSSMRCMAKESVYKKAENLIQEKGKQVQR
FT                   FISGILSAVRKLDVVKQEQGSEATSSEHTMSEEDSIVALRLVQLQSIILKLLFIMQRNK
FT                   SYDIHTETCSENSNGPIDSEENPDFAVQNLQSVSCSGIMLT"
FT   gene            150055..151578
FT                   /locus_tag="ECH_0159"
FT   CDS_pept        150055..151578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45541"
FT                   /db_xref="GOA:Q2GHU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU7"
FT                   /protein_id="ABD45541.1"
FT                   /translation="MLIDQKFQHLSQAFNSYSTLYQRNKLKSKYNFLLGSSIYLTALVS
FT                   VFSIVALYHHSGCFNSIFSGKDKLFGGNIPVVFSIALIVAIPSFILLFFLIYKICATQD
FT                   ITDHVVERTNDLIGSAREVCEFLKEKLHENTCQVEALVGHYGSLAAKHDDFVKKCSRCL
FT                   QSLEEQQVALGALVRRSTSVVDNNISEVQALVVDLKAKIAEMSVAHVKLMDASEDVREF
FT                   IVKQLRLEGLGLQHRVRFLDGLQGTLSQNIDVSDAKSAMKIIIERIENEIPKVRFAFNS
FT                   LNSMLWSLHSNLLKALLGLDKDSSPDGCITVCQELVNALHKFLGDMRAKIDNYNGSDKR
FT                   QFVNIGLVEVPLLQIMILRLMATKRACMFEDVCASVKDFIESGTADRSSSTGTKVIPDS
FT                   AASAAAPVTPTASVTPAASVTPATPTTPAASVTPIASATPATPAASVTPAASVTPTASA
FT                   TPATPAAGTNDGAEFATPPMGTTDAPSVEDLSALGAVGGVDPNAHTHTP"
FT   gene            complement(151766..152269)
FT                   /gene="purE"
FT                   /locus_tag="ECH_0160"
FT   CDS_pept        complement(151766..152269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ECH_0160"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to SP:P09028; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45342"
FT                   /db_xref="GOA:Q2GHU6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU6"
FT                   /protein_id="ABD45342.1"
FT                   /translation="MSTNKNIADVAVIMGSQSDFSTMNNSISILKELNITHEVMIISAH
FT                   RTPERLYTFAKSAEDNGFKVIIAGAGGAAHLPGLVASLTHIPVIGVPVKSSNLNGIDSL
FT                   LSIVQMPKGIPVATMSIGSSGGYNAAIMAASILSLENDEIRKNLKIWRKNLSDSVKLIP
FT                   DIPL"
FT   gene            complement(152256..152804)
FT                   /locus_tag="ECH_0161"
FT   CDS_pept        complement(152256..152804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44755"
FT                   /db_xref="GOA:Q2GHU5"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU5"
FT                   /protein_id="ABD44755.1"
FT                   /translation="MNNKHFIFFTCIIFLFILLTINKISSYYQIQRNMPDTLLQIKEIN
FT                   SDKALSEMFTIKDSKVNILVIYTSWCSSCIKKLPEINKVIANNENIHPIIISLDENKNK
FT                   LLSFLSKQGTLYFTPYNVPPNHMKKLLSHLTNKGITFDHHIPYIAVLYNGMNPITNINS
FT                   VSQLKSTIKDIIEKYHVNQ"
FT   gene            153131..153433
FT                   /gene="ihfA"
FT                   /locus_tag="ECH_0162"
FT   CDS_pept        153131..153433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="ECH_0162"
FT                   /product="integration host factor, alpha subunit"
FT                   /note="identified by similarity to SP:P30787; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44586"
FT                   /db_xref="GOA:Q2GHU4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU4"
FT                   /protein_id="ABD44586.1"
FT                   /translation="MTQTLTKSKIAEVINRDVGLSREDASSVVGEILDEMLNALVKDRI
FT                   LKISSFGTFKSYKKKARMGRNPKTSEEFVIKERYTVSFYPSILIKHSINSDDSTE"
FT   gene            153445..153825
FT                   /locus_tag="ECH_0163"
FT   CDS_pept        153445..153825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0163"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45154"
FT                   /db_xref="GOA:Q2GHU3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU3"
FT                   /protein_id="ABD45154.1"
FT                   /translation="MGEKKILHDEYSSKLKTIGEVAKDLDVEQYVLRFWEEKFPQVNPI
FT                   KRRGRRLYSQVDVDTLKHIKHLLYDKGYKIKGVQQELGRKPANINKHTNDTEQSVYRKD
FT                   LISLLDDMLSLRDSLLKKFNGM"
FT   gene            153816..153894
FT                   /locus_tag="ECH_0164"
FT   tRNA            153816..153894
FT                   /locus_tag="ECH_0164"
FT                   /product="tRNA-Pro"
FT   gene            complement(154222..154309)
FT                   /locus_tag="ECH_0165"
FT   tRNA            complement(154222..154309)
FT                   /locus_tag="ECH_0165"
FT                   /product="tRNA-Ser"
FT   gene            154647..155504
FT                   /locus_tag="ECH_0166"
FT   CDS_pept        154647..155504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL08844.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44708"
FT                   /db_xref="GOA:Q2GHU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU2"
FT                   /protein_id="ABD44708.1"
FT                   /translation="MQVDVGSEPDHGYHILFKNNGHVISDFRGVQAENFVFDIKNHNLR
FT                   ASFLVDPMAPFTELDNSQHPHFVVNMHTANECGSDCVHHNEHDHDAHGRGAASSVAEGV
FT                   GSAISQILSLSDSIVVPVLEGNASVSEGDAVVNAVSQEAPAASVSEGDAVVNAVSQETP
FT                   AASVSEGDAVVNAVSQETPAASVSEGDAVVNAVSQETPAASVSEGDAVVNAVSQETPAA
FT                   SVSEGDAVVNAVSQETPAASVSEGDAVVNAVSQETPATQPQSRDSLLNEEDMAAQFGNR
FT                   YFYF"
FT   gene            complement(156239..157240)
FT                   /gene="trpS"
FT                   /locus_tag="ECH_0167"
FT   CDS_pept        complement(156239..157240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="ECH_0167"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45423"
FT                   /db_xref="GOA:Q2GHU1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHU1"
FT                   /protein_id="ABD45423.1"
FT                   /translation="MSIPIVLSGIQPSGGIHLGNYLGSIRNWVSLQSSYKCFFFLADLH
FT                   TLTSNNYNSAELKQNSINTLATYLACGIDPNKSVLFVQSSIHAHAELLWIFSCITSTGQ
FT                   LNRMTQFKEKSRNKVSTACLGLYSYPVLMAADILIYKANIVPVGIDQKQHLELTRDIAM
FT                   NFNSTYNTQYFQIPEPLIMQESAKIMNLRNGKKKMSKSDSSDYTRINLYDSNDVISKKI
FT                   SKATTDSIVGFNFSTLDSRPEVKNLVSIYATLLNINIEQACTNIENFSTKQFKEQLTEL
FT                   LIDNIAPIRHKVTEFLEDKEHLHNIIVSGNNKAASIANKHILEIKEIIGCWS"
FT   gene            complement(157397..158008)
FT                   /gene="grpE"
FT                   /locus_tag="ECH_0168"
FT   CDS_pept        complement(157397..158008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="ECH_0168"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44781"
FT                   /db_xref="GOA:Q2GHU0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHU0"
FT                   /protein_id="ABD44781.1"
FT                   /translation="MSDNGDNNTKSPQHNNPQPNEKSDGKVQPGQPQVNPQRKFTAGIN
FT                   KKKEKLNEDLSELDKLRQQLIHFQNQFRLAVADKENVKRIMQKNIDDTSIYAISNFARD
FT                   LLSSCDNLETSLKNLKEGDSIHAGVLMTYKELLNTLERHNITRIDPIGEKFNPQFHKAV
FT                   SQMVDAEKDDNTILHVVQPGYIIKDKLLRAASVIISKKSD"
FT   gene            158116..159198
FT                   /gene="ribD"
FT                   /locus_tag="ECH_0169"
FT   CDS_pept        158116..159198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECH_0169"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45534"
FT                   /db_xref="GOA:Q2GHT9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT9"
FT                   /protein_id="ABD45534.1"
FT                   /translation="MIRYDKKFMSLALRIARRGLGNVFPNPAVGCIVVNHGMVVGRGYT
FT                   QVGGRPHAEVIALNNAGHLAKGSTVYVTLEPCSHYGQTGPCALKLIDAGVKRMVIAAKD
FT                   PDVRVSGNGIELLRNAGIDVKCGVMYEEARELNIGFFYSKIKNRPFITVKLASTLDGKI
FT                   ALKDGNSRWITNELTRNWVHKQRSMYDAIMVGSNTIVQDNPMLNTRLPGLECYSPVRIV
FT                   IDRFGKVCDYHNIIKTSDVIPTYILTNDVPQTKLGKASCLVVDDKDNFLRSAMKMLSVK
FT                   IGITRLFVEGGGVLITELLKNQLIDRIIWCRSNKIFGNDAIPSIGDLDILTLQCGYNFR
FT                   AVDTLYFKDDIVEILEHCTE"
FT   gene            159346..159942
FT                   /locus_tag="ECH_0170"
FT   CDS_pept        159346..159942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0170"
FT                   /product="variable length PCR target protein"
FT                   /note="identified by similarity to GB:AAQ82755.1; match to
FT                   protein family HMM PF07122"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44961"
FT                   /db_xref="GOA:Q2GHT8"
FT                   /db_xref="InterPro:IPR009805"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT8"
FT                   /protein_id="ABD44961.1"
FT                   /translation="MSQFSEDNMGNIQMPFDSDSHEPSHLELPSLSEEVIQLESDLQQS
FT                   SNSDLHGSFSVELFDPFKEAVQLGNDLQQSSDSDLHGSFSVELFDPSKEEVQLESDLQQ
FT                   SSNSDLHESSFVELPGPSKEEVQFEDDAKNVVYGQDHVSLSELGLLLGGVFSTMNYLSG
FT                   YTPYYYHHYCCYNPYYYFDYVTPDYCHHCSESSLE"
FT   gene            complement(160388..161986)
FT                   /gene="pyrG"
FT                   /locus_tag="ECH_0171"
FT   CDS_pept        complement(160388..161986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="ECH_0171"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by similarity to SP:P13242; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF06418; match to protein family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45130"
FT                   /db_xref="GOA:Q2GHT7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHT7"
FT                   /protein_id="ABD45130.1"
FT                   /translation="MNQASTRFIFVTGGVVSSLGKGLAAASIGALLQARGFKICLRKLD
FT                   PYLNIDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFTGVKTTKNDNITTGKVYHNLLK
FT                   KERRGDYLGQTVQIIPHVTDLINSFILHDTDKLDFVICEIGGTVGDIESQPFLESIRQI
FT                   GYKLSKNNTIFVHLTLVPYIDAAMELKTKPTQHSVKELSSVGIQPDIILYRSKIPLSKE
FT                   QRDKIANLCNVSSTNIIPALDVKNIYELPISYHNYNLDTQILNHFNIDSPEPDLRKWEN
FT                   ILNISHAVTKTVNVAIIGKYIKLLDAYKSLIEALEHASIHNKVKLSIKWIDSRSLDSNE
FT                   INIFDKVDSILIPGGFGDDGIQGKMTAITYARLNKIPFLGICMGMQLAIIEFANNVAHL
FT                   EDANSTEFNLYCKNPVIHQLPELQQNFLGGSMKLGSCPCYLESGSKIFSIYQQSIIHER
FT                   RRHRYAFNLQYKDLLEQHGLIFTGKSNNNNDSLIEVIELKDHPWFIGVQFHPEFKSSPF
FT                   HSHPLFISFIKASLD"
FT   gene            complement(161992..162324)
FT                   /locus_tag="ECH_0172"
FT   CDS_pept        complement(161992..162324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0172"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by similarity to SP:P33582; match to
FT                   protein family HMM PF03840; match to protein family HMM
FT                   TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44537"
FT                   /db_xref="GOA:Q2GHT6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT6"
FT                   /protein_id="ABD44537.1"
FT                   /translation="MVLTVIQLVLVFFLVILILLQPPESDNLSGFGSTQSNLDSMFTTG
FT                   SSSNFITKLTVIIATAFIINTVLLVGINAKSVHKESIVKKIAEMSKAHNLPPMEHNNED
FT                   SVPFNQ"
FT   gene            162619..163548
FT                   /gene="xerD"
FT                   /locus_tag="ECH_0173"
FT   CDS_pept        162619..163548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="ECH_0173"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by similarity to SP:P21891; match to
FT                   protein family HMM PF00589; match to protein family HMM
FT                   PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45089"
FT                   /db_xref="GOA:Q2GHT5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT5"
FT                   /protein_id="ABD45089.1"
FT                   /translation="MDNQRYVNIFLEAIVAEKHVSHNTYQSYRTDLLGLCKFIDRNDLL
FT                   LTDASIHELQDYIRFLYEKGYKANTVSRKISAIKNLYGFLYRDNIIENDPTVYLDSPKL
FT                   SRSLPKTLSYEEVNILLDVAALDVSPDGRRINAIVNILYSSGIRISELVYLKFREVREA
FT                   LDDGDTEICHMKIQGKAKKERIILLNSSAVTSIQKYMEVYEYFIPNGYKMSQWLFPGTK
FT                   FDNPVTRQRVGQLLKNLAMNAGINVTHVSPHKLRHSFATHLLNNGSDIVFIQKMLGHAN
FT                   LATTQIYTHVASERLKSILLKFHPLRNK"
FT   gene            complement(163888..164595)
FT                   /locus_tag="ECH_0174"
FT   CDS_pept        complement(163888..164595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0174"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44785"
FT                   /db_xref="GOA:Q2GHT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHT4"
FT                   /protein_id="ABD44785.1"
FT                   /translation="MSTVFALANIYKSFGRNKEVPVIVNATLQIKKGEIVALIGKSGSG
FT                   KSTLLHIAGLLDTPSSGSILLNNIECTDKTSDKDKTYLRRHFLGFIYQFHHLLQEFSVL
FT                   ENVMLPQIITGKSKSIAKKNAMEILERVRLQDKLSMPISQLSGGERQRVAIARSLINCP
FT                   LIVLADEPTGSLDNNTALEVFSLLQEYAKEKNIAILLATHNYSLAQKACRIVKIDSGIL
FT                   RSYSIDESGFNKI"
FT   gene            164885..167161
FT                   /locus_tag="ECH_0175"
FT   CDS_pept        164885..167161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0175"
FT                   /product="malate dehydrogenase"
FT                   /note="identified by similarity to SP:O30808; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF01515; match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45280"
FT                   /db_xref="GOA:Q2GHT3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT3"
FT                   /protein_id="ABD45280.1"
FT                   /translation="MVDLENNGFDEKRKEALEFHCKDLKPGKVSLLPTKPLLTQRDLSL
FT                   AYSPGVAVPCLEIARNPDLVYEYTARGNYVAVISNGTAVLGLGNIGPLASKPVMEGKAV
FT                   LFKRFADIDAVDIEVNTSDVDEFVNTVKYLGLSWGGINLEDIKAPECFIIEKRLSEIMD
FT                   IPVFHDDQHGTAIIVAAGLINALDITGKSFKDVKIVINGAGAAGIACLEMIKLIGVPAE
FT                   NITLCDQNGVIYKGRQLGMNEWKEKHAIETENRSLKDALIMADVFLGLSVKDVLSKDML
FT                   LSMNRDPVIFALANPDPEINPNVAHEIRPDAIIATGRSDYNNQINNVMGFPYIFRGALD
FT                   VRAKSVNNEMKIAAANAIAMLAREYVSDEVSDAYGGRKMNYGKDYIIPTPFDPRLITVV
FT                   SPAVAKAAIDSGVARKNIENWDEYTKQLASRLSLTSNILSMMYSAVKCDPKRVIFSEGE
FT                   EEKVIEAAVQWRNQEYGLPILVGRIDKVQEAFDRLGIKDTKGIEIANAAISQRNNEYTD
FT                   YLYKKLQREGYLYRSCVRDVKTDRNVFAACMLACGDGDVLITGMTRGYYASINDVQKVI
FT                   GSQGVVFGLSIIVMKERTIFVADTAIHESPTPEQIAEIAIQASVQAKKMGYEPRVSFIS
FT                   SSNFGSHSQEDAKKMRQAIKILDSYNVSFEYDGEMSVDTALNPELLTLYPFCKLTGEAN
FT                   VLVMPTLHSASISSKLLQRAAGVSVIGPILIGMEKPVQIVQMSSSVSEILNLTVLASLV
FT                   NNTNF"
FT   gene            167336..169978
FT                   /locus_tag="ECH_0176"
FT   CDS_pept        167336..169978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14671.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45169"
FT                   /db_xref="GOA:Q2GHT2"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT2"
FT                   /protein_id="ABD45169.1"
FT                   /translation="MRLLIYSGGTILVFLLFLIISPFFINWNSYYASHVLKQIEDISGD
FT                   VSVKGVGKVTGRLILPKIVINNLYIEGHGNELLNHKSTILISRLELKISLLSLLLFSPK
FT                   VNAITIDGLNIPLGNLLDLFSSFQSKNFNIKTFNVFNSVVNTSYDGTSFNSKPISIKSG
FT                   TIKTVSDMKVINGLLSIGKNDYNVVADISLNEEHRINANIYSQSTKVTLSGVAAGNAFD
FT                   GVILTNGSDFSQFINDISETNKTSIFSFINSHEEFSLSTNIKLLDKTFELNDFKLSTDS
FT                   MEGIGKVICSNYASCSANIDFSRIDVDRLYGVKHESDVYRKDSRTLDYLNTLISENLNY
FT                   NIKASAKEIKYHDQVSSNLIMDLEVSKGKISINQMTIMLPGNNNVLHVEGNVGSNDLIS
FT                   SFHGKLKINGDDFCSFAKWLFPIQVESKSSDKFSIQSDLYVAPRVFSLSHIEVLTDSFG
FT                   DVKGQLRIKYDRKGSAVVGDIEIHNIDFDQYKINEKLKIEDFMPMKWLKDIKYKINVDT
FT                   NISDFIIQKQQVSNLSFLVNVMQSKFAIDKIRFNGADGSDLSGFIKAYIGSQDLKPKIL
FT                   VSLKGNKYNTAFIKFPSLIRYVLDGSNKVTNIKWSNEDLKFYGLEHVDGNIDINIKNFI
FT                   SKDNSLKDFVLSSSLKDNLMSVNKLMFKVDDGFVSASGKIGMGSNTYSLSAVLSIANIG
FT                   LNNLLKHINVDGITGNVSISGSVQTQGKTLVDWINALDGKMEVVAKGVNVVGVDFNKFI
FT                   ISLLDVQSKSDVAALTQIGLYENNTVFNFISAGANIRRGNIISSLQFAIDNASGMASAN
FT                   ISLLQFAVMSKIRLSFIRPNVSSPSNVDMSLNGQLWQPRINFNVNALYEEIVKGGSQSV
FT                   SAHDEEFID"
FT   gene            170015..170158
FT                   /locus_tag="ECH_0177"
FT   CDS_pept        170015..170158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44607"
FT                   /db_xref="GOA:Q2GHT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT1"
FT                   /protein_id="ABD44607.1"
FT                   /translation="MKHAFLLMLEILRFCFDRLFVAYWNLGRLIYIFIIVGAEVNLGCE
FT                   FR"
FT   gene            complement(170138..171643)
FT                   /gene="cutE"
FT                   /locus_tag="ECH_0178"
FT   CDS_pept        complement(170138..171643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="ECH_0178"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45397"
FT                   /db_xref="GOA:Q2GHT0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHT0"
FT                   /protein_id="ABD45397.1"
FT                   /translation="MIEGDFYRKYNYTLAMILGVAGAISMAPFHMFIALLIAFSGFYIV
FT                   LSQVKNTRQAFFCGWWFGFGYFTASSYWVNVPLIIQSKIFWPLIPLTLILSASLSLLFA
FT                   AAAAISYTLNYKKLFGLITFSLSFTIASMLLGYIVPWNLFAYSWSFSIEMLQTASLIGT
FT                   YGMEFLAIFCSTAAGVSIRDKSTLPCITALLILVSMFIYGNDRLSNNQEQKYNQKIAIR
FT                   IVQGNTESHWDGNEEQEYDRFQTYLRLTSKYGLNSRTHVVWGENSFPFLTDTNSRSVQN
FT                   YLKFIIPGFLIAGGTRFENNKFHNTLFVINDNGQIIDFYDKLHLVPFGEFIPSILKNLI
FT                   PKSIANRLNYSPGTNKEKSISLNNQSPFIPLICYESIFSNEVTSRCTKGQWIINITNDG
FT                   WFGISSQPYQHLEINRVRSIENGLPTIRAANNGISAVIDSYGRIINSLPIMTEGIIDSY
FT                   LPYHISEGTIYSKHLNKFITIQFAIPIMLILVLLRFILSKFTS"
FT   gene            172216..173691
FT                   /locus_tag="ECH_0179"
FT   CDS_pept        172216..173691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0179"
FT                   /product="putative NADH dehydrogenase I, N subunit"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44810"
FT                   /db_xref="GOA:Q2GHS9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS9"
FT                   /protein_id="ABD44810.1"
FT                   /translation="MISSLPVLQVVIPLLSAIGCALLKDARLVKIISAIVVLISSAIAV
FT                   VLFFQVYHGGVIKYSIGGWIVPYGIELKVNVFNSMMLVLVGFVAMMSIVYGIYPNTKEI
FT                   NVRTIPSFYSVFLLCFSGFLGILVSNDVFNIYVFLEISSISSYILVAMGNNRNALIAAF
FT                   DYLVIGTIGATFYLIGVGFLYAITGTLNVGNLFLIVQDKSLTTNRAIQVGLLFIMLGLF
FT                   IKAALFPFHKWLIQAYNYAPTFISVFFSGVSTKVMIYLIIKVIYDVFKAELVLLTLPFN
FT                   IVFMSFAALSVISASILAMLSSNMKRIFAYSSVAHLGYIIFAVGLNTYYGLVAAVTYII
FT                   NHSLVKSALFMVMGSISYNCGSLELKDCTNIWKNMPKIALPFVILCISLIGMPITSGFI
FT                   SKWYVFDAAIKTNFWLGVIVLLIGSGLSVVYVWNIIEATCFKPSDKQVKKLFEVPNVMV
FT                   LCIWVMAISSIILGLYPVPLMMISNKIAESLLY"
FT   gene            complement(173803..173919)
FT                   /locus_tag="ECH_0180"
FT   CDS_pept        complement(173803..173919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45592"
FT                   /db_xref="GOA:Q2GHS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS8"
FT                   /protein_id="ABD45592.1"
FT                   /translation="MNNCIISKQIYFNFNKAAALFEKKTKVKIVVVQWFAGI"
FT   gene            complement(173970..174281)
FT                   /locus_tag="ECH_0181"
FT   CDS_pept        complement(173970..174281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45137"
FT                   /db_xref="GOA:Q2GHS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS7"
FT                   /protein_id="ABD45137.1"
FT                   /translation="MVMSYFDYILSYIINNPKYTALLVLVLLAGIAYLFKRKKSKSKYK
FT                   KSTTSYTNNNSSSSTFTPKPHNKNYIPEHSTQHSQGSNFFVVESVSQVFESKMQGRSR"
FT   gene            complement(174272..174394)
FT                   /locus_tag="ECH_0182"
FT   CDS_pept        complement(174272..174394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45461"
FT                   /db_xref="GOA:Q2GHS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS6"
FT                   /protein_id="ABD45461.1"
FT                   /translation="MYIFLIQDKNYLLFFSLNYYSKQLLNVIIKEVCINKVIWL"
FT   gene            complement(174604..175053)
FT                   /locus_tag="ECH_0183"
FT   CDS_pept        complement(174604..175053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0183"
FT                   /product="mce-related protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45269"
FT                   /db_xref="GOA:Q2GHS5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS5"
FT                   /protein_id="ABD45269.1"
FT                   /translation="MRRSNVIEIFAGLIVLVAAVSIGIIAFKKLPLNTTSHNCYIVKAH
FT                   FPSVDGLDIGDDITLSGVKIGTVTSISLDKNYSPTVTMCIQKNILLPSDSSASLSLSNL
FT                   LGRRHIDIALGSNEDVIPVEGFIEHTSSDLNLNVILTKLVNKFVK"
FT   gene            complement(175077..175370)
FT                   /locus_tag="ECH_0184"
FT   CDS_pept        complement(175077..175370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0184"
FT                   /product="NADH:ubiquinone oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF05071"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44517"
FT                   /db_xref="GOA:Q2GHS4"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS4"
FT                   /protein_id="ABD44517.1"
FT                   /translation="MKLFLNLQFLVKRNKKLVGKDILGNRYYITTANGIEKRWVIYNGK
FT                   ADPTKVPAPWHIWLHYADNQVPKSSQSLHLPNLTGTQYAYHPNKTFSFYNTK"
FT   gene            175498..175959
FT                   /locus_tag="ECH_0185"
FT   CDS_pept        175498..175959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0185"
FT                   /product="ATP cone domain protein"
FT                   /note="identified by similarity to GB:BAC44856.1; match to
FT                   protein family HMM PF03477; match to protein family HMM
FT                   TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44793"
FT                   /db_xref="GOA:Q2GHS3"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHS3"
FT                   /protein_id="ABD44793.1"
FT                   /translation="MKCPFCNSTDTQVKDSRSIENDMLIRRRRVCLVCHSRFTTTEKLL
FT                   LRSFMVVKKNGETELFNKQKLLSSILIATKKRPVSHEGINMMVNNIFYELEGKKENAIP
FT                   TNVIGKMVMDNLFKLDKVAYVRFASVYMNFRNINDFSNIIAKIISEKTP"
FT   gene            176071..176143
FT                   /locus_tag="ECH_0186"
FT   tRNA            176071..176143
FT                   /locus_tag="ECH_0186"
FT                   /product="tRNA-Ala"
FT   gene            complement(176256..177947)
FT                   /locus_tag="ECH_0187"
FT   CDS_pept        complement(176256..177947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44668"
FT                   /db_xref="GOA:Q2GHS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS2"
FT                   /protein_id="ABD44668.1"
FT                   /translation="MNNNIPITTNQASSFKLKVGENLHGFCNRNIYTVKITTEDNTEIV
FT                   MPSKNYFFVGDKFYVPYNNYLHDSYLNIPSEYQYIKVERTQYTTYSKETQDFYNLVICD
FT                   QNGEAYHYNYQKFYIRPENIIEKPETINLEEYYNVQKTRGDSPLFKISSEEPYKNTETS
FT                   PAILLDLHSNEKFAKLSPESLQYKHYSSANHDTFIFNYSDISKHHINDDKSIHLHNIRD
FT                   DVIQEEMENSPIFLVIQDGKFFFTDIEQEGSLVKDYNTALRVLNFANFQIQDIPNDNRY
FT                   VNMHEKFIFKVVKSDLQTEYGKNFASVILEDKEIALIPNDDNTHLFFDGNFSFEYCNNV
FT                   REVFKYDEPISGFTKSFAAISQEKLDSTNIYITIKSDEGDHTQTYFSDKQGNHILDLPN
FT                   TGLTEYLSTILPLDYSQNETHNISARDITHQASETIQEHNVLDQKEDNTRPEKLIDKEH
FT                   HTNEGNTFDPITEQDIDTIYFPLSKEHINIGDNIDQDKHHISFDLTYEGWLNFYEAIKE
FT                   NYSYDQVWSAYNNIFKDYGKEQENDNVYINQNNHIFIDNYDFGLVQ"
FT   gene            178181..181222
FT                   /locus_tag="ECH_0188"
FT   CDS_pept        178181..181222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0188"
FT                   /product="putative surface protein"
FT                   /note="identified by similarity to GB:AAD32553.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44951"
FT                   /db_xref="GOA:Q2GHS1"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS1"
FT                   /protein_id="ABD44951.1"
FT                   /translation="MTVFFEYNGSKVNTKEVVKRNTAGRTDQDKDSSTYVYNTYNAGDL
FT                   QGHVQQSFMRNNAEHNRTDTVLPYNDSYETLPVVPAVETGADGNSGKGNSVDFKSNVFC
FT                   NTHTIRDDQLKLNLEIHTLGNLSDRRLQEIKKGFDDSIIRFKDNFGLEPNEKDTTFELY
FT                   LFDDKEQYEHYGRLYNLGINGAGGMTFYGDADVPYKIYVYQFGEILNLKHELTHALENY
FT                   ASGHSLSKLKINHDIFTEGLADYIQNDGTFIMRELRDKEVTSSVLKEGSSKDIDQVSDA
FT                   AVAKDQHLSYSIGHAFVTFLQENYPGVISEYFAALREGNAVHAREIISMNKYADFEPWV
FT                   QSKDISLYLEGMNVLKIDLGEKMFSAKNAVSFENKNVRNEYYCENICTMNGEVVGKISP
FT                   VVHYADKDTIRTWNIASTDMIEVKPEYSFLKLVSTPSGKSAYVYCDKDGNEYFNTQSYV
FT                   EYAFNILKKYDENLRINGDFLDIRGRYSDADKVFDKIPNADLLLDQFLDKIGYGNYKQV
FT                   IMSDPEQVSVIKMHIVKKAFEDFRESEVKKVFTGESGVDSTIKNLLMDLTYINLSDVIG
FT                   VNGSNIESIVSDPNVMLRTAILGKGDASGISLYVGDQKVAELSTEGGYCVKDLDTNNVN
FT                   FVFRNAVGNIASSYQDRAYMVVCEKDGEFTTALIDDIQKTEHGNVIWDNQFNHPGVNHL
FT                   YPNYQKVLLNDASLKDYSHLANTRFHHDDTVIVRGDLLDDKGTVTTSDDIHQAVIKHDD
FT                   QVLHQFKSISFYISEPSTDSAGTYGSDFFIADEGKNLRFQLPKTITHLKLVNVDGNQKL
FT                   VPCTADGNEHPDGMPSNLTDEYRYIDPIFAHTFEKQSYSKNSVSIGLVDFDKYQEGTMF
FT                   KLQYYSDDYHINKDEHGNIIRPNNVSYKTKVDLVYDDKVIGMLSDNVNKFQGDVFVAAS
FT                   LNYSHSDFLSSKYFQKVNIEALENGVYSGRYDVGSGDEIANLDTDVGYSDKTVFYFKGS
FT                   NSPVDVLDNVDTVSTISPYINEFQ"
FT   gene            181597..182637
FT                   /locus_tag="ECH_0189"
FT   CDS_pept        181597..182637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0189"
FT                   /product="putative iron-binding protein"
FT                   /note="identified by similarity to GB:AAD03802.1; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45576"
FT                   /db_xref="GOA:Q2GHS0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHS0"
FT                   /protein_id="ABD45576.1"
FT                   /translation="MRLIACLGIIAVVILAFSFFTKKQQVQDLTQEVRVYSSRKEELLH
FT                   SLFKQFTKETGINVKYINDEAAQLINRMENEGTATSADVFLTADAVNLILAKKKGLLQP
FT                   VQSEVLNQAIPSKYRDSEGFWFGLTKRARVIVYNKDLVEKSDLSTYEHLANTKWKDKIL
FT                   VRSSSSPYNQSLIAFMIANNGIENTKIWVKGLVSNMARKPSGGDIDQIYAVAADEGSIA
FT                   IVNSYYFGRIAASDKKSDQIAVKKLGIFFPNQETTGTMINISGGAVTKNAKNKQNAIRL
FT                   LEFLTSVKAQKVYAQVNQEYPVVEGVELSEILGTFGSFKESNLPLQELEKHLTEAVKMA
FT                   DECGWR"
FT   gene            182684..182779
FT                   /locus_tag="ECH_0190"
FT   CDS_pept        182684..182779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44536"
FT                   /db_xref="GOA:Q2GHR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHR9"
FT                   /protein_id="ABD44536.1"
FT                   /translation="MFIRVNLLSKSSLRHTELLLKGYILVSCTLT"
FT   gene            182838..183008
FT                   /locus_tag="ECH_0191"
FT   CDS_pept        182838..183008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44661"
FT                   /db_xref="GOA:Q2GHR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHR8"
FT                   /protein_id="ABD44661.1"
FT                   /translation="MYFCMLAMGAEIFYDTVFVTCLVIKIMSFLLHNLYLLLISVKILL
FT                   LPIFIMDSLVS"
FT   gene            complement(183937..184200)
FT                   /gene="rpsP"
FT                   /locus_tag="ECH_0192"
FT   CDS_pept        complement(183937..184200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="ECH_0192"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by similarity to SP:P02372; match to
FT                   protein family HMM PF00886; match to protein family HMM
FT                   TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45435"
FT                   /db_xref="GOA:Q2GHR7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHR7"
FT                   /protein_id="ABD45435.1"
FT                   /translation="MSVKIRLARFGAKKRPFYRVVVADSRVARDGKFIESLGFYNPMLP
FT                   KEHELFVKVKVDRLKYWLSVGAQATDRISWFIKKGIINIETA"
FT   gene            184447..185715
FT                   /locus_tag="ECH_0193"
FT   CDS_pept        184447..185715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0193"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44809"
FT                   /db_xref="GOA:Q2GHR6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHR6"
FT                   /protein_id="ABD44809.1"
FT                   /translation="MNLRRAVLSTIMCNTLVWYDYVLFGNLVSVISKLFFPAEDRYFSL
FT                   IMTFSIFAVGFLMRPFGASIFGYIGDKYGRKAALTLSIIAISVPITFISILPTYEKIGI
FT                   LSPILLIICRLMQGISLGGEAGNATFLIEHSKKGKNIGFFGSFETLSAVLGSIIALFMI
FT                   LLSQYFTGENFEVWGWRIPFVIGLLLGLISVYIRRITGESPAYDTHKENNNLSQSPFLE
FT                   LLKKYKRPLVLATCIDCVENCSFHIFMVFFITFIKEFSNIHLNLNANTISIIESFNIMI
FT                   CGILNVFFGYISDYVGRRKVMLIASVSLFCVAIPVFWLLSQDSYVSLIAAYLIFVIPFS
FT                   ATLGPASGAMSELFPTKVRYTGFGLSRNIASAISGGMAPVVCTWLIRATGLSFIPGVYV
FT                   MFWALVGVIALCQIRKKDVYADW"
FT   gene            complement(186107..186286)
FT                   /locus_tag="ECH_0194"
FT   CDS_pept        complement(186107..186286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AF3011; match to
FT                   protein family HMM PF03966"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44914"
FT                   /db_xref="GOA:Q2GHR5"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHR5"
FT                   /protein_id="ABD44914.1"
FT                   /translation="MSNMFDHRILEILVCPLTKDKLQYNKDTNELISEKAKLAFPIRDG
FT                   IPIMLIDEARKLEE"
FT   gene            complement(186545..187240)
FT                   /locus_tag="ECH_0195"
FT   CDS_pept        complement(186545..187240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0195"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45064"
FT                   /db_xref="GOA:Q2GHR4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHR4"
FT                   /protein_id="ABD45064.1"
FT                   /translation="MLKTHKKGALITGGARRLGKAIAMFLANNGYDIAIHYNISEAHAL
FT                   QTKNTIEELYHQKCILIQADLIEFDSLSPIIDKTFEFMPYCNCIINSASVFYKNTLMNT
FT                   SIKDFTDHYNLHIRAPLFLTQYFAKKCTTTGNVINMIDAMITKDSTKYFIYTMSKKSLL
FT                   DLTKFTAVELSPKIKVNAIGPKMIPHHFLDNINHHNIMDNIEVKTILTRIAELLDDNNN
FT                   ETGTVNFIQ"
FT   gene            complement(187234..188274)
FT                   /gene="pheS"
FT                   /locus_tag="ECH_0196"
FT   CDS_pept        complement(187234..188274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="ECH_0196"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by similarity to SP:P08312; match to
FT                   protein family HMM PF01409; match to protein family HMM
FT                   PF02912; match to protein family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44710"
FT                   /db_xref="GOA:Q2GHR3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHR3"
FT                   /protein_id="ABD44710.1"
FT                   /translation="MLHSNIYNLQAEATNKILSSSSLEELESIKLYYFGKSGTITACLK
FT                   SIATISNIEERKSVGSSVNAICAELKSLINSQKEKLHKIQINAQLMQDRVDISLPVRPK
FT                   QIAKLHPISKTLHEVRHIFSSLGFKLSDGPELEDEFHVFDALNTHKNHPAREENDTFYL
FT                   KTLVNQKRVVLRTHTSSVQIRVMQANKGNYPIKIIAPGKVYRNDWDATHSPMFHQIEGL
FT                   YIDKNVNMGHLKYCIHYFLKKFFGENIQIRFRNSYFPFTEPSAEVDIKCGEKDWIEILG
FT                   CGMVHRNVLTNVNIDPDQYSGFAFGIGIERVAMLKYNISDLRKFYSNKLQWLNHYGFCF
FT                   THLVSC"
FT   gene            complement(188261..188635)
FT                   /gene="rplT"
FT                   /locus_tag="ECH_0197"
FT   CDS_pept        complement(188261..188635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="ECH_0197"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45437"
FT                   /db_xref="GOA:Q2GHR2"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHR2"
FT                   /protein_id="ABD45437.1"
FT                   /translation="MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRIALQRVEKALQY
FT                   AYRDRRNRKRFFRSLWIMRINAAVRQHGLLYSDFIHGLSLANVTLNRKVLADMAVNHKD
FT                   HFKQIVDLIKEALNKSRVAQ"
FT   gene            complement(188661..188861)
FT                   /gene="rpmI"
FT                   /locus_tag="ECH_0198"
FT   CDS_pept        complement(188661..188861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="ECH_0198"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44820"
FT                   /db_xref="GOA:Q2GHR1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHR1"
FT                   /protein_id="ABD44820.1"
FT                   /translation="MPKLKTKSSVKKRFSVTATGKIKSTQSAKRHGMTKRSKRSIRVQR
FT                   GTAIMNSSDSRIVKLFMPYSR"
FT   gene            189220..189861
FT                   /locus_tag="ECH_0199"
FT   CDS_pept        189220..189861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97712; match to
FT                   protein family HMM PF06242"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44593"
FT                   /db_xref="GOA:Q2GHR0"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHR0"
FT                   /protein_id="ABD44593.1"
FT                   /translation="MSNSNVPLAHNPKESSSTLEDSGPLMPRAVAVWLVDNTILTFEQI
FT                   AKFCNLHLLEVKGIADGEVAKGVVGCNPITMGQVTKEEIEYCQNDPTRVPRLISYRNFK
FT                   KSKKRTVRYTPVARRRDKPDAVAWILKYCPEMQDVCIAKLIGTTKSTIAAIRNKEHWNS
FT                   SNIKPRDPVLLGLCTQVDLDEAIMKAQIVAERERRVKNIKANDFSVSDSV"
FT   gene            190408..191676
FT                   /gene="rho-2"
FT                   /locus_tag="ECH_0200"
FT   CDS_pept        190408..191676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho-2"
FT                   /locus_tag="ECH_0200"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by similarity to SP:P03002; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF07497; match to protein family HMM PF07498; match to
FT                   protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44973"
FT                   /db_xref="GOA:P0CH93"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CH93"
FT                   /protein_id="ABD44973.1"
FT                   /translation="MLDLSELKKKTIEDLLKIAEDLGVVSNGRMLKQEIIFHLMKKVVS
FT                   DGGAAIGGGVVEILSDGFGFLRSPEANYAASGDDVYISAGQIKKFNLRTGDIVSGEIRA
FT                   PSEKERYFTLVKAHSINFTDMAKLQRYVHFDDLIPLYPEERILLECNDPISVSKKDISM
FT                   RVIDIVAPLGKGQRALIVAPPRAGKTIILQQIAHSISVNHPDIELIVLLIGERPEEVTD
FT                   MCRSVKGEVVSSTFDEPGYRHVQLAEIVIEKAKRMVEHKKNVVILLDSITRLARAYNSV
FT                   IPSSGKVLTGGVDSNALQRPKRFFGAARNIENGGSLTIIATALIETGSKMDEVIFEEFK
FT                   GTGNCEIILDRKISDKRVYPAIDISKSGTRKEDMLIDSVCLKKVWLLRRLLSSMGSVEA
FT                   MEFLRDKLLITKDNNEFFDMMNS"
FT   gene            complement(192202..192441)
FT                   /locus_tag="ECH_0201"
FT   CDS_pept        complement(192202..192441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0201"
FT                   /product="dnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44528"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ8"
FT                   /protein_id="ABD44528.1"
FT                   /translation="MTSTLNKVINDANVYNSPQNTSSSLSRGEALEILGLDKNASQEQI
FT                   NTAYHKLMKSMHPDKGGSPYLAQKLNEARDTLLN"
FT   gene            192635..193195
FT                   /locus_tag="ECH_0202"
FT   CDS_pept        192635..193195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0202"
FT                   /product="NifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45419"
FT                   /db_xref="GOA:Q2GHQ7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ7"
FT                   /protein_id="ABD45419.1"
FT                   /translation="MFIQIGETPNPNTLKFMPGMPINNGKVSEFADSVAAEGSSLATAL
FT                   FKIEYVKSVFFGGDFVSVTKSDDIEWDVLKPEILTVIMEFLTLNSDNATESFDQEELEE
FT                   FFDEKDIEMVGKIKELIDNYVKPAVIQDGGDIKFKGYSNGIVFVKLRGACSGCPSASIT
FT                   LKEGIYNMLSYYIPDIQGVESIQ"
FT   gene            complement(193803..195224)
FT                   /locus_tag="ECH_0203"
FT   CDS_pept        complement(193803..195224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44912"
FT                   /db_xref="GOA:Q2GHQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ6"
FT                   /protein_id="ABD44912.1"
FT                   /translation="MPKSKHKVRKYSTHSRLRNEIFEILSTDPLKLLLVIVPEVCDVPT
FT                   ADNENYRYHSIIQFYTNTSHKTIQDKKKARLLLKLWFKELINKISDRVIIFPEDQKIID
FT                   KALNKLFSNFKNISITQQTKDTLFKTFRKIILKSDINPELKEFFRSYALDMSSLTMYTR
FT                   EIIKEITSEITSAMNNPDATLLIACHGITGPYSNNYPNIPISQQIRYLYQHIMKIPPIN
FT                   PKTALNLFPKQHIVFSIQNKLINTRIKLKDHQNKTEKLLRHPYPWYSIINKLKQIIHIY
FT                   IVKPRITKKTEIIKQIENAFTESIAYGDTTLFFKQLQIIRHNTNISWNPYYKDIKITIR
FT                   SLSNMEPSAQDTMTIKEFVSNMKFYIKHEHVIYPTRNTTKQHLPSTSYTIREPITTGHN
FT                   KSRKSNIIKNTKKAILHIAKNSTKSIKNKLRKVIRHKKTKSYEKLITPSTNFTFLDSTS
FT                   SIKSTHTQPSTSTSL"
FT   gene            195482..195700
FT                   /gene="thiS"
FT                   /locus_tag="ECH_0204"
FT   CDS_pept        195482..195700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="ECH_0204"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44555"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ5"
FT                   /protein_id="ABD44555.1"
FT                   /translation="MSDVLITVVVNQKKMLFKPGLTLSEVLNECNYDTDLPFAVAVNRS
FT                   LVVRNKYDSTYLNDEDIVDIVYPMQGG"
FT   gene            195767..195871
FT                   /locus_tag="ECH_0205"
FT   CDS_pept        195767..195871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0205"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45054"
FT                   /db_xref="GOA:Q2GHQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ4"
FT                   /protein_id="ABD45054.1"
FT                   /translation="MCDMYVVESKNLLMLRRILGVNIVSFDGENKNIC"
FT   gene            195868..196650
FT                   /gene="thiG"
FT                   /locus_tag="ECH_0206"
FT   CDS_pept        195868..196650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="ECH_0206"
FT                   /product="thiamin biosynthesis ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44560"
FT                   /db_xref="GOA:Q2GHQ3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ3"
FT                   /protein_id="ABD44560.1"
FT                   /translation="MNLYGVLLKSRLLLGSAMYPSPAILRESIQLSGTEVVTVSLSRQM
FT                   PSENGGSDFWNIVKKSGCRILPNTAGCCTVNDAVLMSQMAREIFGTNWVKLELIGDEYT
FT                   LYPDLVLLCEATKELISQGFEVFPYCTDDLVVCKKLVNYGCRVLMPGISPIGSGCGVLN
FT                   MYNLKLLRNRFPEITIIADAGIGRPSDAAMIMEIGFDAVLLNTAIAKSIVPQDMSRAFK
FT                   YAVEAGRIAYDSGIIPKKDFAVSSTPLIDTPFWYNTSS"
FT   gene            complement(196891..197421)
FT                   /locus_tag="ECH_0207"
FT   CDS_pept        complement(196891..197421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0207"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AF3507"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44640"
FT                   /db_xref="GOA:Q2GHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ2"
FT                   /protein_id="ABD44640.1"
FT                   /translation="MLHITQNSDNIVHSFYIAIQKYFKFTNLKKHCNTFRFTNFYFNHT
FT                   IKCRAANYIIYMQSFIIYKHPKKINTSDGIVFVQDEFSFMAFIFSILFTFYNKLWLLSF
FT                   ISIVILSGIYIMYNTLNLINLPIYLSVNLLYSLYIASSYPDWYQAKLKKMGYKIHDVIF
FT                   AENLISAKLKFKR"
FT   gene            197517..198848
FT                   /gene="gltX-1"
FT                   /locus_tag="ECH_0208"
FT   CDS_pept        197517..198848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-1"
FT                   /locus_tag="ECH_0208"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P04805; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45168"
FT                   /db_xref="GOA:Q2GHQ1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHQ1"
FT                   /protein_id="ABD45168.1"
FT                   /translation="MITRFAPSPTGYLHVGNVRTALVCWLYARKQNGKFLLRFDDTDTQ
FT                   RSKDEYIREIENDLVWLNINWDSSFRQSSRFDRYEDVFNYLLKEGLIYPCYESKEELEF
FT                   KRKMKLKLGLPPIYDRSALNLTQAEKDKYSERAPYFRFKIDQNQLISWNDEVRGKVSFN
FT                   SENISDPIIRRVDGTYTYMLPSIIDDMDFNVTHIIRGEDHISNTAVQIQMLHALKASIP
FT                   IFSHLSLLYSDDNKISKRVGGSSVKDMQSYGLEPMAINSYFAKIGTSNPVSVHTRMCGL
FT                   IDSFDITTFSQAPTKFNIDDVLKLNPKVLCSMSFDDVRNRLQSFNITSPSFWNFVCGNI
FT                   DKFSDIEGWAKICSGDMIPVIGQDDKDFIMLALNMLPQGEVRDNTWNLWISNIKQHTDR
FT                   RAKNLFTPLRLALTGLSTGPELAKLLPLIGRVEIVRRLSYSEVQ"
FT   gene            198945..199019
FT                   /locus_tag="ECH_0209"
FT   tRNA            198945..199019
FT                   /locus_tag="ECH_0209"
FT                   /product="tRNA-His"
FT   gene            199330..200517
FT                   /locus_tag="ECH_0210"
FT   CDS_pept        199330..200517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0210"
FT                   /product="surA domain protein"
FT                   /note="identified by similarity to SP:P21202"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45164"
FT                   /db_xref="GOA:Q2GHQ0"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHQ0"
FT                   /protein_id="ABD45164.1"
FT                   /translation="MFNHAVRLLVLFIILYSSNVFASVKIVAMVNDELISNLDLEKRIA
FT                   INKFFYKVEGNTAEEIALNALIDESIWRQEARKLKVTVTERDLLEAIKQFLVIKNLGNI
FT                   DLKSYVEAQGLDYKLFVQHMKSKLLWNKILMLKIAPYIIISDKEVQDSRDNMVGNGLDI
FT                   SVHIQEVMLPASMNDNESIISSIISELQSGVSVETIKANRKDVLFEEASVNVKNIDANL
FT                   ANKLLNAKIGDVIGPMKSEYGTLIIKLIHRSDINKEFANSNVDLRQMHLNIEQGKEYLD
FT                   QISILKTKATCENFNSVAKELGLPEPLSFVIKVKDLSVKIQNVLQSCDVGKVVEVTDNN
FT                   VVDVIMLCNVTKGKADDVVDNADFIKQRLYMEKLSMQSEYLLSTLKKNALIEKYN"
FT   gene            200523..201074
FT                   /locus_tag="ECH_0211"
FT   CDS_pept        200523..201074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0211"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44662"
FT                   /db_xref="GOA:Q2GHP9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP9"
FT                   /protein_id="ABD44662.1"
FT                   /translation="MLRITSGKYRGRRIFSDKLLSARPAMSIIRESIFNIILSRMSIQG
FT                   CKILDLFCGSGSLSFEALSRGAESVLLVDINHYNLSLVKRTSEYLGVVNNVTLMCCDVE
FT                   KLPLATDQYDIVFVDPPYTNPNLVDMTLNVLIKLNWVKSSSIVVVRIRKKVVFVCPIGY
FT                   RIMVERTYGISKVIMLQREF"
FT   gene            complement(201489..202403)
FT                   /locus_tag="ECH_0212"
FT   CDS_pept        complement(201489..202403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0212"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to GB:AAS13992.1; match to
FT                   protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45307"
FT                   /db_xref="GOA:Q2GHP8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP8"
FT                   /protein_id="ABD45307.1"
FT                   /translation="MFFILLSKILPLYITVLLGFIAGKFLKIDSPSIARLLFYIMGPTV
FT                   IFSGISQTNINSEVLSLPFLTWLVCCIMSAVVYYTSSFIFRDSTRNILAFSSGSSSMGF
FT                   FGLPVALAMFDNHTVSIYLFCYVGMLMFENSFGFYIAAQGIYTPKKCIIKLITSPAAHA
FT                   AVMALCVNYFKIPIPSFVHDVASNIRGAYVSLGMMLLGIAVANIKTFSIDWKLISITLI
FT                   IKYVLWPVLVLGCIILDKLTIQLYNNDIYRALILLAIIPMSGTGIILATMLNNNPDKTA
FT                   IMLLVNTIIGLFYVPIMISILLY"
FT   gene            complement(202899..203213)
FT                   /locus_tag="ECH_0213"
FT   CDS_pept        complement(202899..203213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0213"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF04800"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44783"
FT                   /db_xref="GOA:Q2GHP7"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="PDB:2LJU"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP7"
FT                   /protein_id="ABD44783.1"
FT                   /translation="MQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPL
FT                   MNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYADNFTKPRDM
FT                   "
FT   gene            203259..203447
FT                   /locus_tag="ECH_0214"
FT   CDS_pept        203259..203447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0214"
FT                   /product="putative exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45454"
FT                   /db_xref="GOA:Q2GHP6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP6"
FT                   /protein_id="ABD45454.1"
FT                   /translation="MSINDEYNFEAAIEQLEYIVKELESDEVTLARSVELYSLGKELYE
FT                   YCNKIIEDIELKIEIKE"
FT   gene            203618..203830
FT                   /locus_tag="ECH_0215"
FT   CDS_pept        203618..203830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0215"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44966"
FT                   /db_xref="GOA:Q2GHP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP5"
FT                   /protein_id="ABD44966.1"
FT                   /translation="MYKKKFLVVLNYKKICVLKILEHWMLYWFYLEYVSSMIVYRFFRI
FT                   DFTLIGLPVIINDEICRKATHLLHC"
FT   gene            203787..203897
FT                   /locus_tag="ECH_0216"
FT   CDS_pept        203787..203897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45569"
FT                   /db_xref="GOA:Q2GHP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP4"
FT                   /protein_id="ABD45569.1"
FT                   /translation="MMKFVEKLLICYIVKLVIARCKVYGAFGYLINVSIE"
FT   gene            204031..205269
FT                   /locus_tag="ECH_0217"
FT   CDS_pept        204031..205269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0217"
FT                   /product="tRNA modification enzyme, MiaB family"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01579"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45053"
FT                   /db_xref="GOA:Q2GHP3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP3"
FT                   /protein_id="ABD45053.1"
FT                   /translation="MSDVITFGCRLNFYESEVIKNNLKKAQLDDVIVVHSCAVTNEAER
FT                   QVRSRIRKLYRDNANVKIIVAGCAVQLNPELYVNMPGVIKVLGNQDKLKYESYLAKDKI
FT                   IVSKIENSKEVVQDSVKGFSGKSRALIEIQNGCNHECTFCVITKARGNNRSLYIEDIIT
FT                   KVKACVDNGYNEVVFTGVDISDFGLDIYGQRVLGTMIKRVLSAVPQLRRLRLSSIDVAE
FT                   IEDDLINIIINEPRFMPHLHLSLQSGNNLILKRMKRRHSREQVIEFCNKITSKRKEVVF
FT                   GADIIVGFPTETEEMFNDTVRLIEEANISYLHVFPYSKREGTPAARMPQVVQEVKKRRV
FT                   KHLLEFAEKRLHDFYSTLLHTKQSVVVEKSGTGRAENFALVKFLDDNVQLQSIVEVEIK
FT                   RVEGNYLVGQVFV"
FT   gene            complement(205658..205981)
FT                   /gene="trx"
FT                   /locus_tag="ECH_0218"
FT   CDS_pept        complement(205658..205981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="ECH_0218"
FT                   /product="thioredoxin"
FT                   /note="identified by similarity to SP:P06544; match to
FT                   protein family HMM PF00085; match to protein family HMM
FT                   TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45579"
FT                   /db_xref="GOA:Q2GHP2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:6ALI"
FT                   /db_xref="PDB:6AMR"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP2"
FT                   /protein_id="ABD45579.1"
FT                   /translation="MIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKL
FT                   AQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINN
FT                   NIN"
FT   gene            complement(206250..207062)
FT                   /gene="virB9-2"
FT                   /locus_tag="ECH_0219"
FT   CDS_pept        complement(206250..207062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9-2"
FT                   /locus_tag="ECH_0219"
FT                   /product="type IV secretion system protein, VirB9"
FT                   /note="identified by match to protein family HMM PF03524"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45287"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP1"
FT                   /protein_id="ABD45287.1"
FT                   /translation="MKRCTFYYKLQMKNVAIIFVLILFSSTVCFAKQEVRSIAQDNHIK
FT                   VITYNPHAVHKYTGFYGYQSSIVFDDGEDIDTISMGDSTGWQLMPKGNRLFIKPVADKA
FT                   DTNATIITNKRVYYFEFFAEEAQGLDDPRLAYEVRFVYSSTEDFISEDSPGMVFPVNQP
FT                   AIPDLTDSDVAKKGLNFDYLVSHNRGSQRIVPLKIFDDNQFTYMQFAQINADLPSIFTV
FT                   DSEGYESLINFRVSGDYVIIERVSSAFTLRYGSDTVCVFNNKYKKTKR"
FT   gene            complement(207354..208337)
FT                   /gene="pdhA"
FT                   /locus_tag="ECH_0220"
FT   CDS_pept        complement(207354..208337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="ECH_0220"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by similarity to SP:Q9R9N5; match to
FT                   protein family HMM PF00676"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44567"
FT                   /db_xref="GOA:Q2GHP0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHP0"
FT                   /protein_id="ABD44567.1"
FT                   /translation="MTKKYSHNLTNEQLVNCYYSMLLMRRFEEKSGQLYGMGLIGGFCH
FT                   LYIGQEAIATGIQNAIIDGDSIITSYRDHGFMLSVGTDPKYVMAELMGKSTGCSKGKGG
FT                   SMHMFNIEKHFFGGHGIVGAQVPIGTGIALANKYKKNNNVVFVCLGDGAVNQGQVYESF
FT                   NMAALWKLPVIYVIENNEYAMGTSVSRSSYITDLYKKGESFGVPGHQVDGMDLFSVTQA
FT                   ATDAVNYCRANNGPILLEMKTYRYRGHSMSDPAKYRSKQEVEEIKEHKDPITNLKNYLI
FT                   SNNIISDDECNKYDKEIRNIVKESVDFSQNSSEPDAKMLYTDIYKD"
FT   gene            complement(208547..209401)
FT                   /locus_tag="ECH_0221"
FT   CDS_pept        complement(208547..209401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0221"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45290"
FT                   /db_xref="GOA:Q2GHN9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN9"
FT                   /protein_id="ABD45290.1"
FT                   /translation="MLPYTLNISHLQEKFIMHYNYTNSPSSNYLICVHGITRNSRDFDY
FT                   LANILSSDYKIICPDIVGRGKSSWLEDYSLYNYLTYCKSIIYLLKHLKIDKVDFLGTSM
FT                   GGIIGMYLAAYFPNLINKLIINDIGPAIKVSALEKISKHININPIFNTITEAEIYIKKL
FT                   LCNFSIDQEDHWQHIIKHSIIQNPNKTYSLAVDPKIGIAFNKEINCIKDTDAWTIWDIW
FT                   EKIQSRILVIRGSLSNILTKTTLNKMLLSKQYIDFIEYPNIGHAPALMSNNQIQDIRNW
FT                   LLS"
FT   gene            209676..212447
FT                   /gene="rrlE"
FT                   /locus_tag="ECH_0222"
FT   rRNA            209676..212447
FT                   /gene="rrlE"
FT                   /locus_tag="ECH_0222"
FT                   /product="23S ribosomal RNA"
FT   gene            212537..212637
FT                   /gene="rrfC"
FT                   /locus_tag="ECH_0223"
FT   rRNA            212537..212637
FT                   /gene="rrfC"
FT                   /locus_tag="ECH_0223"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(213163..214620)
FT                   /gene="guaB"
FT                   /locus_tag="ECH_0224"
FT   CDS_pept        complement(213163..214620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="ECH_0224"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44834"
FT                   /db_xref="GOA:Q2GHN8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN8"
FT                   /protein_id="ABD44834.1"
FT                   /translation="MELSYAFDDILIIPSESDVLPSETNVKTYITNEIELRIPIISAAM
FT                   DTVTEAKLAIALAQHGGIGCIHKNLPIDTQLLEVRKVKKYESWIVYNPIAVSPDDSLAV
FT                   ALSIMQEYSYSGIPVVTDTENGKLLVGILTNRDVRFVENKNCKVSDIMTKDHLITVPEG
FT                   IERSDAIKLLHQYRKERLIVVDNNYCCVGLITVKDIEKFNQFPNSCKDSGARLRVAAAV
FT                   GTGPKDGIERAEALIAEDVDIIVVDTAHGHSQKVLTTIKEIKTLFPYSQIIGGNIATAE
FT                   GAHALIEAGVDAVKVGIGPGSICTTRIVTGVGVPQFSAILNVANACKNKKIKVIADGGI
FT                   KYSGDIAKSIAAGADVVMIGSIFAGTDESPGEIIICNGRAYKSYRGMGSVGAMKRGSAS
FT                   RYFQENNHKFIPEGIEGRVPLKGPVAGVIHQLVGGLRSAMGYTGNRNISEMKTNCKFTS
FT                   ITSAGLRESHVHDVIITREASNYDPIS"
FT   gene            complement(214700..215491)
FT                   /locus_tag="ECH_0225"
FT   CDS_pept        complement(214700..215491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0225"
FT                   /product="putative ATP-NAD kinase"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45580"
FT                   /db_xref="GOA:Q2GHN7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN7"
FT                   /protein_id="ABD45580.1"
FT                   /translation="MSKYKNIGYVFTDAFDKTAAIALEKQYGLIDIKKNEDIAIDLLIV
FT                   IGGDGFMLHSLHNYVVNKCNNVPVYGINYGTIGFLLNQYSEYNLIDRINEAIPTQLTIL
FT                   NMVATDTDKKQYNAIAINEVSLFRSTHQATNLQIKINSKLVMEKLVSDGVLVATPAGST
FT                   AYNFSAGGSILPLNSNVFSLTAINSFRPRRWRGAILTNSTIIEIDVINPKVRSVAAVAD
FT                   YTEFRNITNIKIKKDTDTTITLLFDKERNLEERITNEQFSA"
FT   gene            complement(215548..215775)
FT                   /gene="rpmE"
FT                   /locus_tag="ECH_0226"
FT   CDS_pept        complement(215548..215775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="ECH_0226"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by similarity to SP:Q8U9I5"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45555"
FT                   /db_xref="GOA:Q2GHN6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN6"
FT                   /protein_id="ABD45555.1"
FT                   /translation="MKKGIHPETNDILTIFTNGEERKMKSTLGKKNELIKIHLESDCFN
FT                   HPAWNPNLRTVSKKNSKAAKFMSKFGDLDL"
FT   gene            215951..216922
FT                   /gene="fabD"
FT                   /locus_tag="ECH_0227"
FT   CDS_pept        215951..216922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="ECH_0227"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by similarity to SP:P71019; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44777"
FT                   /db_xref="GOA:Q2GHN5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN5"
FT                   /protein_id="ABD44777.1"
FT                   /translation="MIFMFPGQGSQFVSMGKNIYDNFAVARYVFHEVDDILNKKLSKIM
FT                   FEGSIENLTSTDNAQLALMVTSIATLRAIEYVLGKPVHLFNNIKYMAGHSVGECVALCA
FT                   SGALTLYEVTQLLLVRSQAMYDAVPLGYGGMCALIGGSLSDVENVVKMAQEYGICEIAN
FT                   DNCDGQVVVSGVKAALEKLPDLIKDTGIKKVIKLQVSGPFHSSLMSSACEKLQEFIESV
FT                   RNMKMPSVKVVSNVSAREYTDCFMIKNLIAKQLVSRVRWRESILYMISQGCTHFIEVGA
FT                   GTTLSGLVKRISSDVSAVSINTADCIDSITRHFTVSTDLVDA"
FT   gene            complement(217031..217126)
FT                   /locus_tag="ECH_0228"
FT   CDS_pept        complement(217031..217126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45100"
FT                   /db_xref="GOA:Q2GHN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN4"
FT                   /protein_id="ABD45100.1"
FT                   /translation="MQVKIPKSLIPYKVSNNKLTFYKTYADHYLK"
FT   gene            217178..217786
FT                   /gene="tmk"
FT                   /locus_tag="ECH_0229"
FT   CDS_pept        217178..217786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="ECH_0229"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by similarity to SP:P37537; match to
FT                   protein family HMM PF02223; match to protein family HMM
FT                   TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45252"
FT                   /db_xref="GOA:Q2GHN3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="PDB:3LD9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHN3"
FT                   /protein_id="ABD45252.1"
FT                   /translation="MFITFEGIDGSGKTTQSHLLAEYLSEIYGVNNVVLTREPGGTLLN
FT                   ESVRNLLFKAQGLDSLSELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAYQGY
FT                   GQGIDCSLIDQLNDLVIDVYPDITFIIDVDINESLSRSCKNGYEFADMEFYYRVRDGFY
FT                   DIAKKNPHRCHVITDKSETYDIDDINFVHLEVIKVLQMV"
FT   gene            217847..219082
FT                   /locus_tag="ECH_0230"
FT   CDS_pept        217847..219082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0230"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44707"
FT                   /db_xref="GOA:Q2GHN2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN2"
FT                   /protein_id="ABD44707.1"
FT                   /translation="MGDVLNRKFLAWFLVSMFYAYQYILRVIPNVIVSVSMEKFKISAM
FT                   AFGQFSGLYYIGYTLAHIPLGILLDKYGPKIVLPICAALTFIGLVPLLISDVWLFAQIG
FT                   RIITGVGSAGSALGLFKVASMYYGNRFARMSGISVIIGLLGAMYGGLPILSLLNKFGWE
FT                   SLFLVFIIIGAVIALLLYLFMLPYDKDSNVEDNKGLCDKIKLIVFNKYIVMISLLAGFM
FT                   IGPLEGFADGWVTSFLKAVSNMDKEVAALLPSTIFIGMCFGLFVLPYMLEKKSFNSWNI
FT                   LITSALGMLFPFLMLYISSSVILVTISFFMIGFFSSYQIIATCKVLSYVSNNVVALATA
FT                   VNNMIAMAFGYFFHTAISCVIDLLWDGKIVDSEPVYTKALMLKSMLFIPGGLLIGAIGF
FT                   IYLKYLDKKEGK"
FT   gene            219533..219631
FT                   /locus_tag="ECH_0231"
FT   CDS_pept        219533..219631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44868"
FT                   /db_xref="GOA:Q2GHN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN1"
FT                   /protein_id="ABD44868.1"
FT                   /translation="MVYHEFYVYFNIIYFTTKLFVNSKIGMSDYTD"
FT   gene            complement(219619..220257)
FT                   /locus_tag="ECH_0232"
FT   CDS_pept        complement(219619..220257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0232"
FT                   /product="tim44-like domain protein"
FT                   /note="identified by similarity to GB:AAS13862.1; match to
FT                   protein family HMM PF04280"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45207"
FT                   /db_xref="GOA:Q2GHN0"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHN0"
FT                   /protein_id="ABD45207.1"
FT                   /translation="MVELAIYAFLAAFIFFRLYHSLGKTSGLQSNSHSQTISIIMEDTQ
FT                   EHDTADIDIDSVMEICNENDKSIINHIKKKDKEFSLRHFMDGSIKAFEIIIKAFNEGNI
FT                   HILSMLLDTNLYNSFVEEIENRKALGQLYEDIIVSITSHKITKLSLSGNIAYITVKFIS
FT                   EQINFVKDKDDNILQGSTSKINKIEDTWTFRKDTTLSNKKWYLSTIQSV"
FT   gene            220370..220897
FT                   /gene="secB"
FT                   /locus_tag="ECH_0233"
FT   CDS_pept        220370..220897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="ECH_0233"
FT                   /product="protein-export protein SecB"
FT                   /note="identified by similarity to GB:AAM89273.1; match to
FT                   protein family HMM PF02556; match to protein family HMM
FT                   TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45000"
FT                   /db_xref="GOA:Q2GHM9"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHM9"
FT                   /protein_id="ABD45000.1"
FT                   /translation="MSCKLKVKGQYIKDLSFENPNSPQIFLMISKTPPEINISINVSSV
FT                   SLPVKAQDQSSEQPSDNKVEPLYEVTLQVNAEARVGTTVAFICEIKYCGVFSIESDDVS
FT                   IEELSQQDIRDVLLISAPTILFPFVRELISRVTSTGGFPPLMLDIVDFRAMYESQMKQG
FT                   VGQNDNSQDPEK"
FT   gene            220978..221700
FT                   /locus_tag="ECH_0234"
FT   CDS_pept        220978..221700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14712.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44565"
FT                   /db_xref="GOA:Q2GHM8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM8"
FT                   /protein_id="ABD44565.1"
FT                   /translation="MKCLVISKLFFLFVVVFFFNFAFCSDNNKQEPEQKFYSDTLVKLD
FT                   DDITAQELLSLLPNDRFIGNTKAPVIIIEYASFSCMHCAHFTLNVFPELERKYIKTGKV
FT                   LYIFRNFPLDYISLKAAMLGICYNTASSFFTYTKAVFSSIEALVTNYKDLGVLSNIAKI
FT                   SNVTDERFEKCINDEDIMNYIVQEKFVANRKLQVNATPVFFINGRKYDKPHDIESFSET
FT                   IDELIMLHPNYSLVGSKP"
FT   gene            complement(221811..223076)
FT                   /locus_tag="ECH_0235"
FT   CDS_pept        complement(221811..223076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0235"
FT                   /product="peptidase, M16 family"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44534"
FT                   /db_xref="GOA:Q2GHM7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM7"
FT                   /protein_id="ABD44534.1"
FT                   /translation="MSPKITQLSNNFTIITDTMPYVESVSINIWVNVGSRYENINITGI
FT                   SHFLEHMAFKGTKTRTALDIAQIFDDIGGNFNAHTDREHTVYHVKTLKRDIKIAIEVLA
FT                   DIILNSQFPEEEIYKEKGVVLQEIYQTNDSPTSIIFDKYIEAAYPNQIFGKSILGTPES
FT                   VNSLSKADLHIYMSEYYHAGNMLLSVAGNISHEEVIDLVSQYFSHMKKSQRKIADPSIY
FT                   RSGEYREIRNLEQVHLVIGFPSVSYKDDLFYTIQILDSILGNGMSSRLFQKIREQLGLV
FT                   YTISSFNSSYSDNGIFSIYAATDKSNLSQLLSTIASEVKNIITNLQENEITRAKGKLTS
FT                   EILMSRESTTARAESLGYYYSHYNRYISKEELIKKISTITVTDIQNCINNLLGSNNKIT
FT                   LAAIGQIENLPSYDDIAQMFYI"
FT   gene            complement(223247..223339)
FT                   /locus_tag="ECH_0236"
FT   CDS_pept        complement(223247..223339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0236"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45062"
FT                   /db_xref="GOA:Q2GHM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM6"
FT                   /protein_id="ABD45062.1"
FT                   /translation="MLLIKQAVQPTLPFTYHNVPLKVYIKQVFR"
FT   gene            223716..225119
FT                   /locus_tag="ECH_0237"
FT   CDS_pept        223716..225119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13931.1; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45420"
FT                   /db_xref="GOA:Q2GHM5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM5"
FT                   /protein_id="ABD45420.1"
FT                   /translation="MRKKIKKVLISGKSVWPIIEGGKGIGASDGRTAGAFAAASAVGTF
FT                   SGACARLVDDNGEHVPLIYRGKTRLERHNELINYSIDAAVSQARMAHEISKGLGRIHMN
FT                   VLWEMGGVQRVLHGVLDKAKGLIHGITCGAGMPYKLVEIAAQYQVYYYPIVSSMRAFKI
FT                   LWQRSYQKFSKTLLGGVVYEDPWLAGGHNGLSNSESPGHPQDPFERVAAIRAYMNEVGL
FT                   SDVVLIMAGGVWHLKDWESWLDNDLIGPIAFQFGTRPLLTQESPISPGWKKKLMSLKPG
FT                   DVFLNRFSPTGFYSSAIENEFIKELQARNTRQIAFENEMTEKCSAELSIGSRGRKVYVD
FT                   PKDKKLSESWVAMGYTDALKTPDNTLIFVSQSQSRSIREDQINCMGCLSHCKFSNWKDH
FT                   GDYTTGIKPDVRSFCIQKTLQNIIAGVDHEHELMFSGHNAYKFVQDEFYRDGYIPTIKE
FT                   LVDRILTGY"
FT   gene            complement(225183..225344)
FT                   /locus_tag="ECH_0238"
FT   CDS_pept        complement(225183..225344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0238"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45322"
FT                   /db_xref="GOA:Q2GHM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM4"
FT                   /protein_id="ABD45322.1"
FT                   /translation="MLIHAKLQINFTNRKATTLSAKQKFHKHILYLLKTSSSKYHKTYK
FT                   VQEEFLCD"
FT   gene            complement(225372..225995)
FT                   /gene="ribE-1"
FT                   /locus_tag="ECH_0239"
FT   CDS_pept        complement(225372..225995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE-1"
FT                   /locus_tag="ECH_0239"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to SP:P51961; match to
FT                   protein family HMM PF00677; match to protein family HMM
FT                   TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44804"
FT                   /db_xref="GOA:Q2GHM3"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM3"
FT                   /protein_id="ABD44804.1"
FT                   /translation="MIQYWMFKGIIEDIGTIIQVDYTKGQDRRLVIKPTNANFLSETKI
FT                   GDSIGCSGICLSAVELDNECFSADVSDATLSVTSAAHWKEGTKINLELPLKMTDRLDGH
FT                   FVQGHVDGVGNIISITNVNSSHNIEFHIPDALLKYMIRKGSIAIDGVSLTINSISNNIL
FT                   SVNIIPHTWKKTTFQYNKVNDNINIEVDMLAKHLERLYEHNIKV"
FT   gene            226194..226670
FT                   /locus_tag="ECH_0240"
FT   CDS_pept        226194..226670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45396"
FT                   /db_xref="GOA:Q2GHM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM2"
FT                   /protein_id="ABD45396.1"
FT                   /translation="MLNNFNASILHVGRNVSNHSVFDGIFDHSDDFTGNDTLIPKGFNN
FT                   IGTGRDDLLAAGVIAFYVLVVVVVGGLIYWIGNRDLMRQNGYTKCTSKASIMLENTDSS
FT                   DSHVEEKISLLIVSDDINPQESKEESECIPKVLDQQHVASIQSKECSLHYSHVV"
FT   gene            226586..226735
FT                   /locus_tag="ECH_0241"
FT   CDS_pept        226586..226735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44954"
FT                   /db_xref="GOA:Q2GHM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM1"
FT                   /protein_id="ABD44954.1"
FT                   /translation="MYSKSIGSTACCFNSIKRMFITLFSCCVSAIVDMYNYVFLFVLRI
FT                   LLPK"
FT   gene            complement(226712..226873)
FT                   /locus_tag="ECH_0242"
FT   CDS_pept        complement(226712..226873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45141"
FT                   /db_xref="GOA:Q2GHM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHM0"
FT                   /protein_id="ABD45141.1"
FT                   /translation="MGYIHYIPGKGLKHILTLHVCKALAKKATTPYPTFCYTYMFAHLS
FT                   DSFRQQNS"
FT   gene            227093..227974
FT                   /locus_tag="ECH_0243"
FT   CDS_pept        227093..227974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45264"
FT                   /db_xref="GOA:Q2GHL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL9"
FT                   /protein_id="ABD45264.1"
FT                   /translation="MSWLDLLKSVLTSIVAGVSDYTSFILNNTVNGTLDVTRRNVTALH
FT                   DILNNTLTTISNNVVSNISSTTDSIGIVTSRIGNYTSFILNSTVDSILDVTRRNVTMLY
FT                   DIFNGTFTTSNTVSNISSTTDSVGMATNNSIVSQDNAASNYHINTIMYVVMACAILCMM
FT                   RHICHHFMQGVQGERRVRRIAREFSEIREPRMSSDVNITGMSRASICCDSREDVEVQQS
FT                   RVNIEGEGGVATQLDLEYVPQNVCHRLRHWMARLCHRRSTVYSVGSDLGMELDVMSRVE
FT                   EETECVEESMSF"
FT   gene            228232..228345
FT                   /locus_tag="ECH_0244"
FT   CDS_pept        228232..228345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45084"
FT                   /db_xref="GOA:Q2GHL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL8"
FT                   /protein_id="ABD45084.1"
FT                   /translation="MLLFNRLGCALTAIVVSVSHGVSRIIDTTFIKIVIST"
FT   gene            228503..228610
FT                   /locus_tag="ECH_0245"
FT   CDS_pept        228503..228610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44913"
FT                   /db_xref="GOA:Q2GHL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL7"
FT                   /protein_id="ABD44913.1"
FT                   /translation="MLLFNRLGCALAAIVVSVSYGISRTVNTTFIKIVI"
FT   gene            228670..229497
FT                   /locus_tag="ECH_0246"
FT   CDS_pept        228670..229497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45417"
FT                   /db_xref="GOA:Q2GHL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL6"
FT                   /protein_id="ABD45417.1"
FT                   /translation="MAAIIVSVSHGMLHVINTTASMGGENVTTTMRNIFTRVFNNTVDS
FT                   TVENESTTIPSALNDTVTDIVNSAVNSTMENGSGSATISSILNNTVADVVNSTVSSTME
FT                   SGSSSATISSILNNTVTDIVNSTVSSAMESGNGSTTISSTFNRTITVISSSTTGQSSGG
FT                   EYALLQAFIMVMGVFLLMLSLLMCVRSVQRCRTDILRARARLNYLREHGGDPPDTVNNA
FT                   AMELDIVRDVEVVTDELNLENRPCLCQHDHQEAPDDPVEQVRPVFRLQGIFPR"
FT   gene            229809..230717
FT                   /locus_tag="ECH_0247"
FT   CDS_pept        229809..230717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0247"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAO05891.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45446"
FT                   /db_xref="GOA:Q2GHL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL5"
FT                   /protein_id="ABD45446.1"
FT                   /translation="MSSVNHGISYVLNSTTSIGNGNLTTTTLSNLFTRVLDDTVSSTVE
FT                   NGSNTTTVSSALNDTVSDIVNSAVSSTMENGSSSTTISSILNNTVSDIVNSTVSSTMEN
FT                   GSSSTTISSILNNTVSDIVNSAVSSTMENGGGSTTISSVLNSTFTNILNSAVGSTVEGS
FT                   VGNATTIFPVLNNTVTSSTRNNSLHDSTLIAAFIMIMGTFLLMFSVMICVRSVQTCRSN
FT                   IRRHRVQMAYLREHGGGGPPDNLSDAVIALDVIGEVSVVTESSNVENRPFLLCQHDHQE
FT                   DPADSAEQVRPVFRLQGIFPR"
FT   gene            231473..231697
FT                   /locus_tag="ECH_0248"
FT   CDS_pept        231473..231697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44768"
FT                   /db_xref="GOA:Q2GHL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL4"
FT                   /protein_id="ABD44768.1"
FT                   /translation="MCVYMNDKVFVVTIISMIVLVTLVFFFFPLFSICHRAVKDNTNQQ
FT                   DNNVNSELDDLENVSDDVVLVAQQQKLRF"
FT   gene            complement(231601..231741)
FT                   /locus_tag="ECH_0249"
FT   CDS_pept        complement(231601..231741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45187"
FT                   /db_xref="GOA:Q2GHL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL3"
FT                   /protein_id="ABD45187.1"
FT                   /translation="MVDILLKNIRANPQHQNLSFCCWATNTTSSLTFSRSSNSEFTLLS
FT                   C"
FT   gene            complement(232089..235493)
FT                   /gene="mfd"
FT                   /locus_tag="ECH_0250"
FT   CDS_pept        complement(232089..235493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="ECH_0250"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to SP:P30958; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45115"
FT                   /db_xref="GOA:Q2GHL2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL2"
FT                   /protein_id="ABD45115.1"
FT                   /translation="MNNINKIFNIPQTLEPLVIIKMYIKKLIHSAIYIVNQETQLHNLA
FT                   SIFKFYVPNLEIIIFPAWNSIPYKKNSPHNSVMAERIKTLYSLITRHNDNPYIIISTIN
FT                   AITQKVLHQNIILQSVLKITSLQNITKNHIEDYLTNHGYSQYSIVQDIGEFATYNNIID
FT                   IFPTTYKNPIRIHLNNNLIQSIHYFNRQTQLIDNNSSLNEVVIYPTSEIIKQKKNIDIF
FT                   SKTYKTKPNQDQNLLNTIISGKKHIGEENFLPLFYKEELQNIFNYISQNTTLIFNDKLI
FT                   NEIKEYNNQIYLNYRSQLSYQVPPPQLYVDSEEFKIITKQFHKTIFSQSDNTSNNSAYT
FT                   DRNIHTSSFNITEKIQNVPNFKTLVQNKQIDIFEILTQYIKTTCHTKKLIIACYSTGSL
FT                   EYIQNRLRTLNIKLCKIENYQEICSSYNIAILPIYHSFISKYTIVIAEHDLLYKQETTN
FT                   KSNISNIISNDTNLDIGDIVIHKDYGIGKIVALETTKVFDSYHDFIKIEYYNNDKLFLP
FT                   VENINLISKYGQQNVNVTLDKLGSTSWQQRKTKIKNHIKKIAKELLTIEAARRLSTGKS
FT                   FFPDENYKHFCNEFSYTETEDQLQAIKDMEHDLSSGKIMNRLICGDVGFGKTEIALRAA
FT                   FLVASQNYQVAIIVPTTLLCRQHFIVFTERFKKFPNIKIKQLSKIVARSEIKKTKESLS
FT                   CGQVHIIIGTHAILAQDVTFANLSLLIIDEEQQFGVKQKELLKKIKTNVHVISLSATPI
FT                   PRTLYMSLCGIKDLSLIKTPPKNRLAVTTYTTYYEETIIKDAIIREHNRGGRVFYVCPQ
FT                   ISNIKSISDKIRKLVPEIKMNTAHGQLSPTQLDTIMNDFFDGKFTILLTTSIIECGLDI
FT                   PFANTIIIHNADMFGLAQLYQLKGRVGRSSTKGFAYFILSEKATNKSAIKLEIIQSIDS
FT                   INSGFNLSLHDMDIRGFGNLVGEEQSGNIKDIGIELYQQMLEEELNIYSEYPKDLDHIN
FT                   ININVNIRIPEHYIQDIGLRMRVYKKIGSLKTKEDIDNYYIELTNKFGKLPNEVENLLN
FT                   TIYIKQLCANIGIYEVEQIKNSILLKIDSNTTLKQKILNYFINNPLTFKIQNNSILMLI
FT                   NNSSNCIISFIIHHISKINLLNKKAIL"
FT   gene            complement(235943..236560)
FT                   /locus_tag="ECH_0251"
FT   CDS_pept        complement(235943..236560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0251"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44590"
FT                   /db_xref="GOA:Q2GHL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL1"
FT                   /protein_id="ABD44590.1"
FT                   /translation="MRDKVKDLSNNNNSRNSNPIWNILRSIFTTLGNWGNMLANVLPRI
FT                   LISGIVPPIIPTNATNNNPQHNENSSTTHSNENTQSSDHNNMEQHTSQSEIPVLQSSAN
FT                   LDSLSDIEETPRRNNEDEIPVWESSTDSDGISDTENMPIDSHEQHDSDTVSNDTNSDIE
FT                   FISEEDVLEASGFFIVDICDNPNSSVTHIDLQSGSQDMVYRP"
FT   gene            complement(237967..239061)
FT                   /locus_tag="ECH_0252"
FT   CDS_pept        complement(237967..239061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45265"
FT                   /db_xref="GOA:Q2GHL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHL0"
FT                   /protein_id="ABD45265.1"
FT                   /translation="MRSITDPRIVVQQEADQQQEVQQQADQQQADQQQEVQQQEVQQQE
FT                   VQQQEAAQQQAAAQQQAALLQQALQQEEMLRQQAERQEVILQQQEAEQQQGGSPVPGGR
FT                   PSTVFSRHAKNLKRAILNQCLMLVTDLYLILFVPVIVVGIVVMMLRQFMMIFNETFILP
FT                   WALSCNYARSTNQEPLPEEPEYDDISVYGDSDVIFPSPSVRNPFRRLSDSARNHLQYVS
FT                   KKLSAAALCFVIIMLSPIFIGILACTMVYRLATILINIVAFLFAKCCSCIADAYNSRQQ
FT                   QQYIPVPQEETCDSTSHGEECSSSDTYATPSEGHSSGSQEATTSPHPTEQPEPLSTLIT
FT                   QHGPVESLILNAAEIAHSRRIIYP"
FT   gene            complement(239629..240198)
FT                   /locus_tag="ECH_0253"
FT   CDS_pept        complement(239629..240198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44858"
FT                   /db_xref="GOA:Q2GHK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK9"
FT                   /protein_id="ABD44858.1"
FT                   /translation="MTNETNLTTNPTGALTTTQGTLSNITTPSSDTAEDMATTIFYSII
FT                   LIVVFMIAVVKLFFPTRTDPYNNLLLDSETETETGYSDSDTDLDSEENIPLLENAHLTL
FT                   IDDEEEENIISLINLTEVHVTNTHGRNTDTNDTESNNGLDDDDEIPLLLHGSLRLMNEE
FT                   DNNVNPSVILTDVCTTNTQESGSIHK"
FT   gene            240092..240220
FT                   /locus_tag="ECH_0254"
FT   CDS_pept        240092..240220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45513"
FT                   /db_xref="GOA:Q2GHK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK8"
FT                   /protein_id="ABD45513.1"
FT                   /translation="MSSAVSLEGVVIFDNVPCVVVSAPVGFVVKFVSFVIIFYLIE"
FT   gene            complement(240692..241708)
FT                   /locus_tag="ECH_0255"
FT   CDS_pept        complement(240692..241708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44986"
FT                   /db_xref="GOA:Q2GHK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK7"
FT                   /protein_id="ABD44986.1"
FT                   /translation="MNSTTSSATVTTSSTNSTLLSSTINAVSSSTQSIMNNTTSAISET
FT                   AQAIADTTSNIASTITSTITNTTNNIREGVNYTLNTISNSIINTTIETTTASTTNSTTP
FT                   LTSNTTYPTTNSTNSTLTLNTTSNTSYLFKEPSDYFKTGLMSFLCFVSIVFVLYVLLSA
FT                   LFNNNQQQIRQNPSIDEGYVSCNSSALASNNSTSHSSNLDSENNENDAHSTSGEDDEEA
FT                   SINLSLLANNSVQFHNENDAHSTSDEENEEASINLSLLTSNSVQFHNENDAHPTSDEEN
FT                   EEASINLSLLTSNSVQFHNENDAHSTSDEENEEVSTNLSLLASNAVQSHGDNQVTKL"
FT   gene            complement(242172..242390)
FT                   /locus_tag="ECH_0256"
FT   CDS_pept        complement(242172..242390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45526"
FT                   /db_xref="GOA:Q2GHK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK6"
FT                   /protein_id="ABD45526.1"
FT                   /translation="MTMMIQTTNSPPPPSSQPEGPILRTPHSHTTDQNNESDIFASSDE
FT                   DEHEEISTVLQAVNTQRYHDNRASKSQ"
FT   gene            complement(242296..242976)
FT                   /locus_tag="ECH_0257"
FT   CDS_pept        complement(242296..242976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45215"
FT                   /db_xref="GOA:Q2GHK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK5"
FT                   /protein_id="ABD45215.1"
FT                   /translation="MYLHKSRKYISLLSIKVYNHYSGKKTMVNNTTNATTTTQGTPTNT
FT                   SPLSTIVSSVQSTAENLSSAISSTVTDIVNATSEAASTAFQNFTSSVTQSTSSPTSSTT
FT                   AGTFTTNNSTSSNITESIFNTTTNAANTTTNQPEQDQTFLITCSIIMLLAAIIVMIYHC
FT                   CYLPNAHRRHRRLRHSSDGTLEESLSQFELQLHDYDDTNNELTPPPLFTTRRSNFTYTT
FT                   FSHN"
FT   gene            complement(243735..243842)
FT                   /locus_tag="ECH_0258"
FT   CDS_pept        complement(243735..243842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44516"
FT                   /db_xref="GOA:Q2GHK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK4"
FT                   /protein_id="ABD44516.1"
FT                   /translation="MHHTITLEDIIIVILLTLQEDKVDNFIHSVLIMLR"
FT   gene            complement(243778..244134)
FT                   /locus_tag="ECH_0259"
FT   CDS_pept        complement(243778..244134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44692"
FT                   /db_xref="GOA:Q2GHK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK3"
FT                   /protein_id="ABD44692.1"
FT                   /translation="MNNTNITNSTQSNNSTNSDNSVTIYAPIIAITCLFILMIIICRRM
FT                   HRNRENQVSTTAPSRSTSFEIRRHTNFTNYVLYDSFYEPELTDREVMALVDVDAPHNNT
FT                   RRHNNSNSTNASGR"
FT   gene            244241..244333
FT                   /locus_tag="ECH_0260"
FT   CDS_pept        244241..244333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45514"
FT                   /db_xref="GOA:Q2GHK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK2"
FT                   /protein_id="ABD45514.1"
FT                   /translation="MGIFCFVGTLGNELTTKYMINVVILQCNSM"
FT   gene            complement(244693..245487)
FT                   /locus_tag="ECH_0261"
FT   CDS_pept        complement(244693..245487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45195"
FT                   /db_xref="GOA:Q2GHK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK1"
FT                   /protein_id="ABD45195.1"
FT                   /translation="MPTTLGTVASSILNTTSNTTNGTITATAESTSSILESTTNTASNI
FT                   YNTTTSAVTSAIETTASNAFNNVTNITNSIITTSTESISSFIESATSTANNIHNTIFSG
FT                   ITSPTGNITNTTSITNTTSNDNKQETTLALIGIFFFSLLLLAFIICIHSKHTRANQRHQ
FT                   DEEIPLTEENSDKKKGYKKHGDVIRFDDGSVLPVSVRCDENTDVRHGRSPRVIETNDSV
FT                   TPVYNFSNGPSSRLTDLLDDFVQSVDYGIAHARQACGRFFRR"
FT   gene            246029..246151
FT                   /locus_tag="ECH_0262"
FT   CDS_pept        246029..246151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44727"
FT                   /db_xref="GOA:Q2GHK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHK0"
FT                   /protein_id="ABD44727.1"
FT                   /translation="MLTIYVVSVHFLLLKFNGMKKCFLTKSLICVELSEVFYAE"
FT   gene            246522..246962
FT                   /gene="rnhA"
FT                   /locus_tag="ECH_0263"
FT   CDS_pept        246522..246962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ECH_0263"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by similarity to SP:P00647; match to
FT                   protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44596"
FT                   /db_xref="GOA:Q2GHJ9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHJ9"
FT                   /protein_id="ABD44596.1"
FT                   /translation="MKDELNKVVIYTDGACSGNPGPGGWAAVLLFDDNEKTICGNDSDT
FT                   TNNRMELTAVIEALKLLKVAYNVDLYTDSVYVKDGITLWIRKWKVNGWKTANKMPVKNL
FT                   ELWLELDSLANFHKVTWYWVRAHVGDLYNQKADMLARSQIVR"
FT   gene            247080..250067
FT                   /locus_tag="ECH_0264"
FT   CDS_pept        247080..250067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14039.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45203"
FT                   /db_xref="GOA:Q2GHJ8"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ8"
FT                   /protein_id="ABD45203.1"
FT                   /translation="MLKKKKFIRLFFILMISIVCSVSYLYVRDRDVIEINAKFLNFYVK
FT                   HKLATVFPGSEIDIGSTTLTWQNKSENFILSSQNLTIKSPKLGANITIPKFLLYSRVGI
FT                   LFLWGNCDFSYIDIPKIRIEFYDIQKKVGINLVENSVKILKDMLLKAIKLDIPVFISNA
FT                   ILAKHGKEDLMIKQLSVKMNKGYDKNTIDFNVENDNSFISMTVHEHYKGIMSFEISYGN
FT                   FNTKVLGYLGNLNAKLPLYDNLNFSGDIVLRIDEHDEITYGDVNIQRIKGVVPCVSSRK
FT                   CYIHDFRTRLVYQNDILSVKNFFLLLDQSKIVATGMIDNENVDLTFNFDVIFPKTLCDY
FT                   WFVNLYPDLNRWYCTNVTDGKITDLKLQIKGKRDGMFIYNDLSNYNVSANIENVSIKFN
FT                   HNFDPVRIVHGKLYLRDNQFIITSDNSDFKGVVIQDGILKIDNLKDENAVMTISGSSVG
FT                   DVKQLYKAVNKDEFILLDNNKIFGKSHTNFDFKIFNLLNDDIVDYVSYIHAQIESFKAG
FT                   SILNTFDVYDAKVDVTLHDNDVNINTQGYMNGFPMSLKVDRNLQDNYKFHYEFAGYISA
FT                   DNIKELGIFEYGDCSGVMKSNLQWDINANNTVITGDVDLSQLKIHFDGLTHNNFDSVVK
FT                   FSASFQDKKEIKIDSASIVGKGVDIELSGKTGANLELLLNKVKLKDTDITAELKRSNDS
FT                   ITVKVFGESLDLSTVDFSEMMKGESPMQQTKIDVNVSRVMMKNNVVANNVDFKLSCYDT
FT                   VCNEIKLTGNFLDNSNFSLEYGPIGLEINTDNAGELLRAIDILKVVDKGKLSFYMYPVK
FT                   AGEITSGMFSLTNFHLVNASILAQILTLSSLKGVVNTLNGKGIYFNALNAPFTYQDNLI
FT                   SIDESWIEGSELGISLGGEIDLNTKMFNIKGQIIPAYVINKIIWQTPIIGKLLTGGQSR
FT                   GVIAIDYKVKGTDKDHDLSVNLMSILTPNLLKRVLKIFDSKLLKKEHVKKRSSVNKVNN
FT                   QVRMVS"
FT   gene            250428..250556
FT                   /locus_tag="ECH_0265"
FT   CDS_pept        250428..250556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44736"
FT                   /db_xref="GOA:Q2GHJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ7"
FT                   /protein_id="ABD44736.1"
FT                   /translation="MIDKDKLNADKKNKNSNYVPTIDHNKFMILGICILHLFVAKI"
FT   gene            250612..251346
FT                   /gene="pyrH"
FT                   /locus_tag="ECH_0266"
FT   CDS_pept        250612..251346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECH_0266"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45243"
FT                   /db_xref="GOA:Q2GHJ6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHJ6"
FT                   /protein_id="ABD45243.1"
FT                   /translation="MSEASATKVKYSRVLLKVSGEALMGKKGFGCDIEVLDKLSHDLKE
FT                   VHSFGVQLCLVVGGGNIFRGASASASFGFERASNDYIGMLATMMNALSLQNALEKVNVQ
FT                   SRVLSAIPITAVCETYIRRRAIRHLEKGRVVICAAGVGSPFFTTDTAAALRGIEMGCDA
FT                   IFKGTQVDGVYSADPKKNADAVRYDKISYRDLLSLDLKIMDVAAVSLAREHSVPIIVFN
FT                   LGQPGSFADIIRGDGLYTTIYN"
FT   gene            251369..251926
FT                   /gene="frr"
FT                   /locus_tag="ECH_0267"
FT   CDS_pept        251369..251926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ECH_0267"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by similarity to SP:P16174; match to
FT                   protein family HMM PF01765; match to protein family HMM
FT                   TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45378"
FT                   /db_xref="GOA:Q2GHJ5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHJ5"
FT                   /protein_id="ABD45378.1"
FT                   /translation="MISEVKQDAKSRMEKSLSVYLSDIDGIRTGRARTSVLNGIVVETY
FT                   GGRVKLNTISSVSVSDNKTLMIKVWDSNNIGAIKTAIMNSNLGFGISCEATTIRLTVPD
FT                   MTQDMRKNLVKLLGKISEDCRVSIRNIRRDIMDRLKVMQDSKEISEDDLRVAGVEIQKI
FT                   TDDIMKKVNDAFTSKEKELLHV"
FT   gene            complement(252525..252671)
FT                   /locus_tag="ECH_0268"
FT   CDS_pept        complement(252525..252671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44877"
FT                   /db_xref="GOA:Q2GHJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ4"
FT                   /protein_id="ABD44877.1"
FT                   /translation="MLTKIIEKLNTFYLSLLHNIKFIQTNINEYCIKKYKTLCLLSSIL
FT                   ERT"
FT   gene            252771..253406
FT                   /locus_tag="ECH_0269"
FT   CDS_pept        252771..253406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0269"
FT                   /product="putative phosphatidate cytidylyltransferase"
FT                   /note="identified by similarity to SP:P76091; match to
FT                   protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45496"
FT                   /db_xref="GOA:Q2GHJ3"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ3"
FT                   /protein_id="ABD45496.1"
FT                   /translation="MFIRSLSSILICAVVSLSLYFGGIAFYILCFFLAMVSSVELFNIM
FT                   QCRRLYYIPAFFMIVIPYASLVYIYNLLHGEIILIWLIFVIWGTDVAAYFVGKNIGEKK
FT                   IVPMISPNKTWAGLFGGIVAGAFISVVISVIFGIFFVFHAFIAGILIAFVAQVGDITES
FT                   YVKRLCKVKDSGSFIPGHGGILDRMDSFIFTAPLVAYYVQKFSKFFLA"
FT   gene            253727..254776
FT                   /locus_tag="ECH_0270"
FT   CDS_pept        253727..254776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44635"
FT                   /db_xref="GOA:Q2GHJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ2"
FT                   /protein_id="ABD44635.1"
FT                   /translation="MRNISNLLYFSCYSKLGEISGRLYSMHCARLDEKPELYRPFTLNA
FT                   GALLRLASYACDALSDQAVVERVNLDRDVVEIIKFDVLNIITSLIKVYNSVIDMRIHPE
FT                   QTNDLVFSAKLLLHEVKNTLNRMRCLCQKLIKYSNVIARDDFLHMSLAVHNLDFFSYNI
FT                   QEYVDDIKSAISEPCRSMSMASVPATERAKISSENFNILEPLDFNKNRYLCDLKDKAIS
FT                   ELVPVYDESLTDLGLRYGYDISLLFKSVMISTQEYRQPFSKGSRLVILNCGRVACINDL
FT                   KDGFILYNKFIVSLAEGGVVYSTSSNIGLRELSGCDQEAQGRVYSPDSVLSSSDEELIT
FT                   SLGSADKNK"
FT   gene            complement(254698..254799)
FT                   /locus_tag="ECH_0271"
FT   CDS_pept        complement(254698..254799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45142"
FT                   /db_xref="GOA:Q2GHJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ1"
FT                   /protein_id="ABD45142.1"
FT                   /translation="MFHYLSTYYLFLSALPKEVINSSSLLDKTESGL"
FT   gene            255329..256063
FT                   /locus_tag="ECH_0272"
FT   CDS_pept        255329..256063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0272"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44509"
FT                   /db_xref="GOA:Q2GHJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHJ0"
FT                   /protein_id="ABD44509.1"
FT                   /translation="MADNLSKMEKTLNIILFIILFPIMLPVFLYIKLSEKINKAVSVQK
FT                   ERSKISRGANRYVQGVLSKYSEDTLKHDSRERLRFRYATSLIMRSLYSITTEHYSIGNY
FT                   HDSEHLSALEQLATKMVISRGSIMRAYAFVSNSIRSGQEDCDSADSIKEIKKTIALFEE
FT                   LYQNSSDFMRKADAIYADVKGSEVCERVLKMHDASKVVKYNSEFCIKKLKIMLKNEIAA
FT                   AKRNGLCNTSVDGVSNPGLSAA"
FT   gene            complement(256038..256178)
FT                   /locus_tag="ECH_0273"
FT   CDS_pept        complement(256038..256178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45372"
FT                   /db_xref="GOA:Q2GHI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI9"
FT                   /protein_id="ABD45372.1"
FT                   /translation="MNMNHIKLFNINYISYDIIPVNGALAPLTIHVWYTKQCFKQHLNQ
FT                   D"
FT   gene            complement(257048..257149)
FT                   /locus_tag="ECH_0274"
FT   CDS_pept        complement(257048..257149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44628"
FT                   /db_xref="GOA:Q2GHI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI8"
FT                   /protein_id="ABD44628.1"
FT                   /translation="MNTYFSKNIEKVTKLYYIKSYNNNKTLKYEKVA"
FT   gene            257565..258296
FT                   /locus_tag="ECH_0275"
FT   CDS_pept        257565..258296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL08846.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45519"
FT                   /db_xref="GOA:Q2GHI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI7"
FT                   /protein_id="ABD45519.1"
FT                   /translation="MKYGTYLAMASLLICIIFALMLYGILKKCRTSRAVLNGVDTLPKH
FT                   VYSISNSRLHNSILCYLKVKLKEQLKDFCDRNNVECIKAESAQYGVLMVKVGFEYVQHQ
FT                   MACFISEIQNDDIYKKALLLGNVISQSENLIFAYSEYRYALIKCELQNILYARISLRNI
FT                   FNLVKDIKVKDQIELMKTYHAKLDCGLAFIAKGLGFIMKDVGVLDEFDSIRELCDDGFL
FT                   YDDDYLTFTSISLKSIEGYTH"
FT   gene            259182..259736
FT                   /locus_tag="ECH_0276"
FT   CDS_pept        259182..259736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44789"
FT                   /db_xref="GOA:Q2GHI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI6"
FT                   /protein_id="ABD44789.1"
FT                   /translation="MSKIYPVVQKEVSVMLDMKLQGADPSHNKDFLKITNAINYIRDQI
FT                   MLLRCSYPHNLRVQCAMLSMFCVRAKARIMGLYQNEEGFSAEEKDELSSLRMSMYRDGI
FT                   EYTTESLQYDIIRLLQSVVSCINGLVRGHTLFVYYEEEQWILCRIKAAYKICQEGMQSI
FT                   NKEKTEYVQIQCLLAPTLGYT"
FT   gene            complement(259817..260359)
FT                   /locus_tag="ECH_0277"
FT   CDS_pept        complement(259817..260359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0277"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to PIR:S12059; match to
FT                   protein family HMM PF02245; match to protein family HMM
FT                   TIGR00567"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44538"
FT                   /db_xref="GOA:Q2GHI5"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHI5"
FT                   /protein_id="ABD44538.1"
FT                   /translation="MPHYILKKSFYEQSSLTVAGKLLGKKLLFNQHQGIITETEAYIGQ
FT                   DDPAAHSARGYTKRTSVMFGSPGFSYVYFIYGMYYCLNVVTEQEGFPAAVLIRGIVLLS
FT                   ENKPNTIINGPGKLCKILQITKEHNNTDITQKYNFCICNTDINIDNYICTPRIGISKGK
FT                   EKFWRFVIPDLTFLLNV"
FT   gene            260437..260868
FT                   /locus_tag="ECH_0278"
FT   CDS_pept        260437..260868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44937"
FT                   /db_xref="GOA:Q2GHI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI4"
FT                   /protein_id="ABD44937.1"
FT                   /translation="MSDQEKTDTSGKKVDKLKKVHNAVSKVAQFIVGESLSLQLKEYKV
FT                   SFSYIVDNTTDYLKLTNVQEVKIIEKINQLKNINNTLLERLFNFWLRRNKQLLYWHMIF
FT                   LLVNIILLILNGDNLVKLSNLIVEILIKWKDGVVSLYCS"
FT   gene            261341..261466
FT                   /locus_tag="ECH_0279"
FT   CDS_pept        261341..261466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44664"
FT                   /db_xref="GOA:Q2GHI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI3"
FT                   /protein_id="ABD44664.1"
FT                   /translation="MYCRNNSESGSGQCGMVNVTESAYTNFAEQGLALSEDILLI"
FT   gene            complement(261628..261729)
FT                   /locus_tag="ECH_0280"
FT   CDS_pept        complement(261628..261729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45363"
FT                   /db_xref="GOA:Q2GHI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI2"
FT                   /protein_id="ABD45363.1"
FT                   /translation="MSCPCIQYQNLHKEDDLITPHLFILFTISKKSL"
FT   gene            262185..262724
FT                   /locus_tag="ECH_0281"
FT   CDS_pept        262185..262724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45366"
FT                   /db_xref="GOA:Q2GHI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI1"
FT                   /protein_id="ABD45366.1"
FT                   /translation="MSEGLIVVIALQVFLLLLLFIFALYHYCIKPCSKSGKMGYERFEG
FT                   ENIPKYEGVLEHFEEMDYLQLQQRVAELRLACRMLDKERVTNDRTYEECLDWMFFVSLT
FT                   LDELMVENKLESDYITRMRAQYHLFNLRIIADQVARQPAANVERQEDLQEVEQSPSPQV
FT                   EGTSVASCCGQEKQAA"
FT   gene            263401..264075
FT                   /locus_tag="ECH_0282"
FT   CDS_pept        263401..264075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44702"
FT                   /db_xref="GOA:Q2GHI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHI0"
FT                   /protein_id="ABD44702.1"
FT                   /translation="MGTGAIIGIIIAILLLILIALVLYVLFRTFLRPELYVRSNLFPTG
FT                   VVTNVDPERDLRSFIMMDFERQTAANMVSIVRDMKFQISSIRCYRDILSSLIQEDQDTL
FT                   QPEIMEQILELMYRAQTIDEQIQDRLSSIGQFTLDMANAEDIACVTCNYEALCNIGQEI
FT                   EACIHSIFDIEVNRTTVAAYTMSIQLIMSEATRKLFVLVPIRDLGLPTDASHSQAASSM
FT                   DR"
FT   gene            complement(265305..265445)
FT                   /locus_tag="ECH_0283"
FT   CDS_pept        complement(265305..265445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45236"
FT                   /db_xref="GOA:Q2GHH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH9"
FT                   /protein_id="ABD45236.1"
FT                   /translation="MRHSNITQKISNTTIIILIINTFDVITYKPFYAIISIYTTFIKNA
FT                   I"
FT   gene            265429..268479
FT                   /locus_tag="ECH_0284"
FT   CDS_pept        265429..268479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44604"
FT                   /db_xref="GOA:Q2GHH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH8"
FT                   /protein_id="ABD44604.1"
FT                   /translation="MLLCLIIICSQNRNASLVDDQQDPVLYDFEEHCSISSSSCHTQSD
FT                   STLSEGESVDEEQEVDDTMQYLSDCDDFETDSLEIHDDSSSMNQGHCSLGAIPKTYNPT
FT                   FMQKKTGWIEESSSREFSDECFSCSDVSDDDMSTKSSMLLDYDCQNRKSNPNHELVVLR
FT                   TDNSDVSTVNVSRVMPNGRIRLNSLGGEGDHLTSYTFGFPLRSSSKLVLSSSNLSFSEL
FT                   IISPTIYAEFGKIDPFCFSYFEKDMLGRMGGVPSSGVYGIESHACANSLISQDAILGLR
FT                   TCGKLRKDTVFVVNQGDLIDMKDHISNVLPSDVKPGISSSREIVGLTSGSECTEENSQR
FT                   IVQGTGVSVVEDAVPSGSRMVFASQDVDAMFASSVQIIQDSMDLLSDFCLDEMTDDEVE
FT                   QITRNMEQSSTSCATVSAMAQMVGASNVSDGANTDVNYLCQEGKDSAGLLLGEGVSKDK
FT                   KMTSAASRNVVVVQAEVHEPSTSSSVVRKSRIPIKVGESSRVVTKKRLDVKQSSLSVTS
FT                   KSQGLGVRKLQAVAADDRPNLVGYKFKSGDYMLCQSPKSNRADVTKRRVSQSGGSVSVK
FT                   PYEPGHTRVAAHKESQSSDHVSVKPCEPRRIVPQVTVALRKKRVVFQDTGKGEAVLGRH
FT                   GSTQECVEPSSVTRSSLENVPNVVKHKYEDVCHKDSRHDIALRRSVSSVHQQSSKSARS
FT                   MATLGKRSAAAKTGVSVRRTKSDAIDTEKGRDKRWLENEIAIPLENTVSQVVICGTNET
FT                   LHDTLSKHFRVLHDSLSQYSKNSDAVVRCKEVYYIAHSRIKHADSIIQEAVDKWALTQR
FT                   ATLWDKHGKKVVTACMKDLEKVFKKIYIDQGKTSLDCQAKLQDIRSEVENNVKNQIACL
FT                   VRDTFLKNACDEIFTEVSSTILHKVSVAHESIVKGMRKCSREELEGQVVKSCSIFHKSK
FT                   LQSKILTHINDLGTFFKKQLQVKSKEIVKEQLKKCKVDIVPGDIRHCCIDTVINAPVPN
FT                   TAARYAIHVLNSRPNVSGLDAGQLSFS"
FT   gene            269095..269640
FT                   /locus_tag="ECH_0285"
FT   CDS_pept        269095..269640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44556"
FT                   /db_xref="GOA:Q2GHH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH7"
FT                   /protein_id="ABD44556.1"
FT                   /translation="MLSLLIYVMSKKCYMTAAITVGEGEDIQSVQAPERNLSNGVSNPR
FT                   VVNSIDSSSNMSADSASDMGADSASNMSADGAGNMGADGAGNMSADGAGNMSADGAGNM
FT                   SADGAGNMSADGAGNMGTDGADSGSDIDTDNSIGSDVIEGGTSGDEEEELHSVDQHMVN
FT                   VGNNGVIAVEPQSSICFR"
FT   gene            269807..269929
FT                   /locus_tag="ECH_0286"
FT   CDS_pept        269807..269929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45014"
FT                   /db_xref="GOA:Q2GHH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH6"
FT                   /protein_id="ABD45014.1"
FT                   /translation="MCSLRSEIVNEKFLEFNILILCLCGNIMHTVCKRSQVFFL"
FT   gene            270043..270249
FT                   /locus_tag="ECH_0287"
FT   CDS_pept        270043..270249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45488"
FT                   /db_xref="GOA:Q2GHH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH5"
FT                   /protein_id="ABD45488.1"
FT                   /translation="MSSYVNSSNAARRMTSDKENNNVLEEIGHSTELKSGYLGRKVTKD
FT                   NFSKRKPYYLSIELHSLCGAKRN"
FT   gene            complement(270568..270801)
FT                   /locus_tag="ECH_0288"
FT   CDS_pept        complement(270568..270801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44860"
FT                   /db_xref="GOA:Q2GHH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH4"
FT                   /protein_id="ABD44860.1"
FT                   /translation="MTFYPHVKIFYNKSIISPIHTNSGLIFDKTYKKVSNILIFLSILK
FT                   TLKINLHILKIFCKKFTTRIYAFLINRNPQQY"
FT   gene            270800..272338
FT                   /locus_tag="ECH_0289"
FT   CDS_pept        270800..272338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44872"
FT                   /db_xref="GOA:Q2GHH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH3"
FT                   /protein_id="ABD44872.1"
FT                   /translation="MITNRSGSDRLKPGAFLGISSCVDHRLVRPGYIKKMVDSLTLERR
FT                   KLEEARTSLIMYEYSLQFYSLLILFFKVLRNNYGSRQTLQKHIEMRGITTLLKNKKVLL
FT                   NDAFARKFINCMVNKVVGFIIDKKQAQKLWVEKEEYAREICYKVINDINKKRKSLDIQN
FT                   LTEEEIVSQDDKMDEALFGAYTEQVRIFSEVKDQQQGFNFLKCIPSLSEIFDASDVLRS
FT                   SEICSSIRSAVEISRVDAIELEMLLKYIILGNSVDVIKVNFLFSALKNCLKNIYCKIAE
FT                   NFVDVRESRSSSSDIHQVQLHEQIGVICKNLVKVSMPAEDICNMYTEIYYTLSLRFNMI
FT                   SKEIEDLLIAVFIGNEKGEVEEFKKKDIIRSLYDCQLKSIYSIIEADCCCADLLFVNRR
FT                   VKSVIMSLCVQRDDIIDHMSNVEKLLISAAKYQDIVADFVSHDVPVSNEDLLLKCDNIT
FT                   QLKKSLKSGERVNSSVATILTEDLGVIDSQIQKLEESLNMLISRRCVRAGSCIV"
FT   gene            complement(272596..273324)
FT                   /gene="purC"
FT                   /locus_tag="ECH_0290"
FT   CDS_pept        complement(272596..273324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="ECH_0290"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by similarity to SP:P12046; match to
FT                   protein family HMM PF01259; match to protein family HMM
FT                   TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45002"
FT                   /db_xref="GOA:Q2GHH2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="PDB:3KRE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHH2"
FT                   /protein_id="ABD45002.1"
FT                   /translation="MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHE
FT                   KGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKR
FT                   FQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILS
FT                   ELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNL
FT                   GNVIEGYREVAHKLNAIPNL"
FT   gene            273511..274752
FT                   /gene="hisS"
FT                   /locus_tag="ECH_0291"
FT   CDS_pept        273511..274752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="ECH_0291"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by similarity to SP:Q83K44; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF03129; match to protein family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44995"
FT                   /db_xref="GOA:Q2GHH1"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHH1"
FT                   /protein_id="ABD44995.1"
FT                   /translation="MQRDKLREVRGTKDLLGIELYKFQYIHRLSQSIAHRYGFIAVDTP
FT                   IIEFTEVFTKTLGDDSDIVMKEMYNFQDKSGENITLRPEFTSAIVRVLINKNLIIPVKL
FT                   FSSGPVFRYERPQKCRQRQFHQVNFEFFGSDLPLADIEMIALGYHILDELKLLDDITLE
FT                   INFLGDKETMNSYKLSLIEYLNKYKKDLSEDSQRRLITNPLRILDSKAPEDREILLNVP
FT                   NISYFYSKSSNDFFAEVLYGLDELCIPYKVNHSIVRGLDYYCNTVFEFTTSKLGAQNAV
FT                   VAGGRYDGLVKSMGGNDTPAVGFAMGVERVSALIDYKHQEPRSVVLIPIGKDAVSYALK
FT                   LAYELRCNGISVNWNYKNANLRNALRKVGDDNIVLIFGDEELKNNTIQVKDMKTGEQQE
FT                   IVRCDLLDTLCNKI"
FT   gene            274943..278257
FT                   /locus_tag="ECH_0292"
FT   CDS_pept        274943..278257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0292"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAL08832.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44524"
FT                   /db_xref="GOA:Q2GHH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHH0"
FT                   /protein_id="ABD44524.1"
FT                   /translation="MLTNKFKQSAVMAHNMSYLAYFCRSMGLSSEDTLGLLTILESFHQ
FT                   NAASFLIYDLDRCNVESNDHIDFVVKDCDHRNYRCYDHVSQQLETQGHLELASMTRLWN
FT                   VQMYLLLRLHSLAAQYVLSTRHYTDDEIVEGLLSDLSRTCMSIMTRGKTSSVTPENAEA
FT                   LKVYGDKFVQRLFGIQTMDMDSMHSILHSMICSVRGSYLQVIEGLDKVQDKETLMKLVT
FT                   LVVYKSAISCFMNINPDFFSQTLRKKAYSVLHGFICDGTDKLPISCRSRLGMGMAPSLV
FT                   LFYKNLFSVFHQGSISDCYGDEIRYNISVFNDVCLATRGSLAIVANEPVPYNPFSSRMT
FT                   HFAYYDATLAVNGIFHHPKLDNVLKLESMTQMYKMSLEGNPSDLHCLFVSGLGRMNFSF
FT                   EDKGEPNSGLEMLCELLSMCYYAVFVARQPLSVVRGMFNICYGKLGDLGDKVNVGSVAG
FT                   SKLAIESYRDAFNAAQAALHCTGINPSDVIFKKETLLILVQHLLLGEVAQEKIEDSKLA
FT                   FDIFELCKPVNEVKAQQAAMMMCQAFRGSNGVVDGYEVGNLGAIVLKLLFGNFVERNLI
FT                   LKLLDITCVACDRYKMQGAVQDMYNELLKDFMSCADVCLSLFRYAGSSLPMCYSSQVVA
FT                   GLDGDSCAVYSQMYNMLSSYASRLNVSQDDLIRARNSRFSVSFAELFSNAVLPHGEQSG
FT                   PELQVNPCDGISKPESMALVQMLASYVYLYNSSEIKEELLSAKLSSPQFLFSIILVSPR
FT                   FAANFINMCYESSTKKDYSPQKAVSAFLNRISNIGGSRTSSAEAIDIMTGQGNNVIMEN
FT                   FIRSCVNEDGSINVEDSILRAACLWIIKSNNLVHKDVIQDVDDADCAGKVSPVVIDSVS
FT                   LSEVLLPVLSNPLALDDPEGPVSFSHLVYSTGLLDKSGIESASATVGKLQIQIQVDAKC
FT                   ETDVKEVGPSDDKVSEIVEMKDDVQEVEVECKTSDTQTVAIEDQTQRYEDSYVARDPGD
FT                   VQSSTSDIFKEKRSSICNYASAISAAILAVSLTLMGMAFAVNDEGARIACIALSMTCFV
FT                   ISISMFLMTCINIRSLNGRNEGHDDDTQRILNNEVVNETQDATIFPVDINTRPKTH"
FT   gene            complement(278286..279026)
FT                   /locus_tag="ECH_0293"
FT   CDS_pept        complement(278286..279026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0293"
FT                   /product="disulfide oxidoreductase"
FT                   /note="identified by similarity to GB:AAM22615.1; match to
FT                   protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45310"
FT                   /db_xref="GOA:Q2GHG9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG9"
FT                   /protein_id="ABD45310.1"
FT                   /translation="MLRILFLLSLVILVASFPLINNWLSSKSGKTIIDKDTIISIVEEY
FT                   IANYPQKVIDLLTRGQAQAENEEMSKNIKKYKSELEDSSYPSAGNKDSKIVFVEFFDYS
FT                   CGYCKMMSEDMKQIIQDGKVRVIFRDFPILGEASLKAVQAALAVHLINPSKYIEFYHAA
FT                   LNHKQQFNDESILSLVKSIGIAEEDFKVSLAKNSDTIEKMIQSTKELAQNINIRGTPAI
FT                   IIGDTFIGGAADISTLRSKIDEQG"
FT   gene            279343..280377
FT                   /locus_tag="ECH_0294"
FT   CDS_pept        279343..280377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0294"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45450"
FT                   /db_xref="GOA:Q2GHG8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHG8"
FT                   /protein_id="ABD45450.1"
FT                   /translation="MKIASDNREVCVGVKIWLCICCIGILLMVLVGGITRLTHSGLSIT
FT                   EWNPVIGVFPPIGERAWIREKIKYMATPEFKYLNFNITLRGFRKLYLIEYFHRLLGRIV
FT                   GLTFLIPFLYFTYKKKLHRNLIINFIVICLLILFQGVVGWFMVKSGLIDRPHVSHYKLT
FT                   AHLLLALLIFYLLWRQFLLSTISKVTYNIKVNGTLIFSVISVLIVTQITFGSLVAGLNA
FT                   GLLDKTIPFLAGKLMLEDLLFIKPLWYNIFENPVTVQFIHELIATLIFLVVIITLLILR
FT                   LNLFPAYLLLICLCLQLTLGVLTFIYNVPIVLASLHQVTAFILFAVNTYLLHYMKLSKL
FT                   QYVK"
FT   gene            complement(280712..281365)
FT                   /locus_tag="ECH_0295"
FT   CDS_pept        complement(280712..281365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0295"
FT                   /product="putative heme exporter protein CcmA"
FT                   /note="identified by similarity to SP:P33931; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44980"
FT                   /db_xref="GOA:Q2GHG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG7"
FT                   /protein_id="ABD44980.1"
FT                   /translation="MLECTDLACIRNNRYLFSQLNFSTQQNLLTLVIGNNGSGKTSLLR
FT                   LFAGLVPITHGNIKYNGKNIHDSNTYFTSLTYIGHKNFCNDNFTVLENIQLWANLKNTH
FT                   ELIAATICFFKLQPILDIKYKDLSSGWKRRVALSRLLIYNTNIWIIDEPFAHLDINTKE
FT                   LILELIFTRLKQKDSIVIISDHSEVKTYGECQVINLEAFKNQQSNSLQHDLYLY"
FT   gene            complement(281566..282129)
FT                   /locus_tag="ECH_0296"
FT   CDS_pept        complement(281566..282129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0296"
FT                   /product="putative deoxycytidine triphosphate deaminase"
FT                   /note="identified by similarity to GB:AAS14105.1; match to
FT                   protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45481"
FT                   /db_xref="GOA:Q2GHG6"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG6"
FT                   /protein_id="ABD45481.1"
FT                   /translation="MSVMPDHWIKDKAIKEKMIDPFIDYKRSSGILSYGLSSYGYDARI
FT                   DNKFKVFTNVNSVTVDPKNFPLGSFIDKEEDVCIIPPNSFVLAKTVEYFKIPKDILVMC
FT                   VGKSTYARCGIVVNVTPLEPGWEGYVTLEFSNTTPLPAKIYAFEGACQFIFLKGDSQCN
FT                   LSYNEMQGKYMNQLDVTLPIVNNS"
FT   gene            complement(282518..283336)
FT                   /locus_tag="ECH_0297"
FT   CDS_pept        complement(282518..283336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14665.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45333"
FT                   /db_xref="GOA:Q2GHG5"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG5"
FT                   /protein_id="ABD45333.1"
FT                   /translation="MHLFCFGYGYTARFLAQKLLPLKWKISGTLFNKVAHTDNKDVHLL
FT                   DYNFPLPESVFSDVTHVLISIPPDGDNILQKYYNFLKEIKWLGYLSATNVYGDHNGNWV
FT                   DETSSTNPSTPNGINRLKQEKMWHNSNLPSHIFRLSGIYGPTRNVLRNLIQGNVKYTIS
FT                   DTIFSRIHVDDIANILFTSIHNPNPGSIYNCTDDLPSPYSNVVKYGAALLNINTPEPMD
FT                   FEDLSDNMKRFYSERKLVSNLKIKNELNISLQYPSYIQGLQSLIKIETLL"
FT   gene            283625..283891
FT                   /locus_tag="ECH_0298"
FT   CDS_pept        283625..283891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0298"
FT                   /product="cold shock protein, CSD family"
FT                   /note="identified by similarity to SP:Q47130; match to
FT                   protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45143"
FT                   /db_xref="GOA:Q2GHG4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG4"
FT                   /protein_id="ABD45143.1"
FT                   /translation="MSQRLVDDSTYTGYVKWFSSEKGYGFICKDQGNNKIRNIGQDIKD
FT                   IFVHITALQRSKIDGLREGQKVKYQLDKNNGKFSAVNLELLEG"
FT   gene            284058..286202
FT                   /locus_tag="ECH_0299"
FT   CDS_pept        284058..286202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0299"
FT                   /product="putative nitrogen regulation protein NtrY"
FT                   /note="identified by similarity to SP:Q04850; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45031"
FT                   /db_xref="GOA:Q2GHG3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG3"
FT                   /protein_id="ABD45031.1"
FT                   /translation="MKGWFIKVYSNISRFQFFKIVASFLAISVFLFLIITYCVVFHHDD
FT                   PLGPDHSRAIKLVFFDLILFLLLIASVSHKLINMWIRRKRGHLGSHLQTKIILMFSVVA
FT                   VIPTIVISGFSTLFFNYSIQAWFNKRVEAVMHESIQVAEAYLREHKRNIRSDILAISHY
FT                   ISDHKIILNYDTAALQNVVQSRADLLGLAEIIIFEPSRIVASNKFSFVLNFDMVPWNDL
FT                   DRVDNDRIVIIIKENMIRAFLLLDRFSSTYIMVSRIIDRKVISHLSATKGAVKSYRDLQ
FT                   SQISSLQIQFSMIFILISLLLLLTAIWYGINFSGDIVRPLLDLFYATRKVQKGDLSFKI
FT                   EEGRVGEEMSTLARAFNQMTSQLSSQRSQLIKLYQDMNERREFIEAVLSGVSSGIIAVN
FT                   CAGIITLMNDKAKELLAPNDILHAELDDVFPEISELIKSSKMHDEITVLRNRKSFTLSV
FT                   RIKLLGSVNKGYIITFDDISSLVDAQRSAAWSDVARRIAHEIKNPITPIYLAAERLSSK
FT                   YQHEIISDKESFGRYIDTIIRHVTSIRCIVDEFAKFAKMSDPVLIKHDICSVVKELAFS
FT                   GQFSRGVVHYELDIPSYPIFVVLDKNQINHVFINLFKNACESIDMKSNSIQGLIKISVV
FT                   DDRDCVNVQIQDNGVGFPEELMEKLTEPYVTTRVQGTGLGLSIVKKILDEHNATISFYN
FT                   IEDGGLVKLTFVKCQDCENI"
FT   gene            286446..287609
FT                   /locus_tag="ECH_0300"
FT   CDS_pept        286446..287609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0300"
FT                   /product="putative ribonuclease D"
FT                   /note="identified by similarity to SP:P09155; match to
FT                   protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45288"
FT                   /db_xref="GOA:Q2GHG2"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG2"
FT                   /protein_id="ABD45288.1"
FT                   /translation="MLIDTVKELERLCNQLLVLQPKFIAVDTEFVRSSSEYYPKLCLIQ
FT                   IAYGKEQFVIDVLAKDMDLSVLGHIFYNESIIKVFHDCRQDIDALLTKFPEIPSPIFDT
FT                   QIAAMFCCCYDNAVGYSKLVEQFLGISLDKLSLKRSNWALRPLSADKIQYALNDVIYLY
FT                   ELYQILYNNLLDAGKLPWFLEEMNNIVLQEVNCNDVCDIPDFGSDMTKEEIIVVRSVIE
FT                   WRERLAKFFNLNREFILKNKVMLSLVRDFIKKSDISTLGKYIKKEYLSCDAVSDLLQVI
FT                   DNNQSVNIDELHYVSVNSYNKSVLNVLLILLYNMCYKNNISQKLVASKGGLIRFLNGKF
FT                   SYVMKGWRYEFFGCEVEKFMQGKSKIIVSAQVLDNDCMDIVTTLTEM"
FT   gene            complement(287917..289947)
FT                   /gene="ligA"
FT                   /locus_tag="ECH_0301"
FT   CDS_pept        complement(287917..289947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="ECH_0301"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by similarity to SP:P15042; match to
FT                   protein family HMM PF00533; match to protein family HMM
FT                   PF01653; match to protein family HMM PF03119; match to
FT                   protein family HMM PF03120; match to protein family HMM
FT                   TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45317"
FT                   /db_xref="GOA:Q2GHG1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHG1"
FT                   /protein_id="ABD45317.1"
FT                   /translation="MVDQEKAKLELDKLNKQIQHHDVLYYVQDNPEISDAEYDELCRKR
FT                   NLILNAFPKLTQSNDYQNNIGSSPDTKFAKVKHEEKMFSLDNAFNQQDVEKFITRTKKF
FT                   LNINDNQSIPLSCELKIDGLSFSVIYKKGEIYQASTRGNGYFGENITTNVKTIKNLPHI
FT                   IHNAPDLLEVRGEIYIDRCDFIQLNNDGNNFANPRNAAAGSVRQLDHNITAQRKLKYFM
FT                   YTIVNTACLTQEELLYQLKIWGFCVNEHTITTDNIEEAFNFYNQVYNNRSNINYDIDGI
FT                   IYKVNDIKSQHILGTTSKSPRWAIAYKFPAAEAKTQLNKISIQIGRTGVLTPIAELSPI
FT                   NIGGVIVTRASLHNKNEIERKDIREGDYVIVKRAGDVIPQIVDVDKNLRTQELTKFVFP
FT                   TTCPSCGSSVYQAKQEASIYCTGELFCKDQILEKIKHFVSKDAFNIIGFGKKQLLFFYE
FT                   QRLITNITDIFTLEEKISNSDVKLESLHGWGEKSMSNLFSAINNSKVISLENFIFALGI
FT                   RFIGKYIAKILANHFSSYETWYNEMLKLAQNEDYSLNIQQIGSKTIGSLKMFFSQPHNL
FT                   NMINDLVKHLTITDTQSSSYLSLIHGKIIVFTGELSSMSRSEAKIRSETAGAKVSSSLS
FT                   KNTDFLIAGNNPGSKYKKAQSLNVQILTEDLWLQYTQSSEN"
FT   gene            complement(289974..290306)
FT                   /locus_tag="ECH_0302"
FT   CDS_pept        complement(289974..290306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0302"
FT                   /product="glutaredoxin-related protein"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR00365"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45365"
FT                   /db_xref="GOA:Q2GHG0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHG0"
FT                   /protein_id="ABD45365.1"
FT                   /translation="MTNDIMDKIKHDIENNDVVLYMKGDADFPQCGFSSVVVSILKKMN
FT                   VKFKSINVLESLELREAIKEFTNWPTIPQLYVKGEFIGGCDIVKEMYHNGELQELLSKN
FT                   NLIVAQ"
FT   gene            complement(290312..290533)
FT                   /locus_tag="ECH_0303"
FT   CDS_pept        complement(290312..290533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0303"
FT                   /product="BolA family protein"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45544"
FT                   /db_xref="GOA:Q2GHF9"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="PDB:2KZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF9"
FT                   /protein_id="ABD45544.1"
FT                   /translation="MTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGK
FT                   SKLEQHRMIYKVLDGLNIHAIQIQTGCK"
FT   gene            complement(290760..291257)
FT                   /locus_tag="ECH_0304"
FT   CDS_pept        complement(290760..291257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0304"
FT                   /product="putative thiol:disulfide oxidoreductase"
FT                   /note="identified by similarity to SP:P33926"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44915"
FT                   /db_xref="GOA:Q2GHF8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF8"
FT                   /protein_id="ABD44915.1"
FT                   /translation="MRIIATALLVCFLTFTVILTKVLLNQNTITDTTNRVVLPILFTED
FT                   QVFDTNDLIGQPYILNVFASWCTTCQEEHSLWLEIAEKKTIKIYGINYLDTEYKVQEWL
FT                   KKHGDPYTKIAKDYSGKTGNVLGVTGVPETFIFDKNGKILLHIHGSVSRDTWENQILKI
FT                   IQ"
FT   gene            complement(291254..292606)
FT                   /gene="radA"
FT                   /locus_tag="ECH_0305"
FT   CDS_pept        complement(291254..292606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="ECH_0305"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by similarity to SP:P37572; match to
FT                   protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45568"
FT                   /db_xref="GOA:Q2GHF7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF7"
FT                   /protein_id="ABD45568.1"
FT                   /translation="MSTKTFYVCQVCGNQTHRWTGKCNACGNWDSIIEETGTEHLINTQ
FT                   HSSEVKLSSLSDKNTLAPSRFITKISELDRVFGGGIVLGSSTLVGGEPGVGKSTLLLQL
FT                   TAILDKHFSTCLYVSGEESIDQIKIRADRLQITQSNIQLLSTSSLSDIIFSLKKNKDFK
FT                   CVVIDSIQTIYDTRISSSPGTVVQIRMCTHELITFTKQHNIILFILGQITKDGQIAGPK
FT                   TLEHMVDTVLYFEGENNNQLRILRTVKNRFGPTNEIGVFEMSDKGLIPIKNPSSLFLAR
FT                   SQNNNIVGSAVFAGIEGSRPILMEIQSLIANTNMVTPRRAVVGWDVNRLAMIIAVLSAK
FT                   CNIFLGDKEVYLNIAGGLKICEPAADLAIAASLISSFINIAIPSLTIILGEIALSGEVR
FT                   NISNIDARLKEAHKLGFTKAIIPLNNKHIFSDINIVEIGHIKTLKKYLIEL"
FT   gene            293108..295756
FT                   /locus_tag="ECH_0306"
FT   CDS_pept        293108..295756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0306"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR02123"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45351"
FT                   /db_xref="GOA:Q2GHF6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF6"
FT                   /protein_id="ABD45351.1"
FT                   /translation="MKKEAQHIQNLIDRELDSSKPIDEGHKITGYTVSFIAFLWACFQL
FT                   FIASPLPFWLVNCGLEWAVLPDIKSRAIHLAFAFSLLFLFLPISKNSNRGFRALDWISS
FT                   ILSCVTVLYIVAFYEDLSFRIAMPNDIDLIVAFFGLLFLLEGARRAIGIPISIIAIAFL
FT                   VYAYLGKYMPDIIAHKGHNFSAIASHEWLSSEGVFGVALAVSSNFVFLYVLFGAFLDKA
FT                   GAGNFFIKLSFALLGRFVGGPAKAAVIASGFMGMMSGSSVANTITIGSFTIPLMKKMGL
FT                   SPEKAAAIEVSAGVNGQIMPPVMGAAAFLMSEFLSIPYATIVKYAFVPAVMVYVTLLYI
FT                   VHLEACKLDMRPVLDLTKARSIYLSVLRFLIAIACLVVFSCIVYVLIEGISIYGFYVPG
FT                   IKAIFLDKSIYCISLVIVSVYVAILFYQFKGKRSNIEGVEEEKKYPKLSETFKYGIHYF
FT                   IPIFILIWCLIVEKLSSALACFWTNLFLIFILLTRDVIYTLFNKQLSSLCSVFCGSVKQ
FT                   VYEAMVMASKNMIAIAVATSAAGIIVGAVSLTGFGLSISGLLDSIAHGSLFLTLLVTAV
FT                   ICIVLGMGMPATGCYIIVSTLMAPILTSVIHKTGLYVPQIAIHLFVFYFGIMADVTPPV
FT                   GIASYAAAAIAKGNAFKTGVQSFLYNIRTMIVPFLFIFNNELILYDITNIWNNIFVIFV
FT                   SLVGILSISAAMQGYFIRKNKLYESIMLLMLGIILIMPNYIAKLFVSPYDTVPFSKLND
FT                   TLVVFKDSSVRLTVEASNQPDKVRKEVIIPLKDKIEDSEYRGTLFDLLSRNVGITVDLN
FT                   NTSDGYLRVKEIASWSYIEPSDMDDSYSIVELALSLKKHYHVTYVYLIAVILLTTVIFL
FT                   QTRKSNFIRQE"
FT   gene            295761..296381
FT                   /locus_tag="ECH_0307"
FT   CDS_pept        295761..296381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0307"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44842"
FT                   /db_xref="GOA:Q2GHF5"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF5"
FT                   /protein_id="ABD44842.1"
FT                   /translation="MLDIAVIGIILLSVVIGLFRGFIKEIFGLCGICVSILLTMRYRSY
FT                   FSGLYGQYVVSDIISEILSTITVFILITVAIIVVNGWIMHLLSSARCTVIDRFGGLLIG
FT                   FIKGVVFSYFLFFIIETSCYALLPAAEKEDDEVLPTWFVNSYYYNIFYIFNTYVDEIMP
FT                   ESTHEKIQEVESAVQDILEKKYTASNVKKKNYKRVERDMTKKI"
FT   gene            296510..296839
FT                   /gene="rpsF"
FT                   /locus_tag="ECH_0308"
FT   CDS_pept        296510..296839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="ECH_0308"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45370"
FT                   /db_xref="GOA:Q2GHF4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHF4"
FT                   /protein_id="ABD45370.1"
FT                   /translation="MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGL
FT                   LDFAYTIDKMNKGHYCMIYIKATPSSMDEFKRKVRLNEDILRFLCLKKDKLPKGDSLMI
FT                   QASQV"
FT   gene            296853..297140
FT                   /locus_tag="ECH_0309"
FT   CDS_pept        296853..297140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0309"
FT                   /product="putative ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44745"
FT                   /db_xref="GOA:Q2GHF3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHF3"
FT                   /protein_id="ABD44745.1"
FT                   /translation="MLKKNKKANSNNSGATAYSPLAYLKRPYFKRSKACPLEQCPNEDI
FT                   DYKNKGLLSKFTSEYGRILPSRITSVSSRKQRLLSTAVKRARYLALLPYC"
FT   gene            297159..297785
FT                   /gene="rplI"
FT                   /locus_tag="ECH_0310"
FT   CDS_pept        297159..297785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="ECH_0310"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45500"
FT                   /db_xref="GOA:Q2GHF2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHF2"
FT                   /protein_id="ABD45500.1"
FT                   /translation="MLSVILKESVRNLGKAGMVLKVKPGYARYLLTQKKAVRATKENLK
FT                   SLEEQYLFIEKENLEKLEAAKVLKASLEDEFLIITRQAADDGKLFGSVTPKCISKLLSD
FT                   KGYNIHYRNIFFYSVIKYIGEYVVNLELHPDLVLPITLYVVKNDLGAMQAQKLHAEKKR
FT                   KIEEGKVEKGSCTEGESLELGSVDNDINSGNVDSNESEKQDSVSE"
FT   gene            297856..299118
FT                   /gene="glyA"
FT                   /locus_tag="ECH_0311"
FT   CDS_pept        297856..299118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="ECH_0311"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by similarity to SP:P34895; match to
FT                   protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44881"
FT                   /db_xref="GOA:Q2GHF1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHF1"
FT                   /protein_id="ABD44881.1"
FT                   /translation="MVGYILDDDLQEVDAEVFNCISGELNRQNSGLQLIASENFVSKAV
FT                   LQAQGSIFTNKYAEGYPGKRYYCGCHFADIVENLAIERLCRLFGCKFANVQPHSGSQAN
FT                   QGVFAALLKPGDTVIGMSLDCGGHLTHGSAPSISGKWFNAVQYQVDRDTGLIDMDEIEK
FT                   LAVEHNPSLIIAGSSSYPRVIDFKRFREIADKVGAYLLADIAHYAGLIAAGEFPSPVEY
FT                   AHVITSTTHKTLRGPRGAVIMTNYEDIHKKIQSSIFPGMQGGPLMHVIAAKAVAFAEAL
FT                   KPEFKDYAKQIIKNSKALGEVFKERGLDLVTGGTDSHMVVLDLRSKSVTGKDAVLALEK
FT                   LGIICNKNAIPFDPEKPFVTSGLRFGSAAETSRGLQESEFREIGSMVCDVIDSLKASDS
FT                   VRLSVERDIIKRVKELTSNFI"
FT   gene            299277..299606
FT                   /locus_tag="ECH_0312"
FT   CDS_pept        299277..299606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0312"
FT                   /product="cyaY protein"
FT                   /note="identified by similarity to SP:P27838"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44569"
FT                   /db_xref="GOA:Q2GHF0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHF0"
FT                   /protein_id="ABD44569.1"
FT                   /translation="MSHSLCISDFQNLSCNLLNTLTAMVDKVDVDGVLECENYDGLVKI
FT                   SDSKGNVYVINKHDPSMQIWIASPISGSVRFNYDRCSGTWISNKNDELFDLFKSEMKVL
FT                   FNIVI"
FT   gene            299609..301351
FT                   /locus_tag="ECH_0313"
FT   CDS_pept        299609..301351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0313"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45072"
FT                   /db_xref="GOA:Q2GHE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE9"
FT                   /protein_id="ABD45072.1"
FT                   /translation="MKVLFQFVRPHLLYFIFAYLVVAVSSISILAFFYELRNLVDLCIA
FT                   TSDVAAINNALLFLFSIVLIVGLSSFLRLWLTGYVSEKVILDIRIKLYNKIIHFSPRFF
FT                   ENNSISSLITRLMADTATLQVILSTSMSTILRNTTTLLGSVVMLVHTNVKLTMYTVIIT
FT                   PIILIILAFFGKKVKVLLRKVRVNLDNVTSFVEETCRGIYVIQSFSREDITKQKFSNLL
FT                   ANTLSMTNRYIVLRALLVTLVITLTMLSIGFVLSFGIREVLNGNMTVGSLFSFIFYAII
FT                   AASSMNNMGDNFNDIQKAVKISEDISKMLLMQTDIIEVKDPYKIQEVQDKISINNVTFY
FT                   YPSKPDNPALKNVSFTIEKGQVVALVGPSGSGKSTIVNILLRFYDVNIGNITIDGMDIK
FT                   KLSLMNLRSLFSIIPQSHIMFSGTIWDNITYGVTNAEYEDVRNAAKIACILDFVESLPD
FT                   KFDSLVGERGLCLSEGQKQRIAIARAVLKDSGVLVLDEATSSLDSKNEQLIHDALDNLR
FT                   NNRTILVIAHRLSTILKADKIIVFNNGCIDDIGTHKSLMQKPNGLYAKLAKLQLSNDSF
FT                   SEDI"
FT   gene            301682..301786
FT                   /locus_tag="ECH_0314"
FT   CDS_pept        301682..301786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44621"
FT                   /db_xref="GOA:Q2GHE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE8"
FT                   /protein_id="ABD44621.1"
FT                   /translation="MKEIYSIALPEGRYILILGVRMLLQDKSWIIIAG"
FT   gene            302203..303999
FT                   /gene="sdhA"
FT                   /locus_tag="ECH_0315"
FT   CDS_pept        302203..303999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="ECH_0315"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by similarity to SP:P31038; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF01266; match to protein family HMM PF02910; match to
FT                   protein family HMM TIGR01812; match to protein family HMM
FT                   TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45406"
FT                   /db_xref="GOA:Q2GHE7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE7"
FT                   /protein_id="ABD45406.1"
FT                   /translation="MSGSAYDIINHEYDVVIVGAGGAGLRATFGMTNVGLSVACISKVF
FT                   PTRSHTVAAQGGISAALGNVSEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIEL
FT                   ERYGVPFSRTSDGKIYQRPFGGMTTEFGKGKPAVRTCAASDKTGHAILHTLYQQSLKYN
FT                   AKFFVEYFAIDLIMDEEGQCKGVLAWSLCDGTLHRFRAHIVVLATGGYGRIYFSATSAH
FT                   TCTGDGGGMVSRINLPLEDMEFVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMER
FT                   YAPKAKDLASRDVVSRAMTLEIREGRGVGPKKDHVYLSISHLGAKVISERLPGIRETAR
FT                   TFAGVDVIKEPIPVLPTVHYNMGGIPTNYHGEVVTLSNNTEQIIPGLFAIGEAACVSVH
FT                   GANRLGSNSLLDLVVFGRAAAIRAKELIKPGMLHAPVQKSSEEWIIDRFDALRFSKGSL
FT                   RVSEIRSNMQNVMQNHAAVFRTEEVLEEGKQKIRSVAESLSEIAVKDRSMIWNSDLVEA
FT                   LELTNMMPQAVVTMECAANRQESRGAHAREDFPDRDDENWMKHSLAWYNSTDCSVHIKY
FT                   KDVAKATLTDDVQYFPPQKRVY"
FT   gene            304044..304820
FT                   /locus_tag="ECH_0316"
FT   CDS_pept        304044..304820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0316"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44772"
FT                   /db_xref="GOA:Q2GHE6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE6"
FT                   /protein_id="ABD44772.1"
FT                   /translation="MVQFFLPKNSKVNKNGKVHHARKGAKNVKCFKIYRWSPDDDENPR
FT                   IDTFFIDLDECGQMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNIDGTNTLACTKA
FT                   ISDIKSDVNIYPLPHMHVIKDLVPDLSNFYKQYESVTPWIQAEEPNHNKERLQTIEDRS
FT                   KLDGIYDCILCACCSTSCPSYWWNSDKYLGPAALLQAYRWLIDSRDEASDSRLDVLDDA
FT                   FKLYRCHTIMNCTKTCPKGLNPAKAIAHIKQMMVRR"
FT   gene            305301..306062
FT                   /gene="thyX"
FT                   /locus_tag="ECH_0317"
FT   CDS_pept        305301..306062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="ECH_0317"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45587"
FT                   /db_xref="GOA:Q2GHE5"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE5"
FT                   /protein_id="ABD45587.1"
FT                   /translation="MIDYMGSDESIVQAARISYGRGTKSVSQDAALINYLMRHSHTTPF
FT                   EMCEIKFHIKLPIFVARQWVRHRTANVNEYSARYSVLDHEFYIPEHSQVAMQSEDNAQG
FT                   RGNNLSDEDAKYVADLLTRDSDMVYETYNKFLEKGVSREIARVNLTLNYYTEWYWKIDL
FT                   HNLLHFLKLRSEMNAQYEIRVYAETMLDIVKKWVPLTYAAFVEYCLKSQNFSRSALDVV
FT                   KKLIVGEKVVQEDTNIGKREWRELMAILKPE"
FT   gene            306388..307596
FT                   /locus_tag="ECH_0318"
FT   CDS_pept        306388..307596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0318"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45068"
FT                   /db_xref="GOA:Q2GHE4"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE4"
FT                   /protein_id="ABD45068.1"
FT                   /translation="MKILKRNILILIIAVIVLSDISSDIYLPGLPKISDFFSVDYAIAQ
FT                   LTISLNLAGISISGLLYGPLSDYYGRRPIMLLGVGIFTLASVACCFASNITVLIIMRFI
FT                   QGFGAGVAGVVGYAIIKDMYSGSDCAKNISIVNMAVAFSPVLGPILGSAIIAHGYHWNM
FT                   LFIAISIMAIIVLICLFVFLKETIVLEKINSNISCLSIMRKYKELVLNIRFCGFALIQS
FT                   FTIMWIWSCIANLPFIFVKDMGVPVGYYGYFVAINVAAYIVGAMLNQRFVERFGINNML
FT                   LLGLILTTLSDVSVLILYQIVEITPLLAEIMWLPSGMGIAFILGNNMTAAFSEIREPGI
FT                   GSAFILFLQTIFGALGIYILGCFYDGTLIPVILFPIICSTICIVIYILLRKDKNNKSEF
FT                   ISA"
FT   gene            complement(307804..308793)
FT                   /gene="ruvB"
FT                   /locus_tag="ECH_0319"
FT   CDS_pept        complement(307804..308793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="ECH_0319"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /note="identified by similarity to SP:O32055; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF05491; match to protein family HMM PF05496; match to
FT                   protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44562"
FT                   /db_xref="GOA:Q2GHE3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHE3"
FT                   /protein_id="ABD44562.1"
FT                   /translation="MKNILQSTECLEDQQNVSMRPNLLDDFIGQSSVVNNLKIFINAAY
FT                   TRKEPMDHVLLYGPPGLGKTTLAHIIAKELKVNFRSTAGPLLSKAGDLAAILTNLQAKD
FT                   ILFIDEIHRLNRNIEEILYSAMEDFCLDIIVGEGCGARTLRVDLPPFTLVGATTRIGLL
FT                   SNPLRDRFGIPIHLEFYSTEELTKVIQRAAKVIKTNISNSGAQEISLRSRGTPRIALRL
FT                   LRRIRDFMEVTEHNKIITDTFADKALLRLGIDKLGLDRQDIQYLKFIYDSNNPTGIDTI
FT                   SSGLSEDTGNIEETIEPYLIKINFIQRTPRGRVITEKAISHLREQEYI"
FT   gene            complement(309386..309958)
FT                   /gene="ruvA"
FT                   /locus_tag="ECH_0320"
FT   CDS_pept        complement(309386..309958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="ECH_0320"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /note="identified by similarity to SP:P08576; match to
FT                   protein family HMM PF01330; match to protein family HMM
FT                   PF07499"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45266"
FT                   /db_xref="GOA:Q2GHE2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHE2"
FT                   /protein_id="ABD45266.1"
FT                   /translation="MIGSLTGIIEEIYNNYIILNVGNVGYIIYVSHKVLQSCKTGNNIK
FT                   LYIETYVNRDNLTQLYGFLDKQEQDYMRMLVTINGINHKTAISILSKLSPEQIFSAVVS
FT                   NNKNAFRGNGIGEKLAGRITTELQYKISKMPIEETLIIKEDDSLAALISLGYDKLKAFN
FT                   AIQEIKANFPDDSIQEIIRKALQKLSQ"
FT   gene            complement(309967..310671)
FT                   /gene="ccmC"
FT                   /locus_tag="ECH_0321"
FT   CDS_pept        complement(309967..310671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="ECH_0321"
FT                   /product="heme exporter protein CcmC"
FT                   /note="identified by similarity to SP:P33929; match to
FT                   protein family HMM PF01578; match to protein family HMM
FT                   TIGR01191"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44594"
FT                   /db_xref="GOA:Q2GHE1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHE1"
FT                   /protein_id="ABD44594.1"
FT                   /translation="MSKFIRYTRSVLPYTVFLFFVLLVCSLYMIFISSPADYMQGELVR
FT                   IMYLHVPAAWISLGSYTLMAVFSFIALIWRNMISAIISHAIAPLGLTFTSICLITGSIW
FT                   GKCTWGTWWVWDARLTSMLVLLFLYLGYISLWNFFDNEARSMKAASIFAIFSAINIPVI
FT                   KFSVNIWTTLHQPASILRTNGTTIDISMLIPLFTMFTTLGVLFCILLILRSHTLINLRR
FT                   INSKLILLNNIF"
FT   gene            311091..311720
FT                   /gene="gmk"
FT                   /locus_tag="ECH_0322"
FT   CDS_pept        311091..311720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ECH_0322"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by similarity to SP:P24234; match to
FT                   protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45409"
FT                   /db_xref="GOA:Q2GHE0"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHE0"
FT                   /protein_id="ABD45409.1"
FT                   /translation="MNDSLKSRGIMLVISSPSGGGKTTISHLLINELQNDLVRSISVTT
FT                   REPRDGEINGKDYFFVTEPEFINLCNTNQMLEYAKVFGNYYGIPRKFVTDNIANGVSVL
FT                   FSIDWQGAFKLIDIMREHVVSIFILPPSMEELQRRLYNRSGESDVINKRLGEAAFEISH
FT                   CYRYDYVIVNHDIEQSVYQIKCIFTSEKLKTQRRVSLKQFIDNCIR"
FT   gene            complement(311837..312094)
FT                   /locus_tag="ECH_0323"
FT   CDS_pept        complement(311837..312094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45319"
FT                   /db_xref="GOA:Q2GHD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD9"
FT                   /protein_id="ABD45319.1"
FT                   /translation="MPFYIYYHLLIIIQNVPDLLHTDTIIIYITFQTIFVISIFNLMQF
FT                   YSHKCHFTFTIIHLLSYKMFLIYTQISIKFKISEIMFSFI"
FT   gene            312256..313158
FT                   /gene="folD"
FT                   /locus_tag="ECH_0324"
FT   CDS_pept        312256..313158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="ECH_0324"
FT                   /product="FolD bifunctional protein"
FT                   /note="identified by similarity to SP:P54382; match to
FT                   protein family HMM PF00763; match to protein family HMM
FT                   PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44758"
FT                   /db_xref="GOA:Q2GHD8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHD8"
FT                   /protein_id="ABD44758.1"
FT                   /translation="MEENIINGKVIAEDITSTLAVCINDLKVQHNVTPCLIVILVGDDP
FT                   ASHLYVRNKQRKAEMLGLRSETMLLPSTTSESSLIDTIRRLNNDDSVHGILVQLPVPKH
FT                   IDKNLIINTIDPRKDVDGFHNENVGRLFTGQKKDCLIPCTPRGCLYLIKTVTRNLSGSD
FT                   AVVIGRSNIVGKPMACLLLGENCTVTTVHSATRNLPDYCSKADVLVAAVGIPHFVKSSW
FT                   IKPGAIVIDVGINAIEEGGVKKFVGDVDFSEARNIASAITPVPGGVGPMTIAFLMVNTV
FT                   IAACNQAGIENFVEKYLDL"
FT   gene            313206..313278
FT                   /locus_tag="ECH_0325"
FT   tRNA            313206..313278
FT                   /locus_tag="ECH_0325"
FT                   /product="tRNA-Val"
FT   gene            complement(313785..314567)
FT                   /locus_tag="ECH_0326"
FT   CDS_pept        complement(313785..314567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0326"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44752"
FT                   /db_xref="GOA:Q2GHD7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD7"
FT                   /protein_id="ABD44752.1"
FT                   /translation="MSDHYKLVLSNPQGLHITYRQLLGNKASIIFFGGFNSNMQGTKAT
FT                   ALYDYCKSHNLGLILFDYLGHGQSDGQFTDYNISDWYKNCIEIITQLTPTNRPKIIIGS
FT                   SMGAWLMLLVAISHQDKVSHLISLAGAPDFTESLIFQKLNTQQKDELYKYGQITLSQNS
FT                   NNMYSYVITRNLIEDGRKHLLLNQESINITCPITLIHGMNDDTVPYQTSITVAEKIKSD
FT                   NVNLHLIKSANHNLSDDTSLNIIFKYIKEAVEQSIQVK"
FT   gene            complement(314581..315099)
FT                   /gene="cycM"
FT                   /locus_tag="ECH_0327"
FT   CDS_pept        complement(314581..315099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="ECH_0327"
FT                   /product="cytochrome C, membrane-bound"
FT                   /note="identified by similarity to SP:P30323; match to
FT                   protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44791"
FT                   /db_xref="GOA:Q2GHD6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD6"
FT                   /protein_id="ABD44791.1"
FT                   /translation="MDGFHLNKIFTAILFASFIVLFISNVVNLLYDPDPHAEQTKGYKI
FT                   NIEEHIPTEVNNTEEQIDIESLIAQANIAKGKDLTKKCISCHTFEKGGANRVGPNLWHI
FT                   VGNKKAHLGDSFNYSKAMLSKGGTWEYQDLFQFLTKPQAYIKGTRMAFAGISKPQDVAD
FT                   LIAYLKSLE"
FT   gene            complement(315380..316849)
FT                   /locus_tag="ECH_0328"
FT   CDS_pept        complement(315380..316849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0328"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44936"
FT                   /db_xref="GOA:Q2GHD5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD5"
FT                   /protein_id="ABD44936.1"
FT                   /translation="MHFLKDLTSGFSLLSIVLLPFTSAFLILILKKTKYAQEVISIFSS
FT                   CTLFYSVFETYKLQLMNNNSELCIKLYEFIDPQIQIALKTETLSIIFGLLASFLWVITT
FT                   IYSISYMKKNDTNNSKQPIFYACFAMSIGCTMGIAFSANLLTLFIFYELLTISTYPLIT
FT                   YHINTQSQISGRYYIGILLGTSMLLFLPAILIIYNVSGTLDFTTNGILPTNISSSLLMG
FT                   LLLLLIYGIGKAALMPTHLWLPQAMVAPTPVSALLHAVAVVKSGVFTIIKILLYIIGLE
FT                   KLNTLVQEHNNIIMYISGITIILASLTAIKQTNLKKLLAYSTISQLSYIVMAASLYTEY
FT                   AIKVSIFQMISHAFAKITLFFAAGAIYTKTGKKYLYELHGIGISMPITMVAFSIGAIAM
FT                   IGIPPAPTFWGKFFILSEALSQNNITVALVLVSSTVLNTIYFLPIIYNAFSTSYNFKYA
FT                   EAPVPMLISIVTTAVCTLLLFFFPDMIFDIF"
FT   gene            complement(317107..317790)
FT                   /locus_tag="ECH_0329"
FT   CDS_pept        complement(317107..317790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45572"
FT                   /db_xref="GOA:Q2GHD4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD4"
FT                   /protein_id="ABD45572.1"
FT                   /translation="MLMFVADKIIPPYIPAVGTGRGYSTDGIAIPRNSKEILRSKITPG
FT                   TKPLVIFIGGALDDTTRLVLHLYAKYYTQNHNHQDIAYATWGSSAIIPIIKAWYEAQQK
FT                   ICLVGHSWGGDTGYKVIKTLKTNTIDLLCTIDPVSRVGIGGKLPKPHNLKKWYNVAIDY
FT                   KKVKSSINNIIAQLGGPWSDCIHADKNFIIDTVEIDGHLISADHAMAEVLFYIYFNEFV
FT                   KNFAM"
FT   gene            complement(318086..320707)
FT                   /gene="ppdK"
FT                   /locus_tag="ECH_0330"
FT   CDS_pept        complement(318086..320707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="ECH_0330"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="identified by similarity to SP:P22983; match to
FT                   protein family HMM PF00391; match to protein family HMM
FT                   PF01326; match to protein family HMM PF02896; match to
FT                   protein family HMM TIGR01828"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45175"
FT                   /db_xref="GOA:Q2GHD3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD3"
FT                   /protein_id="ABD45175.1"
FT                   /translation="MSEKLIYYFSKTKCDGSLTLSHILGGKGANLAEMCNIGVDVPPGF
FT                   TVSTAVCNYYYQHSKLPDNIFSLVENAIEFLNNEVNLKFGDNDNPLLFSVRSGSVSSMP
FT                   GMLDTILNVGLNDNTVIGLAKKSGEFFAYDSYRRLIQMYAHTVLQIESNLFEEVICKKK
FT                   REAGIPVNSQISDPNILKEIIIEFKKIVSTHTNKDFPQDVHEQLYNSIDAVFRSWMNKR
FT                   AVIYRKIHNIPDNLGTAVNVQSMVFGNMSQNSATGVVFTRNPSTGEKEIFGEFLVNAQG
FT                   EDVVSGTHIPLPLNKMQELMPQPYSDLEKVCQKLELHYREMQDVEFTIENGKLWILQSR
FT                   PGKRSIQSAVKIAVDMVEEKLISREEAILRIDYKSFSKLFHPILENNTNINIIARGLPA
FT                   SPGAATGYAAFTPNDAEQFRKDGKNAILIRQETNPEDINGMNSSVGIITLRGGMTSHAA
FT                   VVARGMGKPCICSANGIFIDKSEQFFYTNTGLKVHKGDNITINGCNGEVILGTIKTVTP
FT                   KLSESFYKLMQWVDEIRILKVMANADTPEDTDIAMNFQADGIGLCRTEHMFFSDKRISI
FT                   VQEMIVSDTKEERIAALEKLEVMQKEDFKKIFKSTINKQVTIRLLDPPLHEFLPDNDNA
FT                   INEVSVRTGKSLEKLRNKVLYLSEKNPMLGHRGCRLAISYPEIYEMQVRAIFLAIKELQ
FT                   EETDITGIVPEIMIPLVMNEKELVIIKELISNVAQQFNNPKYSIGTMIELPKAALIADK
FT                   IAQHAQFFSFGTNDLTQTTLGVSRDDSASFIEIYKDLEIIKQDPFETLDIEGVGKLISI
FT                   AVDLGRKSSPNIKIGICGEHGGNFDSIQFFAKLNLNYISCSPYRIPTARLIAAQAAIMN
FT                   RV"
FT   gene            complement(321118..321609)
FT                   /locus_tag="ECH_0331"
FT   CDS_pept        complement(321118..321609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0331"
FT                   /product="RDD family protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44704"
FT                   /db_xref="GOA:Q2GHD2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD2"
FT                   /protein_id="ABD44704.1"
FT                   /translation="MTIKKTKTANIIKRVLASIIDHVILSLLNYPIVLLTNDITIIPFI
FT                   FNVLSSCYYYTYFLSSKTQASIGQKILNIHTIRCDHKKIDIRLAFDRSLSEFLCPTILM
FT                   MSIQAINMNINNIFIVSIIFLITMVTFVTSTCWYLIALFSQKNQTLHDIMFNTMVVDNE
FT                   "
FT   gene            complement(321606..322238)
FT                   /locus_tag="ECH_0332"
FT   CDS_pept        complement(321606..322238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0332"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45298"
FT                   /db_xref="GOA:Q2GHD1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:3KZX"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD1"
FT                   /protein_id="ABD45298.1"
FT                   /translation="MKQPTAVIFDWYNTLIDTSINIDRTTFYQVLDQMGYKNIDLDSIP
FT                   NSTIPKYLITLLGKRWKEATILYENSLEKSQKSDNFMLNDGAIELLDTLKENNITMAIV
FT                   SNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIG
FT                   DSISDIQSAIEAGCLPIKYGSTNIIKDILSFKNFYDIRNFICQLINI"
FT   gene            complement(322349..322555)
FT                   /locus_tag="ECH_0333"
FT   CDS_pept        complement(322349..322555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0333"
FT                   /product="serine hydroxymethyltransferase domain protein"
FT                   /note="identified by similarity to SP:P00477"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45564"
FT                   /db_xref="GOA:Q2GHD0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHD0"
FT                   /protein_id="ABD45564.1"
FT                   /translation="MHVIVAKAVAFAEALKPEFKDYAKQIIKNSKALGEVFKERELDFV
FT                   TGGTKCYTNGKHIICFISNTLHL"
FT   gene            complement(322619..324391)
FT                   /gene="aspS"
FT                   /locus_tag="ECH_0334"
FT   CDS_pept        complement(322619..324391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="ECH_0334"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by similarity to SP:Q46175; match to
FT                   protein family HMM PF00152; match to protein family HMM
FT                   PF01336; match to protein family HMM PF02938; match to
FT                   protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45106"
FT                   /db_xref="GOA:Q2GHC9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHC9"
FT                   /protein_id="ABD45106.1"
FT                   /translation="MNIYRTHLCDQLRKEHINQEVTLSGWIYRKRDHGKIIFVDLRDHY
FT                   GITQLVFNEADNQNFQLITHLRLESVITVKGIVVARDSSTINTAVSTGFIEVVVKHVII
FT                   EGEADPLPLNITSTQDYPEEIRLKYRFLDLRRDKVKNNIILRSKIISELRKSMEAMGFI
FT                   EIQTPILTSSSPEGARDYLVPSRIHHGKFYALPQAPQLFKQILMVSGFDKYFQIAPCFR
FT                   DEDARSDRSPGEFYQLDIEMSFVSQEDVFNVIEPVLLNVFSKFSNKTIDKEFPRISYHD
FT                   AMLHYGSDKPDLRNPLIIQDVTEIFRDSQFNIFNSNIKQGMVVRAIPAPNTATNPRSFF
FT                   DNKIEFAKTLGAQGLGYITFNDDFSAKGPIAKFLDEERLNRIKSICNLQPGDSVFFVSE
FT                   TEDKATELAGEVRTLLGKELNLIEKDTFRFCWIIDFPYFKYDKKEKSINFFHNPFSMPQ
FT                   GGLEALNNQNPLDILAYQYDIVCNGIEISSGAIRNHKLDIMYKAFSIAGYTKEMVDQKF
FT                   NSLTRAFKFGAPPHGGIAPGIDRMVMLLADATNIREVICFPLNQSGEDLLMSAPSEIDK
FT                   EHLKLLSLSITKKS"
FT   gene            324791..325399
FT                   /locus_tag="ECH_0335"
FT   CDS_pept        324791..325399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0335"
FT                   /product="putative osmotically inducible protein"
FT                   /note="identified by similarity to SP:P27291; match to
FT                   protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45432"
FT                   /db_xref="GOA:Q2GHC8"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC8"
FT                   /protein_id="ABD45432.1"
FT                   /translation="MLLLFHMRFLVNFLLLIFLIISQSGCSGIMAGLAVTTGAIITLQD
FT                   KSVGDTIDDTAILIRINKELFKAGLFPQVTVKVSEGRILLIGHVKSLDDQIKAEKVAWQ
FT                   QKDVREVVNEITVDKNAINIKETAVDTMISAQVKARILSQSKVKSMNYSVNTINGTVYL
FT                   MGIAQDQEELDKVVSIAQKVKKVKQVISYVRLKDSKLRD"
FT   gene            325798..326745
FT                   /gene="gshB"
FT                   /locus_tag="ECH_0336"
FT   CDS_pept        325798..326745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="ECH_0336"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by similarity to SP:P04425; match to
FT                   protein family HMM PF02951; match to protein family HMM
FT                   TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44941"
FT                   /db_xref="GOA:Q2GHC7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC7"
FT                   /protein_id="ABD44941.1"
FT                   /translation="MALIVAFQMDKDVVVDKDMSVKFIQEAQNRGHTVFFYSPNQLAVK
FT                   DNMPIARACLVTIEGQELRFADVQELLLEDVNIIFVRQNPPFDMRYITSTYILERLKRP
FT                   LVINNPKSLRDHTEKLLPLSFPEFIPDTIVTEDYIMLQDFYNKHKDIVLKPLYSYGGND
FT                   VTRMHSNVDIGVIAKLMTEKYGCPIIAQKFIPNVSNDKRIILLDGKPIGVFKRRISFNG
FT                   INEEIRTNLRMGSVPEVATLSDRDIAICSAIEQELLGKGMVFVGIDVLDGYLIEINVTS
FT                   PCGILQINELYGVSLEKKCWDCFEEKFYEKHNSI"
FT   gene            327390..328205
FT                   /locus_tag="ECH_0337"
FT   CDS_pept        327390..328205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0337"
FT                   /product="putative cell division protein FtsQ"
FT                   /note="identified by similarity to SP:P06136; match to
FT                   protein family HMM PF03799"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44735"
FT                   /db_xref="GOA:Q2GHC6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC6"
FT                   /protein_id="ABD44735.1"
FT                   /translation="MSEISNLKDIVNYQSLSNVNSISSLNILKSTRVFFIRKNFIFLVI
FT                   IILSMFFTYFFKGKIINGLQNCAVVLSNQLVNYGFAVERVVIDGNKFVTSDYIEKFIDI
FT                   DKSILFISLSELQKKIKSNNKWIKDVSVKRLLPNVLQIKVLEYLPFANWYHNYGSSIID
FT                   DTGHVIVDSEEEEDDLISIYGNEALKDLHFIKKLLNENSVLSNMISSMSYVDGGRWDIV
FT                   LSSGVNIKLPKENPHNAWNSLLSIYEASNEFLIWKSVDMRIPSQINIIE"
FT   gene            328298..328471
FT                   /locus_tag="ECH_0338"
FT   CDS_pept        328298..328471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45358"
FT                   /db_xref="GOA:Q2GHC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC5"
FT                   /protein_id="ABD45358.1"
FT                   /translation="MFDKLMIIVINFYYMFKIYRLKITNFIYWLLIINVYSSIIKCTYI
FT                   EYTVFCGVSSVL"
FT   gene            328496..329893
FT                   /locus_tag="ECH_0339"
FT   CDS_pept        328496..329893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0339"
FT                   /product="putative nitrogen regulation protein NtrX"
FT                   /note="identified by similarity to SP:Q04849; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44610"
FT                   /db_xref="GOA:Q2GHC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC4"
FT                   /protein_id="ABD44610.1"
FT                   /translation="MSKERLYISEVLVVDDEVDIRNLIKDILSDDNYVTKLAVDGLSAI
FT                   KMAYEKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPYLPVIMISGHGNIATAVKSLHMG
FT                   AYDYIEKPFTEGRLKLVVKRAIESGRLRRENDELKSTFEDYEIVGNSPVIKNLRSMINK
FT                   AATTSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLVNIFGSEES
FT                   SNILSHRVPPHIGIIEQANHGTLFIDEVTDLRYDTQLRLLRLLQEGKIYRENSKIPVSV
FT                   DVRIIVSSSKDIENEVRAGKFCEDLYYRLNVLPIRVPSLVEYCTDIPELCRYFMSSICK
FT                   KIGLCTHILSDEALIAMQSYEWPGNLRQLRNVIEWILIMKSPKEIITAKDLPVDIVSNS
FT                   PINDVLSAKVISVPLRQAREEFERQYLKTQLSRFGGNVSKTAEFVGMERSALHRKLKVL
FT                   GLCSISE"
FT   gene            complement(330179..331159)
FT                   /gene="gpsA"
FT                   /locus_tag="ECH_0340"
FT   CDS_pept        complement(330179..331159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="ECH_0340"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by similarity to SP:P43798; match to
FT                   protein family HMM PF01210; match to protein family HMM
FT                   PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45196"
FT                   /db_xref="GOA:Q2GHC3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHC3"
FT                   /protein_id="ABD45196.1"
FT                   /translation="MKTTILGAGSFGTAIAFALSSNSTSVNLWGRNHTDMQSIAINRKN
FT                   LKYLPTCKLPENIIVSSNIDEVLSDYSTCIILAVPTQQLRTLCLSIQDKQHIFEKTPLL
FT                   ICSKGIENISLKFPSEIVKEILPNNPAFILSGPSFAKEIAEDLPCTIVLAGENESLGTS
FT                   IAQKISNKTFKIIYSQDILGVQIGAALKNIIAIACGIVTGKNLGNNAIATVITKGMEEI
FT                   KTLYAAKNQNINLSTLIGPSCLGDLILTCTTAHSRNMSFGITIGQGADINKMLNNNSKI
FT                   IEGVSTVKPLISLAKELNIELPICTSIYNLLYKNIPLEKTISDIL"
FT   gene            331351..332286
FT                   /locus_tag="ECH_0341"
FT   CDS_pept        331351..332286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0341"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by similarity to SP:P46352; match to
FT                   protein family HMM PF00589; match to protein family HMM
FT                   PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45324"
FT                   /db_xref="GOA:Q2GHC2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC2"
FT                   /protein_id="ABD45324.1"
FT                   /translation="MKDQKLCIVVNEWVSWIKKERRYATNTVDSYLRDVNKFIEFLYMC
FT                   VLRPVTLEDIIGVKVADLRKWFAFRYQANIEAVTNARSLSALKNFFRYLSRTYNIDGQA
FT                   VFCLSRPKLKSTLPRTLTQSHIQKIIDYYALLDTDWIVKRDFALIVLLYGCGLRISEAV
FT                   NLKFQNIRREELLIIGKRSKERILPILPIVRQSLDEYVRCCPYHMELNSVKNEYVFVGV
FT                   RGKKLKRTYFANRIQKICKEIGLPDVITPHAFRHSFATHLFLGGADIRSIQELLGHANL
FT                   STTQIYTHLDHKSVIDHYKNFHPQVIKKNS"
FT   gene            complement(333011..334039)
FT                   /gene="purM"
FT                   /locus_tag="ECH_0342"
FT   CDS_pept        complement(333011..334039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="ECH_0342"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by similarity to SP:P08178; match to
FT                   protein family HMM PF00586; match to protein family HMM
FT                   PF02769; match to protein family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44786"
FT                   /db_xref="GOA:Q2GHC1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC1"
FT                   /protein_id="ABD44786.1"
FT                   /translation="MKTYSSAGVNIESGNSLVEKIKPIASSTSIPGVVDSIGSFGALFD
FT                   ISRIKEYNKPVLVSSTDGVGTKLCIAQGVDNHKTIGIDLVAMCVNDVLAQGAEPLFFLD
FT                   YFATGKVNHDTALEIINSIAVGCKKANVALIGGETAEMPGMYSDNKYDLAGFAVGIIEA
FT                   DNILPKSHNIKVGDKILGLASSGLHSNGFSLIRKIISDNKINYHDVCPWSNQTWANYLL
FT                   TPTRIYVKSLLSTIPLVNGLAHITGGGFTYNIPRIIPSHLSATIDLSSWKMPEIFHWLN
FT                   TEVQIQQTELLKTFNCGIGMILVTSQENEDQVLSLLKVTDEVVYKIGEITERNTEDQVI
FT                   FK"
FT   gene            334194..334826
FT                   /locus_tag="ECH_0343"
FT   CDS_pept        334194..334826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97652"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44956"
FT                   /db_xref="GOA:Q2GHC0"
FT                   /db_xref="InterPro:IPR018762"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHC0"
FT                   /protein_id="ABD44956.1"
FT                   /translation="MQNSDILSNIELVSARLLHDLAGSVGAIVNYIECLSEDESVSEDM
FT                   VPLLSDAANDVMNKFKLLKQAYSISDDNGDFNTTEHNIKNYLKRKKIVLEWDINAQIFD
FT                   VELVEKINKLLINVTMILMFFMINGTKVKVVLSKSNNNDFLIEIIAFAQKIEIHESIQS
FT                   ILDGDMFNQELNTKNVQVNFLMMLLKSYNAKMTYEIQDTIFKFSIFI"
FT   gene            334857..335087
FT                   /locus_tag="ECH_0344"
FT   CDS_pept        334857..335087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45422"
FT                   /db_xref="GOA:Q2GHB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB9"
FT                   /protein_id="ABD45422.1"
FT                   /translation="MCSIYVSYGNFGVQFIFVKYRKTIKVRYQLLNEKFSKCIYEMLVL
FT                   LIVPPPASCCAINSTLLIFVKSCTESISLYI"
FT   gene            complement(334973..335857)
FT                   /locus_tag="ECH_0345"
FT   CDS_pept        complement(334973..335857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13843.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45590"
FT                   /db_xref="GOA:Q2GHB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB8"
FT                   /protein_id="ABD45590.1"
FT                   /translation="MNHFVVARRSDDSVISVQQNNTLQNLTISNLNKPAEILLEYTVEE
FT                   LSNKPLSTILHKNIVENINSYLEYTSDGTDLFDILSKTRNCSFIGKNNKAIPVTPKVFR
FT                   VIASNQDIINYEILIRDISISQKLDIFKESVIFNTKYNMHPTFNIMDEASTKTEVQIIL
FT                   DFLHKYNTHAVISMIQLDPPHNSSNIDSLTQQTINLLHKNIRESDIIGYIGNHKIICIL
FT                   LGCKSEHAYSAISRIHKNINNNLQDSHAKISVGYAQMYNEIDSVQLLTNISNVLFIAQQ
FT                   EAGGGTIKSTNIS"
FT   gene            complement(336274..336645)
FT                   /locus_tag="ECH_0346"
FT   CDS_pept        complement(336274..336645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0346"
FT                   /product="iojap-related protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44496"
FT                   /db_xref="GOA:Q2GHB7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB7"
FT                   /protein_id="ABD44496.1"
FT                   /translation="MNLSKSKKPFSSPEELKELIVFILDKHKANNIVTINISNKSNLAE
FT                   HLIIASGESSYHVKSLAERIRKEIKPHKKLSIEGLKDGNWVVINCYNILIHIFRPEVRE
FT                   YYQLENLWNSQVHEENEKL"
FT   gene            336854..338161
FT                   /locus_tag="ECH_0347"
FT   CDS_pept        336854..338161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0347"
FT                   /product="peptidase, M48 family"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45178"
FT                   /db_xref="GOA:Q2GHB6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB6"
FT                   /protein_id="ABD45178.1"
FT                   /translation="MNIKSVILFLSILLYSNVSFCQDGYMIFRDSEVEAVIKKIAFPIF
FT                   IAAKINPETVRVFIVNDKMVNAYVDGNNNDVFLNYGLFEFSNDPSVLIGVLAHEVGHIS
FT                   QKHVLFRRSKVQNSMILSGIGYVLGIITAITVNPDMGQAIALATNDISKKMFFLYSRLQ
FT                   EASADQCALRYLDEAGYSNDGLIKMFKHFYSLEAQYRGNIDQYLLSHPLSYDRLLQIQN
FT                   YRNRNEVHGFSDEDVQKFKRVVEKINAFFNPVERLVNDKNDINQLSPYIQSIIFYKQSD
FT                   VSKALEKLDNLILQSPEDPYLYELKAQILYKAGDIKKSVENYKLALKFSFDDVLIKLET
FT                   SQALLLYDQKEAVNYLEQVTYQEPDNVFAWKQLAVAYGKIGDLGMSYFSLANKSFFENN
FT                   RRDFDKYFSLARKYLPKDSVHLERMRDLRINLLSNT"
FT   gene            338246..338854
FT                   /locus_tag="ECH_0348"
FT   CDS_pept        338246..338854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL08839.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45244"
FT                   /db_xref="GOA:Q2GHB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB5"
FT                   /protein_id="ABD45244.1"
FT                   /translation="MKIQNAIFFLLMLQASCSPIYGIKKEYKGPENESGKACVVKCAYV
FT                   RNDCYRQCQVDMTNCQLTEKMINAQERSQPLVSIINSNGNKQNNNLKNNNGHPCKSENI
FT                   KCKESCSSDIMCKTQCDMYMDMCNAQQNFNGHDKYDNFVSSIDKKSANITVRKQNSISL
FT                   CSSNKCDRLCTNNYDLCFSSCGGQIITYKQCVAFCDKNK"
FT   gene            339118..339213
FT                   /locus_tag="ECH_0349"
FT   CDS_pept        339118..339213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45069"
FT                   /db_xref="GOA:Q2GHB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB4"
FT                   /protein_id="ABD45069.1"
FT                   /translation="MGVLVRHGGIHKGFCVLDYIACIVELWMCLY"
FT   gene            complement(339625..340134)
FT                   /gene="folK"
FT                   /locus_tag="ECH_0350"
FT   CDS_pept        complement(339625..340134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ECH_0350"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine-pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by similarity to SP:P26281; match to
FT                   protein family HMM PF01288; match to protein family HMM
FT                   TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45103"
FT                   /db_xref="GOA:Q2GHB3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB3"
FT                   /protein_id="ABD45103.1"
FT                   /translation="MFNDVVMLALGSNCGNMLAYIKSAINMLPLHNKNYSYLYKTPALL
FT                   PENAADHWDTPYLNMVVSGYTNLSSSAMLERIKSIEKMLGRINHQRWAPRPIDIDIILW
FT                   GNKVVDSQTLSIPHQQMHCRDFVLVPLCDIYARFIHPVLQIPIYEMLLSLNNINLIKQN
FT                   SHVLQQ"
FT   gene            complement(340306..343329)
FT                   /locus_tag="ECH_0351"
FT   CDS_pept        complement(340306..343329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0351"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase II"
FT                   /note="identified by similarity to SP:P35852; match to
FT                   protein family HMM PF00586; match to protein family HMM
FT                   PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44769"
FT                   /db_xref="GOA:Q2GHB2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB2"
FT                   /protein_id="ABD44769.1"
FT                   /translation="MIIRIGVADKVLPKSYKSNDVTVYTINVQHNLSTAIIKKIGSLLT
FT                   NSITQQFFAFTYDTTEQNYKDVSTNTNYNLLDTFKADWSLEKGFLPRVTDNVGNTTKCI
FT                   INEMLGYNTATDVLTSKVTFGQGPIPQEENILQLFNPLIEYCKLSFVTGKTFKVKFFGN
FT                   KQISNLNNIYADSSTCSSIFIIPYVKYEDLFPQNKKQNVTVTSIDLNIQDHELIQISKH
FT                   GINGRGALNLSLEAMKAIQAYFKKIQRNPNDIELETLAQTWSEHCKHNIFSSPIDEITD
FT                   GLYKHYIKRATYEINSEICVSTFSDNAGAIVFDDNFIIADKVETHNSPSALDPFGGAIT
FT                   GILGVNRDIIGFGKGAKPILNAYYFCFSESDEELYRDKSCTTKVLSSNTIMDGVIKGVN
FT                   YGGNCSGIPTSLGSAYFDNRFRSKPLVFVGCTGIMPRTINKSLSHVKNPNNGDYIVIAG
FT                   GRTGRDGIHGATFSSNALTEHNSSSTVVQIGDPITQKKLSDAIIKEARDLDLYNAITDN
FT                   GAGGLSSSIGEMGNNGFIVELDKVLLKHDNMSPWEIWVSESQERMTFAVSPNKFSIFEK
FT                   VMKKHDIEISIIGEFNNSNKAVVLFKGSVIMDIDVDFLHNGVPKIHLHTSPWSKTTESI
FT                   FPKKHNKPLEIELNEMIQRMNICSKEFISLQYDHEVQGTSIIKPIQGKGRVNGDATVIK
FT                   PILSSKKGIVKSHGLGSSYGEISTYHMAACAIDTAIRNYIAVGGNFNHLALLDNFCWCD
FT                   STNPQRLWQLKNAAQACYDYAIAFRTPFISGKDSMFNDFKGYNNKGKEINISAPPSLLI
FT                   STLGIIENVENAVTLDVKSPGDLIYILGTTYDELGSSEYQKYSGLGNNNVPQVHAEHAK
FT                   KLYISYNKAINTNLIASAIAVNLGGMIISLIKSLIGGQLGAEISLSAIPTYNIDNNTLR
FT                   EKVILFSESQSRILVTIGEHNKQRFEAIFKEVPYANIGKVTSTNTLIIEDICSIDLNIL
FT                   EHNYKKFSNMKIQSYTNI"
FT   gene            complement(343585..343871)
FT                   /locus_tag="ECH_1157"
FT   misc_RNA        complement(343585..343871)
FT                   /locus_tag="ECH_1157"
FT                   /product="sRNA"
FT   gene            complement(344105..345085)
FT                   /gene="bioB"
FT                   /locus_tag="ECH_0352"
FT   CDS_pept        complement(344105..345085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="ECH_0352"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by similarity to SP:P12996; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   PF06968; match to protein family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45247"
FT                   /db_xref="GOA:Q2GHB1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHB1"
FT                   /protein_id="ABD45247.1"
FT                   /translation="MNTCTTIRNNWQLDEILELFNTPFNDLILRSHLTHRQFFNNNEIQ
FT                   LAALLNIKTGGCPENCRYCSQSAHYKTDLQKEALLDVENIKKAIQTAKNSGADRFCFAA
FT                   AWRQLRDKDIEYICNIINLIKSEKLESCASLGMITLDQAKKLKNAGLDFYNHNIDTSRD
FT                   FYSNVTTTRNYDDRLASLNNIYEAGINICSGGILGLGESIEDRAKMLLTLANLKEHPRS
FT                   VPINRLVPIKGTPFENNIKVDNIDFIKTIAVTRILMPKSYVRLAAGRKDMSEEMQALCL
FT                   FAGANSIFYGEKLLTTPNSNCDDDKNLLSKLGIKTKEPVLLNSQN"
FT   gene            complement(345082..345303)
FT                   /locus_tag="ECH_0353"
FT   CDS_pept        complement(345082..345303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44888"
FT                   /db_xref="GOA:Q2GHB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHB0"
FT                   /protein_id="ABD44888.1"
FT                   /translation="MRFFLHDISKMSVSLFGIAIGTLGITNRVVKKCLSAYLRNSGFVT
FT                   QDELDTLSSSVREIASKQNEIEKQLSQK"
FT   gene            complement(345456..345911)
FT                   /locus_tag="ECH_0354"
FT   CDS_pept        complement(345456..345911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14547.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45376"
FT                   /db_xref="GOA:Q2GHA9"
FT                   /db_xref="InterPro:IPR009922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA9"
FT                   /protein_id="ABD45376.1"
FT                   /translation="MSEYVSERRAIKILFAYWNQLRNDRMFPKIEEIEQEEIREIWPNC
FT                   FIIEVKNDTDNQKYNCIYIGERAMELYQSNIKVYAESQNIKLFFPQVIENLFDYLESVV
FT                   ENQEPIMDESETESADGNYIKIRQCLLPIGENNEVTHIIGVIGGRIY"
FT   gene            complement(346233..346844)
FT                   /locus_tag="ECH_0355"
FT   CDS_pept        complement(346233..346844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0355"
FT                   /product="M23/M37 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45497"
FT                   /db_xref="GOA:Q2GHA8"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA8"
FT                   /protein_id="ABD45497.1"
FT                   /translation="MTIRKTLLIVLLCFGCTQKPAPSFLRGEEFHGKKELDDINEYHLV
FT                   RHDVKKDENIESHTIQDNHQVMKEIKTIDKKCNFIMPIEGIITSKFSINNQDRNCKEGI
FT                   NIKSNGAQQVRASSSGKILYVGKGSKWYGNMIIIEHNKNTITTYSYLDSIDVKIGDKVT
FT                   QGQAIGSIKSINSQKNKSYLCFAMRKHGQAVNPLLYINCK"
FT   gene            347142..348065
FT                   /gene="glpX"
FT                   /locus_tag="ECH_0356"
FT   CDS_pept        347142..348065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="ECH_0356"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF03320;
FT                   match to protein family HMM TIGR00330"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44920"
FT                   /db_xref="GOA:Q2GHA7"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA7"
FT                   /protein_id="ABD44920.1"
FT                   /translation="MQSLIFKLLSVTEAAALASYKCLGMGNEKEADRVAVHAMRKSLNL
FT                   LEINGTVVIGEGERDNAPMLYIGEKVGIGGIDVDIALDPLEGTTMCAHYKNGAMSVLAI
FT                   AKKGEFLNAPDVYMKKIAVGPNVPKGVVSLKYDIKTNLYNLAEVRKCNVNELIVMVLYR
FT                   ERHLELIKSIRECGARIKLIDDGDVSAVVSLMKGTHDLYVGTGGAPEGVLAAAALSSMG
FT                   GYMEGKLIFDTEYLRARAEQFGIKDINKIYSIEEMVKSESIFIATGITDSALVKGIRYS
FT                   QGSFIIESIIIKPASVMYVNNTVPEV"
FT   gene            348139..348273
FT                   /locus_tag="ECH_0357"
FT   CDS_pept        348139..348273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44953"
FT                   /db_xref="GOA:Q2GHA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA6"
FT                   /protein_id="ABD44953.1"
FT                   /translation="MKIFYKKCEAVESVIRRNYLEYIYHKRKYCLLVKFSEMVFISDT"
FT   gene            348351..348470
FT                   /locus_tag="ECH_0358"
FT   CDS_pept        348351..348470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45345"
FT                   /db_xref="GOA:Q2GHA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA5"
FT                   /protein_id="ABD45345.1"
FT                   /translation="MLIKLMKSFYFYNEELSRYIYHKRMYCLLVKPSEVVFGI"
FT   gene            complement(348770..350647)
FT                   /gene="gidA"
FT                   /locus_tag="ECH_0359"
FT   CDS_pept        complement(348770..350647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="ECH_0359"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by similarity to SP:P17112; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44851"
FT                   /db_xref="GOA:Q2GHA4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GHA4"
FT                   /protein_id="ABD44851.1"
FT                   /translation="MDHYDVVVIGGGHAGCEAAAAAARIGAKTLLITHSTSTIGEMSCN
FT                   PAIGGIAKGTVVREVDALDGLMGKVIDKASINSSILNRSKGPAVWGPRAQADRKIYKNT
FT                   MQDIILNYPNLTVLEASVEDFTITEKDEKFTVETVITSDQQVIYTKKLILTTGTFLQGT
FT                   IHIGSYNTPAGRFGEQPSIGLAKTLEKYNFKLGRLRTGTPPRLDINSINFSGLQEQKGD
FT                   SEPSPFSYMSQSIDLPQISCYLTATNTRTHEVIKNNLHRAAASNSLKDIKAPRYCPSIE
FT                   EKVRRFSERNSHQVFLEPEGLDSNIIYPNGITTSSPLDVQYEMLKTIPGLEKVNIIRSG
FT                   YSVEYNFIDPRELYHTLETKKISGLYFAGQINGTTGYEEAAGQGIIAGINAALSLNSKY
FT                   EPFILKRSDAYIGVMIDDLVTLGTSEPYRLFTSRAEYRLRLRSDNADLRLTELGYQISV
FT                   VSSKRYTILKNKKQEIITLTNILKNIITTPTQLARHNIPISQDGVRRSIFDLLGHPNIN
FT                   MEIVSRICNTVKEFNKNVAEQVAIEAKYAPYFDRQDADIKAFLEEENTHIPHNIEFSQI
FT                   HGLSKEIQEKLEYIKPLSIGSARRIPGITPAAITNILIYLRYYKSKKTS"
FT   gene            350662..350766
FT                   /locus_tag="ECH_0360"
FT   CDS_pept        350662..350766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44630"
FT                   /db_xref="GOA:Q2GHA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA3"
FT                   /protein_id="ABD44630.1"
FT                   /translation="MLNTKIMVVILLKLSIKLHSNIKFLYHKLLKDIK"
FT   gene            350771..350944
FT                   /locus_tag="ECH_0361"
FT   CDS_pept        350771..350944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44670"
FT                   /db_xref="GOA:Q2GHA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA2"
FT                   /protein_id="ABD44670.1"
FT                   /translation="MYFFKLIANSIFSLISKHILRKEFFIIVILLIRYKHCLVVLLACI
FT                   QYIKCFFGLKNI"
FT   gene            351149..351952
FT                   /locus_tag="ECH_0362"
FT   CDS_pept        351149..351952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0362"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase I"
FT                   /note="identified by similarity to SP:P15254"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44884"
FT                   /db_xref="GOA:Q2GHA1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA1"
FT                   /protein_id="ABD44884.1"
FT                   /translation="MKKMKVIVLSGYGLNCEEETLFAFVKAGELLSCDVQGKIVHINEV
FT                   ISCPNLLRDYNVLAIPGGFSYGDDTGAGNAFALRIFHNLREEISEFLAGDKLVIGICNG
FT                   CQILMRLISDFACITLLNNSVRQYQCRWVKVKVNLSNNSPWLKGLNELYIPVAHGEGRF
FT                   FVENVSVISSIEKNIAFRYINNEGNYANQEFPCNPNGSVADIAALSDNSGKVLVMMPHP
FT                   ERAMFFTQQDNWTQIKEQCLRSNIAYPTYGDGMKIFCNAVKYFCK"
FT   gene            complement(352494..353186)
FT                   /gene="radC"
FT                   /locus_tag="ECH_0363"
FT   CDS_pept        complement(352494..353186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ECH_0363"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by similarity to SP:P25531; match to
FT                   protein family HMM PF00633; match to protein family HMM
FT                   PF04002; match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45356"
FT                   /db_xref="GOA:Q2GHA0"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GHA0"
FT                   /protein_id="ABD45356.1"
FT                   /translation="MNIKDERQKQQIGHRKRLRQKLLSKGNKGLLDYEILELILCSAHP
FT                   RKDVKPIAKKLIEHFGTFAKVFFADYSQLKQISGIGEVAISAIFCIREALNRILRENID
FT                   KGTIINQWQKLIEYLRIKIGNGSVENFHILYLNTKYKLLADETQDVGTVNQTPLYVREI
FT                   IKKSLFLEATSIIIAHNHPSGDAKPSKADIEITNQLARACSDVGITLIDHVIVTSNAHY
FT                   SFKTHNLL"
FT   gene            353453..353737
FT                   /gene="groES"
FT                   /locus_tag="ECH_0364"
FT   CDS_pept        353453..353737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="ECH_0364"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by similarity to SP:P42386; match to
FT                   protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45021"
FT                   /db_xref="GOA:Q2GH99"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH99"
FT                   /protein_id="ABD45021.1"
FT                   /translation="MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPG
FT                   VYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHDKKYIVMKESDIIAKEA"
FT   gene            353838..355490
FT                   /locus_tag="ECH_0365"
FT   CDS_pept        353838..355490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0365"
FT                   /product="chaperonin, 60 kd"
FT                   /note="identified by similarity to SP:P42382; match to
FT                   protein family HMM PF00118; match to protein family HMM
FT                   TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44992"
FT                   /db_xref="GOA:Q2GH98"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH98"
FT                   /protein_id="ABD44992.1"
FT                   /translation="MANVVVTGEQLDKSIREVVRILEDAVGCTAGPKGLTVAIGKSYGA
FT                   PEVTKDGYKVIKSIKPEDPLALAIANIITQSASQCNDKVGDGTTTCSILTAKVIEEVSK
FT                   AKAAGADIVCIKEGVLKAKEAVLEALMSMKREVLSEEEIAQVATISANGDKNIGSKIAQ
FT                   CVQEVGKDGVITVEESKGFKELDVEKTDGMQFDRGYLSPYFVTNSEKMLVEFENPYILL
FT                   TEKKLNIIQPILPILENVARSGRPLLIIAEDVEGEALSTLVLNKLRGGLHVAAVKAPGF
FT                   GDRRKDMLGDIAILTGAKHVISDDLAIKMEDLTLAELGTAKNIRITKDTTTIIGSVDNS
FT                   SANVQSRINQIKMQIEASTSDYDKEKLRERLAKLSGGVAVLKVGGSSEVEVKERKDRVE
FT                   DALHATRAAVEEGVVPGGGAALLYTLSVLENLKSKNDDEQLGINIVKRALQAPIKRIIK
FT                   NSGSENAPCVIAHLLKQNDKELIFNVDTMNFANAFTSGVIDPLKVVRIAFDFAVSLAAV
FT                   FMTLNAIVVDVPSKDDANAGAGGMGGMGGMGGF"
FT   gene            complement(356147..356875)
FT                   /locus_tag="ECH_0366"
FT   CDS_pept        complement(356147..356875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0366"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44660"
FT                   /db_xref="GOA:Q2GH97"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH97"
FT                   /protein_id="ABD44660.1"
FT                   /translation="MEKQLAGKVAIITGASGSIGSAVAKRFAKEGACLILVAKNINKLN
FT                   AVYDSIKELGGDAMLAAVDLQDFDTIKNFAMSIGNKFKNIDILILNAAVVGDLSPTQDY
FT                   EYDTWKRIMDINFIANWHLIKYFDPLLKLSPAGRVIAVTSEVTQSPSRYPYWSTYASSK
FT                   AALETMLRIYATETKHSKLCVNMVYPSLMDNDIYAQALPIKETAQSVLPENFTDKFIEL
FT                   SSNQCNVTGQIYKIGSEDEC"
FT   gene            357222..359795
FT                   /gene="clpB"
FT                   /locus_tag="ECH_0367"
FT   CDS_pept        357222..359795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="ECH_0367"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /note="identified by similarity to SP:P03815; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02861; match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45139"
FT                   /db_xref="GOA:Q2GH96"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH96"
FT                   /protein_id="ABD45139.1"
FT                   /translation="MDLNQFTDMSKNLIMQAQTTAIASGHQSLIPEHLLKVMLDTKDEL
FT                   IELLLTSCGCDIDKIYSDIKLSLSKLPVVSGSGSGHIHLSKEMAQVLEEAISLAKRNQD
FT                   TYVTVERLLQALAVVKDTSVYKILLAHGVTPVKLESLILNMRNGSKADTINAEHKFNAL
FT                   KKYAKDITESAMAGKLDPVIGRDEEIRRTMQVLSRRTKNNPVLIGEPGVGKTAIIEGLA
FT                   QRIVVGDVPVGLRNAKIMALDLGMLVAGTKYRGEFEERLKYVINEIVASNGAVILFIDE
FT                   LHTLVGAGATDGAMDASNLLKPALARGEIHCIGATTLDEYRQHIEKDAALARRFQPVFV
FT                   SESTVNDTISILRGLKEKYEVHHGIRIMDSAIIAASTLSNRYITDRFLPDKAIDLIDEA
FT                   ASRVRIEIDSKPEVIDELDRKIIQLKIEAGVLEKENTESSKQRLAQLSEELNKLSIQAT
FT                   ELNSKWQAEKMKILKMQECVEKLDNARNDLEKAQRSGNLAKAGELMYGIIPELEKELKK
FT                   CEKPSSNMLKREVTESDIASIVSRWTGIPIENMMSSEKEKLLRMEEEIGKTVIGQESAI
FT                   KAVSDAVRRSRAGVQDANKPLGSFLFLGPTGVGKTELVKTLAEFLFCDKSALLRFDMSE
FT                   FMEKHAVSRLIGAPPGYVGYDQGGMLTESVRRRPYQVILFDEIEKAHGDIFNILLQVLD
FT                   EGRLTDNHGKLVDFRNTILVLTSNLGQEILINNKEDVDGESVKKSITSVLQHHFRPEFL
FT                   NRLDEIIVFHRLTKEHIEKIIDVQFSLLQKIVAQKELEISLSSEAKSWLMNNGYDSLYG
FT                   ARPLKRLIQQKIQNSLAKLILANQVSKGDKLEVVLLNDDLIINKL"
FT   gene            complement(359931..360605)
FT                   /locus_tag="ECH_0368"
FT   CDS_pept        complement(359931..360605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0368"
FT                   /product="dioxygenase family protein"
FT                   /note="identified by match to protein family HMM PF00775"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44803"
FT                   /db_xref="GOA:Q2GH95"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH95"
FT                   /protein_id="ABD44803.1"
FT                   /translation="MNYLAKSLLCLLISITCTYDALAIDPILVHCQKTPEIFDLNNKPS
FT                   KFSLSNNLRRKMSSPLAADGELIYIVGKVTNTNCIPIANANVFIWHTNAHGIYQDSQDD
FT                   KHKSELILEELDMYDYQFIGSGKSVTDNLGNYSFITIIPGINKKNKVPRIHFLLQHSEF
FT                   SEFNTTMFFPEYDNSIDNQFQNIDFNLQDLLVARYTKNTLGIKTYYFNITIEDKNPYKS
FT                   YK"
FT   gene            361011..362513
FT                   /gene="pepA"
FT                   /locus_tag="ECH_0369"
FT   CDS_pept        361011..362513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="ECH_0369"
FT                   /product="cytosol aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="identified by similarity to SP:P27888; match to
FT                   protein family HMM PF00883; match to protein family HMM
FT                   PF02789"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45439"
FT                   /db_xref="GOA:Q2GH94"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH94"
FT                   /protein_id="ABD45439.1"
FT                   /translation="MIDISFSSLMPGVSLFLKTTAIVVGIFEGSNHLEDYSALAERSEQ
FT                   IMKVVEGYKSFDGKFAEVLPITGLDAGYPIVIVVGLGKPEEFDENKSLRIGGVIYSELN
FT                   RMKISEASIISSNDSDIMANVAYGAFLRSFKFDKYFVQKKDENATYVRKLEFFSKTNPQ
FT                   KTAVLFDNLKAEGESVFLARSFVSEPPNILYPEIYAQMIYEELSKVDVKVEIFDEDYMK
FT                   ANQMMALLGVGQGSAKKSRLVVMRWNGGKETDSPIAFVGKGVTFDTGGISLKPSRGMWD
FT                   MKYDMAGSASVVGIMRTLAARKAKVNAVGVVGLVENAVGGNAQRPSDVVTSMSGQTIEV
FT                   LNTDAEGRLVLADALWYTQKMFSPKLMIDLATLTGAVVVALGNNQYGGIFSNDDAIANQ
FT                   LIVAGNESGEKLWRLPLDDAYDKLIDSSIADVQNISTKGYGADSITAAQFLQRFVNKTP
FT                   WVHLDIAGMAWDNEGNEICPKGATGFGVRLLNRLILKYYEAN"
FT   gene            362656..363282
FT                   /gene="purN"
FT                   /locus_tag="ECH_0370"
FT   CDS_pept        362656..363282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="ECH_0370"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44645"
FT                   /db_xref="GOA:Q2GH93"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH93"
FT                   /protein_id="ABD44645.1"
FT                   /translation="MTPLKLGILISGRGSNMQALINACAQDDFPAEVSCVISNNPKANG
FT                   LLIAQKQNIKTFVVQGRPLDFDSIDSILRQHQVDLICLAGFMSIVPEGFINKWFHKIIN
FT                   IHPSLLPSFKGLNAQSQALKAGVKIAGCTVHYVYPEVDGGPIIVQAAVPVFSSDNLTDL
FT                   SERILKMEHICYPKAVKLIALNQLQLNENLATSAELLHMFYDETI"
FT   gene            363550..364194
FT                   /gene="lipB"
FT                   /locus_tag="ECH_0371"
FT   CDS_pept        363550..364194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECH_0371"
FT                   /product="lipoate-protein ligase B"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44805"
FT                   /db_xref="GOA:Q2GH92"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH92"
FT                   /protein_id="ABD44805.1"
FT                   /translation="MSYDLIEWKIESLQIDYQEAICFMQQRIEDIYNGVQKELVWLLEH
FT                   PPLYTAGTGAKVEDLLVDNLFPVYATNRGGKYTYHGPGQRIAYVMLNLKTRNKCNIRLY
FT                   VETLGNWIVETLSHFSVKSYFNPDLIGVWVTHGGTEKKIAAFGIRIRKWVTYHGVSINI
FT                   DTNLSHYSGIVPCGIKDYGITSLRKLGINISYEEFDIVLQEKFNEIFSNFN"
FT   gene            364222..364353
FT                   /locus_tag="ECH_0372"
FT   CDS_pept        364222..364353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44946"
FT                   /db_xref="GOA:Q2GH91"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH91"
FT                   /protein_id="ABD44946.1"
FT                   /translation="MAYTLLSCNSSIFNAINVNLELVNAEKYFHIGVVTLGVMGLLY"
FT   gene            complement(364710..366053)
FT                   /gene="pyrC"
FT                   /locus_tag="ECH_0373"
FT   CDS_pept        complement(364710..366053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="ECH_0373"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by similarity to SP:P48795; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45465"
FT                   /db_xref="GOA:Q2GH90"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH90"
FT                   /protein_id="ABD45465.1"
FT                   /translation="MYKQSWELLGNGQHADLTVAYINARIIDPESKLDIRGSLLTKGDK
FT                   IIDFGPDLFANGIPSTIDEVIDCNNNILLPGLIDIHVHFREPGQEHKETINTGSKSAAA
FT                   GGITTVVCQPNTIPTISSVITAKYIKMRALESAYVNIEFYASITKSDNSLSDMALLKEV
FT                   GAVGFTDDGMPVMNALTMRQALSYSSMLDTVIAQHAEDLNISNNGCINEGIISYELGLK
FT                   GIPDISESIIVNRDIALMKNIKNVHYHILHVSSQESLHIIKQAKSQGLKVTCEVTPHHF
FT                   TLTERDIMTHGSLAKMNPPLRTENDRLSMIEGLKSGIIDCIATDHAPHDINAKELPLDT
FT                   AAFGIVGLETMLPISLELYHNGTMPLIDLLATLTYKPADIIKVPRGRIKKDYVADLIIL
FT                   DLDHEWVVDISKFASKSKNSPFHNRKVKGKVLRTIVSGKTTYKAEIII"
FT   gene            complement(366303..366953)
FT                   /locus_tag="ECH_0374"
FT   CDS_pept        complement(366303..366953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0374"
FT                   /product="DNA / pantothenate metabolism flavoprotein family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04127"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44687"
FT                   /db_xref="GOA:Q2GH89"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH89"
FT                   /protein_id="ABD44687.1"
FT                   /translation="MVNVLITAGPTQEAIDPIRYISNNASGKQGYAIAEYMNKIGWKVN
FT                   LVSGPVTIHNHNIQNILHVKNCNEMLQTCIELLPVDIAIFTAAVTDWCPTYSVRKIKKH
FT                   EITNIKVTNNPDIIHCISTHEKRPKLVIGFSLESENVIENAKIKLKRKQCDWIISNTTT
FT                   INNEHVMGNDYNKITIITKDHYKEFPIMSKKEIGQLITEEIINFLAKINNTKS"
FT   gene            complement(367024..367149)
FT                   /locus_tag="ECH_0375"
FT   CDS_pept        complement(367024..367149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45548"
FT                   /db_xref="GOA:Q2GH88"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH88"
FT                   /protein_id="ABD45548.1"
FT                   /translation="MHIMNIPVHNNYTTATAIPYSSRINCTIRLFVTVNLVNMHT"
FT   gene            367403..368788
FT                   /gene="fumC"
FT                   /locus_tag="ECH_0376"
FT   CDS_pept        367403..368788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="ECH_0376"
FT                   /product="fumarate hydratase, class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by similarity to SP:P28894; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00979"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44787"
FT                   /db_xref="GOA:Q2GH87"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH87"
FT                   /protein_id="ABD44787.1"
FT                   /translation="MRKERDSLGEIDVPACHYWGAQTQRSIDNFKIGSEKMPKPLIKAL
FT                   GLVKLAAARVNMKNGDISETIGNAICNAASEIIDGKFDDEFPLVIWQTGSGTQSNMNVN
FT                   EVIANRAIEILGGEKGSKYPVHPNDHVNYSQSSNDTFPTAMHIAAVIETENSLLPNLKN
FT                   LYDALHSKSIAFQNIVKIGRTHLQDATPLTLGQVFSGYAYQILQGMSRVKSALGHLLEL
FT                   AQGGTAVGTGINSRKQFDVHFASEIKKLTGFNFVASVNKFEALATHDALVEFSGALNVL
FT                   AVSLMKIANDIRLLSSGPRCGIGEIILPTNEPGSSIMPGKVNPTQCEAVTMVCAQVMGN
FT                   HTTVTVAGSNGHFELNVFKPVIIYNVLQSIRLLSDVSINFSHKCVQGIKADTNRISFLL
FT                   SQSLMLVTALNKHIGYDNAAKIAKTAFDEGITLKNAAVKLNLISEEEFDKIVNPENMIY
FT                   PTG"
FT   gene            368887..369201
FT                   /locus_tag="ECH_0377"
FT   CDS_pept        368887..369201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0377"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:T27606"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44541"
FT                   /db_xref="GOA:Q2GH86"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH86"
FT                   /protein_id="ABD44541.1"
FT                   /translation="MAEDDYKGVIKQYIDTVKEIVGDSKTFDQMFESVVRIQERVMAAN
FT                   AQNNEDGVIDNGDQVKRIGSSTSESISNTEYKELMEELKVIKKRILRLERKILKPKEEV
FT                   "
FT   gene            complement(369666..372896)
FT                   /gene="carB"
FT                   /locus_tag="ECH_0378"
FT   CDS_pept        complement(369666..372896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECH_0378"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by similarity to SP:P38100; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF02142; match to protein family HMM PF02786; match to
FT                   protein family HMM PF02787; match to protein family HMM
FT                   TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45171"
FT                   /db_xref="GOA:Q2GH85"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH85"
FT                   /protein_id="ABD45171.1"
FT                   /translation="MPKRTDIESILVIGAGPIVIGQACEFDYSGTQACKVLKQEGYRII
FT                   LINSNPATIMTDPEIADSTYIEPITSNIIEKIIIKERPSAILPTVGGQTALNAAINLCE
FT                   LGILEKYNVKLIGATKEAIKKAEDRNLFRQAMDKIGVKYPKSIIIRSVDEINDALEYIG
FT                   LPAIIRPSFTLGGIGGGISYNKEEFHKNVSHGLNISPISEVQVDESIIGWKEFEMEVMR
FT                   DNKDNCIVVCSIENLDPMGVHTGDSITVAPALTLRDVEYQKMRDISFSILREIGVDTGG
FT                   SNVQFAVNPKNDNDLLVIEMNPRVSRSSALASKATGYPIAKVAAKLAIGYSLDEIQNDC
FT                   TEVIPASFEPSIDYIVTKIPRFNFDKFRGTEKELSTSMKSVGEVMAIGRSFPESLQKAL
FT                   CSLEAGYSGLNEYFDQNIEIDQLYNSLVKLSPDRIFIIADALRHNISIEEINKITGYDP
FT                   WFLTQIKNIIQCEQQIQKNGLPKEAEGLLLLKKMGFSDIRLAYLSKTTVEYIEDLRKSL
FT                   SIKPVYKHIDTCAGEFKTNASYMYSCYEGNTINVTECESVVTNNKKVIILGSGPNRIGQ
FT                   GIEFDYTCVHAAHTIRQMGYESIMINCNPETVSTDYDISDKLYFSPLTRESVLDIIYKE
FT                   QETNSLLGVIVQFGGQTPLKLAKVLQEKNINILGTSFDSIDLAEDRMKFQQLLTQLNLK
FT                   QPSNITCNSIHEVYECIKDLVFPILARPSYVLGGQSMSIIRDSNALSNYLTTYKNIFDH
FT                   GSLLLDQFLTHAIEVDVDAICDGEKVYIAGIMEHIEEAGVHSGDSACSLPSYSLTSEIT
FT                   DAIAEQTKKIALALQVRGFINIQYAIQDGEIYILEVNPRASRTVPFIAKATGIPIAKIA
FT                   TEVLLGKKLPNALEEKLTHVAVKEAVFSFSRFPNIDVLLGPEMKSTGEVMGIDKSFEIA
FT                   FAKAQMAAGYELPTKGTAFISVKNSDKPLIVKTAQILKDIGFTIFSTKGTSTYLNEAGI
FT                   TTEHVNKVREGRPHILDLLQDDKINLVINTSEGIKSFSESSSIRKTALIKKIPYSTTIP
FT                   GARALALAIKTLKKQGIHVESMQEYTKK"
FT   gene            373782..374837
FT                   /locus_tag="ECH_0379"
FT   CDS_pept        373782..374837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44646"
FT                   /db_xref="GOA:Q2GH84"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH84"
FT                   /protein_id="ABD44646.1"
FT                   /translation="MIIKFGVENLIDSAVEIVCKYFDIYQRNDAVKHVLHKCIKSLRTV
FT                   EKKLKIYRGKEAKGHVISDSQFAEMEDLIKKVLMKVFEIDISYQKQHLSAEKMEEYKVA
FT                   VSLLLDQIVRCKSYALKESDILPKVVGNATLKRSAYKCKHVVDFINKNRFLPMNMGRFD
FT                   KLCFDLDLDPQILKQVIDLCSFALIFEILDLKLVQFLVEMRFFPHQNTNVISITKDNYI
FT                   ELMQHIMLYKCSQSIGKEYTNEQARYLPCFSPGYTRGNVKGNSFICLGIALFIAQALFN
FT                   GFGLLFMLLSEFKTQNDWWFIGICVVNMLLAVTALTLICIGKKQLSQNHDTLLTDIDVS
FT                   GINIVEESVDL"
FT   gene            375004..375198
FT                   /locus_tag="ECH_0380"
FT   CDS_pept        375004..375198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45275"
FT                   /db_xref="GOA:Q2GH83"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH83"
FT                   /protein_id="ABD45275.1"
FT                   /translation="MCSVSIACRYVYKISECFFSITASNRCVGFYKSTFDVILLNLLWK
FT                   FLLSIKNHVCLFTSLFNSK"
FT   gene            complement(375330..376172)
FT                   /gene="folP"
FT                   /locus_tag="ECH_0381"
FT   CDS_pept        complement(375330..376172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="ECH_0381"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45009"
FT                   /db_xref="GOA:Q2GH82"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH82"
FT                   /protein_id="ABD45009.1"
FT                   /translation="MKFNTKLVGILNYTPDSFSDGGQFFSIDKALQQVKHLINGGADII
FT                   DVGGESTRPTYLYTQHGNNTISQTEEWDRLKYILPKIIEIAHNHNVQVSIDTRYAKTAE
FT                   KAIELNVDYVNDVSTLSDKNMLQVLQNSSVNVVITHSLGIPLIKNNTIPKNLDPINEII
FT                   IWAKKYIDKLTNAGIDKNRIIIDPGIGFSKTANQTFYILNNIDRLKVLNQKIYVGHSRK
FT                   FFLTSYTSNDPTRDNATLAISIFLFQQGIDFIRVHNTHLHSEAFNLLRKMHQTHLNNI"
FT   gene            complement(376178..376369)
FT                   /locus_tag="ECH_0382"
FT   CDS_pept        complement(376178..376369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D97734"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45502"
FT                   /db_xref="GOA:Q2GH81"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH81"
FT                   /protein_id="ABD45502.1"
FT                   /translation="MFSNTTSLIVISVFVSLTLISLISGVVLMAISNEFYIKHRNKIMI
FT                   IRVLLQFISLILIALFFR"
FT   gene            376528..378300
FT                   /locus_tag="ECH_0383"
FT   CDS_pept        376528..378300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0383"
FT                   /product="type I secretion system ATPase"
FT                   /note="identified by similarity to GB:AAD09853.1; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01842"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45197"
FT                   /db_xref="GOA:Q2GH80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH80"
FT                   /protein_id="ABD45197.1"
FT                   /translation="MEGVNFNFQTMKELKQSVLYTSLEKCKSVFWFIFWFSSAINLLML
FT                   FLPLYTSQVLDRVLSSGSVSTLIMLSVITVGAFACSSILEICRSLVMAKVGDWIDKVVT
FT                   PDLIMKSISLTSVKSSTSSGEVLRDLAVVKNFITGFGIFSLFDTPWAVLYLVTIFMIHS
FT                   VTGYIAVVGIVLLTGMAIWNELATKKILQEASEEGVRNIHSIDVATRNAEVVEAMGMVN
FT                   YIVDDWADRNDRNREMQIKAQNRSNLISGITKFIRSILQISVIGIGGFLAILGHKTAGG
FT                   IIASSILMGRALAPFEALINTWKMLISARISYKRLQILLLASPKREQSMSLPAPSGRVV
FT                   FDRVFFTPYGSNKPTIKGVSFSMEVGDIVGVIGHSASGKSTIAKLLVGVWKPISGVVRL
FT                   DGADVYTWNREDFGRYIGYLPQDVELFNASVKVNIARMMPDPDPNEVVKAAKIAGVHEL
FT                   ILSLPNGYDTVIGSNGVVLSGGQKQMLGLARAFYGNVKLLVLDEPNANLDGKSEANLIN
FT                   ALLYARKNGITTFIMTHKIQLLNAVDKVIVMADGMVSGVGARDEILSKVVPNYTPSNSQ
FT                   PKQQTKPLVESENT"
FT   gene            complement(378559..378699)
FT                   /locus_tag="ECH_0384"
FT   CDS_pept        complement(378559..378699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44818"
FT                   /db_xref="GOA:Q2GH77"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH77"
FT                   /protein_id="ABD44818.1"
FT                   /translation="MMFFVLGQYIVCTGFVIAYDYRNSKKFKLVLVYIKINMHCYINLY
FT                   W"
FT   gene            379241..380215
FT                   /gene="qor"
FT                   /locus_tag="ECH_0385"
FT   CDS_pept        379241..380215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="ECH_0385"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by similarity to SP:P28304; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45301"
FT                   /db_xref="GOA:Q2GH78"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH78"
FT                   /protein_id="ABD45301.1"
FT                   /translation="MVKVIIIDKTGSAEVLKYVNHNIGEPKDDEVLIKHTAIGLNRYDL
FT                   ECRNGMRKNKKLPAVLGVEAVGVIERLGKDVEVFNIGDRVGYCTVSGGAYSEKRLIKQK
FT                   YLVRIPDDITDQVAAAVLFKGMTAHYLTHLVYAIRPNTFALVHGATGGVGQILCQWASY
FT                   KGCKVIGVISSDDRANIALRAGCSYVVNNNSKNFVEQIMEITHGSGVNVVYDCIGDLAS
FT                   KVSFESLCMFGIYVSYGQISGPISNVSASMLSSRSLFFTSPLVFHYKRSSFDLAMTAME
FT                   LFEVIRRNYIKVGINKIYKFGDIVTAHQDLENRKLTGSNIIEL"
FT   gene            380459..380599
FT                   /locus_tag="ECH_0386"
FT   CDS_pept        380459..380599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44666"
FT                   /db_xref="GOA:Q2GH77"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH77"
FT                   /protein_id="ABD44666.1"
FT                   /translation="MMFFVLGQYIVCTGFVIAYDYRNSKKFKLVLVYIKINMHCYINLY
FT                   W"
FT   gene            complement(380640..383222)
FT                   /locus_tag="ECH_0387"
FT   CDS_pept        complement(380640..383222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0387"
FT                   /product="ATP-dependent DNA helicase, UvrD/Rep family"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45149"
FT                   /db_xref="GOA:Q2GH76"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH76"
FT                   /protein_id="ABD45149.1"
FT                   /translation="MNNIATNPFYSFIWISASAGTGKTKILVNRVLRLLVTGHKNILCL
FT                   TFTNTAAHEMTERIHSIISTWAILKNEELKKALKDIIPTNITPKEYKRARELFNNLQNV
FT                   SLSIKTIHSFCYQLISTFPIETGIAPDCSIKDFSESFTKIFHKLLHDPTTKHHLSAISH
FT                   EITEATIYDLLYKLLNKQHYNFNQNSIYKKLNINNINNTETYQLFPTDNNTLNHLTKIL
FT                   SEGSIRDKKISENLVKWSNLSQKYKLQKLNKYVKIFINLPSLEKKSISSIITKKTLTNS
FT                   PEIEKIVSDIQEEILNFIKTFHTNKIAERTIHLIEIAKCFTKLYQQDKQKLNYLDHNDI
FT                   IDLALNLLKNPTYKDWILFHLDSKIDHILIDESQDNSIKQWSIILQLCHEFFSGIGTTE
FT                   ELRTLFIVGDIKQSIYGFQNARPDYFNPMCHYFTQQSTQYKHKVLHLTQSFRSTPPILK
FT                   LVDKVFNNFCQEISFSTTKIEHEIFRKNDPGYVEIWPIIDIKNNKNFSLDFENRTDLDT
FT                   NLLLASTIANKIHSWIINKRILLAKNRPITAGDFLILVRHRTCFIDHVITSLKKLDIPT
FT                   LERDKFKIMDYTIIQDLVNLGEFLLLPENDLALTGLLKSPIFEFNEKQIFDLAYNRNNT
FT                   YLWEELQSKFSTISNYLKQLISVSQLHSPLNLYHHIISEHKHKFTKRLGQSNTKIIGEF
FT                   INLLIQCESHNINSLQAFIHWIKNTNPEIKSDINLTKDYVKIMTVHNAKGMQSPIVFLS
FT                   DTTTIPKSDTQLVFDEEYTPFWIRNDINDFCENLKSQQKTNEYNEYLRLLYVAMTRAED
FT                   ELYITGISPIQNKSWYSIIRNTDYTCKKKFIDLQPMIQEKAEVLYLDE"
FT   gene            383327..384208
FT                   /locus_tag="ECH_0388"
FT   CDS_pept        383327..384208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44942"
FT                   /db_xref="GOA:Q2GH75"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH75"
FT                   /protein_id="ABD44942.1"
FT                   /translation="MKRLFLFVMIISFINATVGFARSLRADGNVYTAGIGDVDEDESSD
FT                   NGEQYDEDGEYDLDDIYYEDEIIDIQENVDDAIYTARMEDIEDSYEEEFLDDDEQYDLD
FT                   DIYYEDEIIDIQENVDGAIYTARMEDIEDSYEEEFLDDDEQYDLDDIYYEDEIIDIQEN
FT                   VDGAIYTARMEDIEDSYEEEFSDEDEQYDDNEQYDPDEEEEDYDDILYEEDDYGQVDGD
FT                   ELLDDESLDEGKNVFLEEYDVPQYGQDVADQNQEVDDKTLLKSGNAKDQQLKAPDKNAT
FT                   NETDGKKKLLKY"
FT   gene            384235..384657
FT                   /locus_tag="ECH_0389"
FT   CDS_pept        384235..384657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0389"
FT                   /product="ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45571"
FT                   /db_xref="GOA:Q2GH74"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH74"
FT                   /protein_id="ABD45571.1"
FT                   /translation="MEKSNVSYKWPFTRNVIEEIERSKYDEMNEHLPKIYTVEDYYIQI
FT                   FYCIMQSDVSGLRSLINKLQELGVSLSTILYEVRTLDVGDNLLTYAVKQKKLDIVRFLL
FT                   SIGANSNVANYNNETPLSISIENGSMDIAHAILVAQ"
FT   gene            384907..385764
FT                   /locus_tag="ECH_0390"
FT   CDS_pept        384907..385764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0390"
FT                   /product="SPFH domain /band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45004"
FT                   /db_xref="GOA:Q2GH73"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH73"
FT                   /protein_id="ABD45004.1"
FT                   /translation="MNSKEFCDKKLVHINGFSMIFWCIVFILLLLSGIYYGNFFIVLPM
FT                   SLVSLICTFIIPSGFFVNNPNEAKVVEFFGNYIGTIFKSGFFWTIPFVRMRSISLKVRN
FT                   VNTSKIKVNDFNGNPIEIAAVVVWRVVSPAKACLNVSDYQEFINIQNEAAVRELAGSYP
FT                   YDAEDNSESLRNNSTKISSKLRDMLQNRLDLVGVIVEDARISHLAYSSEIAQIMLRRQQ
FT                   AKAITNARGYIVRNAIIMVDEILKHFELQYQINLSDEQKVKLVNNLLVSLISEQGTQPT
FT                   INIE"
FT   gene            386191..386529
FT                   /locus_tag="ECH_0391"
FT   CDS_pept        386191..386529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14513.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44601"
FT                   /db_xref="GOA:Q2GH72"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH72"
FT                   /protein_id="ABD44601.1"
FT                   /translation="MNYDTLNFYEYYDTCDVDCADYVCSNGVLEEHISYQSMWKAVILQ
FT                   AIIDSTSNYRRMENKLEKIKATNWLNDFSRDFITVCHFAGYNPLSVRNKAKRIISDNKI
FT                   LNEDKIRG"
FT   gene            387085..388140
FT                   /locus_tag="ECH_0392"
FT   CDS_pept        387085..388140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0392"
FT                   /product="ATPase, AFG1 family"
FT                   /note="identified by match to protein family HMM PF03969"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45471"
FT                   /db_xref="GOA:Q2GH71"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH71"
FT                   /protein_id="ABD45471.1"
FT                   /translation="MKEIFDHYYSMVDSGKITYDEQQVKLLNELTPYLSVEKICCFLPI
FT                   KKRLQKVGVYIYGEVGRGKSMITDIYYNACKIERKKRQHFNQFMKTVHTLLHEFKSSRV
FT                   KDPLHKVAKTMVHGVDLLCLDEIQVYDICDAMILGRLFSIIFDQKVIVMMTSNYAPVDL
FT                   YQDGIQRQSFESTISLIIERMCVVHLSGKQDYRAIKDLGISDIYFIGDDSYIKLSQLFF
FT                   EMANGRRVEPVTLHVCRRNIKVNKTFDNVAWFDFDELCGKALWVSDYQEIVRNFSVIFI
FT                   ANIPVFNHYNQNEMRRFTILIDELYENKVKIFCSLAVEPKLLYYLQEVPVDFQRTISRL
FT                   MEMRSPSYYNI"
FT   gene            388321..388512
FT                   /locus_tag="ECH_0393"
FT   CDS_pept        388321..388512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0393"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44869"
FT                   /db_xref="GOA:Q2GH70"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH70"
FT                   /protein_id="ABD44869.1"
FT                   /translation="MDFVMSLYIVSFKHLIMMVTAVIFCITLVFVYNLLTRSNVKLQNT
FT                   FYIEQSIYFLMCLCVHFF"
FT   gene            388891..389019
FT                   /locus_tag="ECH_0394"
FT   CDS_pept        388891..389019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44782"
FT                   /db_xref="GOA:Q2GH69"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH69"
FT                   /protein_id="ABD44782.1"
FT                   /translation="MLTRSNVKLQNTFYIEQSICFVMVCVHISCKNLIVMVTTVIF"
FT   gene            complement(389052..390083)
FT                   /gene="hemH"
FT                   /locus_tag="ECH_0395"
FT   CDS_pept        complement(389052..390083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="ECH_0395"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by similarity to SP:P54225; match to
FT                   protein family HMM PF00762; match to protein family HMM
FT                   TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45161"
FT                   /db_xref="GOA:Q2GH68"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH68"
FT                   /protein_id="ABD45161.1"
FT                   /translation="MNKQYVSKKVAVVLFNLGGPQSLCEVRPFLFNLFYDKNIINISNP
FT                   LRFILATLLSFFRKRKAIEIYKHLNGQSPILSETKIQASSLEHILNNHNENQYKVFIFM
FT                   RHSKPSAKSTIKSVCQYRPDKIILIPLYPHYSTTTTLSAIQHWNYHMKKSRFHCPTSTI
FT                   CCYYNNENYIKAHCQLIIEKYREAQNYGSPRILFSAHSLPLSIVQRGDPYQHQIEQTVL
FT                   LITKSLNISSLDYKICYQSKVGNIKWLEPSTISAINQAKQDDVPIVLVPISFVSENSET
FT                   LVELDIECKKIISKENMFFRVPTLSNNEYYIKCLQEMCTQAHHKNTCPVQCKMCFETLH
FT                   YSS"
FT   gene            complement(390149..390856)
FT                   /locus_tag="ECH_0396"
FT   CDS_pept        complement(390149..390856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45530"
FT                   /db_xref="GOA:Q2GH67"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH67"
FT                   /protein_id="ABD45530.1"
FT                   /translation="MLSCMYYLMIMICLTLRILSIRKDCCGPIKHPIYRNPNLHNNDFI
FT                   NFKRPGSINKLEGSFVESTNIAACTIKTILFSMLMTPLIGIKAAAEFILCIIEILELPF
FT                   SFLLDLCILLYNTLTHSQMEKKFSHSKANLENIASLLYAGSRDLIVTCSFGILNAKIIK
FT                   QEDGTSKSPISYLDELLTITSKQPRCRSVSTLLRRSSDSSEHEGLLETTNESSVNLFVE
FT                   QPVSQSTSSSQHK"
FT   gene            complement(390829..391182)
FT                   /locus_tag="ECH_0397"
FT   CDS_pept        complement(390829..391182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14830.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44493"
FT                   /db_xref="GOA:Q2GH66"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH66"
FT                   /protein_id="ABD44493.1"
FT                   /translation="MHTAKLNFSNFHIKLKNSLFCGLKGWTTFNLAAISLLEMSLYEMH
FT                   YSKHMTNFQRTVVTDNKENAKHQIRKHLIPFFEAMLVMPTLFLATHYFGNKIFPTLNPL
FT                   QMHLICLAACIIL"
FT   gene            complement(391397..391762)
FT                   /locus_tag="ECH_0398"
FT   CDS_pept        complement(391397..391762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14743.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45535"
FT                   /db_xref="GOA:Q2GH65"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH65"
FT                   /protein_id="ABD45535.1"
FT                   /translation="MNNSNPQVIEITVRNNTYRVACNKTEEPHLRNLVDKFNALVNSIS
FT                   SAEKGKGSDALIFLLAGLTLEDEKHELKTQLKKTKDEMLTYKKYFDDYLKIKNEVSNIL
FT                   SHTLLRIEKLIHNLEKS"
FT   gene            complement(391763..392041)
FT                   /locus_tag="ECH_0399"
FT   CDS_pept        complement(391763..392041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50572.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45282"
FT                   /db_xref="GOA:Q2GH64"
FT                   /db_xref="InterPro:IPR025310"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH64"
FT                   /protein_id="ABD45282.1"
FT                   /translation="MNQINNNSEFQQNLDKAFDRLESLLIQKLNNKNNISQYKATIELL
FT                   TEEKNKLDQQLTNKTNECNSWKEICHETIHRLNSTIENIKAILKRSK"
FT   gene            complement(392086..392349)
FT                   /gene="ihfB"
FT                   /locus_tag="ECH_0400"
FT   CDS_pept        complement(392086..392349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="ECH_0400"
FT                   /product="integration host factor, beta subunit"
FT                   /note="identified by similarity to SP:Q06607; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45350"
FT                   /db_xref="GOA:Q2GH63"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH63"
FT                   /protein_id="ABD45350.1"
FT                   /translation="MLKSHLIQHISKKNPSLSEEIVSKILNIFFSLIVDYLKNDCRVEL
FT                   RGFGSFTVRSYNIKTANARLAKSKYKKVYFRASSKFIKIINQ"
FT   gene            complement(392355..393221)
FT                   /gene="sppA"
FT                   /locus_tag="ECH_0401"
FT   CDS_pept        complement(392355..393221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="ECH_0401"
FT                   /product="signal peptide peptidase SppA"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01343;
FT                   match to protein family HMM TIGR00706"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45325"
FT                   /db_xref="GOA:Q2GH62"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH62"
FT                   /protein_id="ABD45325.1"
FT                   /translation="MSDQLLKIEVLNSKVKLWRVFAFFMIFVLLMLVNYIDISKISSFL
FT                   DNEYIAKVNIEGKIETNEEMDALLKKIAEDNHVTGLILNINSPGGSVTGSEILYQNIRN
FT                   VSKNKPVVALLNDFAASGGYMTAIAADYIIARHTTITGSIGVLMQYIGINPLAEKMGIS
FT                   LKSIKSSNLKAETSPFEELTEEKEESIRRIIKNSYDYFVDIVADRRKMEKDQVLKIANG
FT                   SIYTGSEALSIGLVDQIGGQDEAMNWFHSQNISTQKVKVLSKKKHKSIIENVSSFISQV
FT                   VHYYINK"
FT   gene            complement(393235..394938)
FT                   /locus_tag="ECH_0402"
FT   CDS_pept        complement(393235..394938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0402"
FT                   /product="putative ribosomal protein S1"
FT                   /note="identified by similarity to SP:P02349; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44532"
FT                   /db_xref="GOA:Q2GH61"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH61"
FT                   /protein_id="ABD44532.1"
FT                   /translation="MEDLQTKTNLGSENYLHNIKKIKSNKFISHNLEVEDSDNDSSSEF
FT                   QHALKEFIDDSVKEGQIIEGTIICIDKGYVTIDSGLKSESIVSLKEFELGDDYQNISIG
FT                   SKVKLYLEKIEGRNGSVVLSREKAIRDELWQKLEEAAEKKEDVEGVIFSSIKCGYTVDI
FT                   KGVVAFLPASHVALRQVKDITPLLGKKQKFRILKMDKKQGNIVVSRKAILEESLADAKS
FT                   LYLSQLNEGDIIEGKVKSITKYGVFIEIHESPSVGVVDGLLHITDISWSRVSHPSAVFS
FT                   CGQTVKTKIIKIDRENKKISLGVKQLEESPWSNIEKKYPVDSIHKGIVTSIEEYGVFVE
FT                   LETGIEGLVHVSEVSWTKNSLPINQLFMRGEEIQVKVLSIDTAKSRMSLSMKRCQDNPW
FT                   QAFTLKYPLGSIVSTKIKNITNLGIFVSFQDNTLNDGIEGLIRTTELSWSLSPEAAIKK
FT                   YNVGDSVEAKILMINPNKSKIDLGVKQLEYDPFLDLLKKINLGDKIPVTVTKVVEDTGI
FT                   LVDVFNGSNSFNLLIEQEYLPDNKKFFPGDRLEAEVLLIETYNMILSLKH"
FT   gene            complement(395004..395645)
FT                   /gene="cmk"
FT                   /locus_tag="ECH_0403"
FT   CDS_pept        complement(395004..395645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="ECH_0403"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45120"
FT                   /db_xref="GOA:Q2GH60"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH60"
FT                   /protein_id="ABD45120.1"
FT                   /translation="MTKHCNNFVITIDGPSASGKGSLAKKLANFLNFQYLDTGKLYRII
FT                   ATIFGTSAQNHLKIDNKLEDKILSLLLEDNNTIYNNEDIGKTASILARYQHIRLALLPI
FT                   QRKLIHLAEPGIILDGRDTSSTVFPEADLKIFITAQASIRAQRRFKEMLYHKKEMYKKI
FT                   HKQILERDIRDTYRKFSPLVKVKDALYINTSYMNKEQVLLYIKEKIKTYL"
FT   gene            complement(395626..396384)
FT                   /locus_tag="ECH_0404"
FT   CDS_pept        complement(395626..396384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0404"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45495"
FT                   /db_xref="GOA:Q2GH59"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH59"
FT                   /protein_id="ABD45495.1"
FT                   /translation="MDKNKIWIYGKHPCTAALQNKNRKCHELLVTENFMKNNNEISKIL
FT                   RLCKQKNINLKQVNPNYINSVLPHNSNHQGIALKASVIDSTTVEEVLNTSKESSTIILL
FT                   DQVTDIHNVGSIIRSAVCFNVDAIILPYHNSPSENCGMSKTSSGAVDMIPIVYVINIVN
FT                   TIKLLKKAGYWCYGFDAKEGEFLHKTKLDSKKLIIFGSEDKGMRKLTKENCDFLLKIAI
FT                   SKKIDSLNVSNAAAVALYSIFIQNYDQALQ"
FT   gene            396544..396626
FT                   /locus_tag="ECH_0405"
FT   tRNA            396544..396626
FT                   /locus_tag="ECH_0405"
FT                   /product="tRNA-Tyr"
FT   gene            396638..396708
FT                   /locus_tag="ECH_0406"
FT   tRNA            396638..396708
FT                   /locus_tag="ECH_0406"
FT                   /product="tRNA-Gly"
FT   gene            396752..397939
FT                   /gene="tuf-2"
FT                   /locus_tag="ECH_0407"
FT   CDS_pept        396752..397939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf-2"
FT                   /locus_tag="ECH_0407"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by similarity to SP:P48864; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03143; match to protein family HMM PF03144; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45144"
FT                   /db_xref="GOA:Q2GFN6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GFN6"
FT                   /protein_id="ABD45144.1"
FT                   /translation="MVEERKPHINVGTIGHVDHGKTTLTAALTTVLAKRLSGEGNKSVK
FT                   YDEIDKAPEEKARGITISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDAAILV
FT                   VSATDGAMPQTREHILLAKQVGVKDIVVWMNKCDVVDDEEMLSLVEMEIRELLSKYGYP
FT                   GDDIDVVRGSAVKALEEETGSGVWSEKIMELMNALEKISLPTREKDKPFLMSIEDVFSI
FT                   PGRGTVVTGRIERGVIRVGDKIEIVGLRDIQSTVCTGVEMFHKALDAGEAGDNAGILLR
FT                   GIKKEDVERGQVLSAPGQIHSYKKFKAEVYILKKEEGGRHTPFFSNYQPQFYVRTTDVT
FT                   GSIKLPEGVEMVMPGDNISIEVSLDKPVAIDKGLRFAIREGGRTVGSGIITEILE"
FT   gene            397947..398273
FT                   /gene="rpsJ"
FT                   /locus_tag="ECH_0408"
FT   CDS_pept        397947..398273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="ECH_0408"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44817"
FT                   /db_xref="GOA:Q2GH57"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH57"
FT                   /protein_id="ABD44817.1"
FT                   /translation="MVTQKIYIELKAFDSCLLDRSARSIILTAKRSGARVNGPIFFPRK
FT                   IMKFIVNRSTHVDKKSREQFEIRTHKRLISLPKANSTIIQALMSLQLPAGVDVKVKVIG
FT                   GSNG"
FT   gene            398266..398961
FT                   /gene="rplC"
FT                   /locus_tag="ECH_0409"
FT   CDS_pept        398266..398961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="ECH_0409"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by similarity to SP:P02386; match to
FT                   protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45271"
FT                   /db_xref="GOA:Q2GH56"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH56"
FT                   /protein_id="ABD45271.1"
FT                   /translation="MAKRIGLFLEKVGHTAIFDNEGKRIPITLLHLRDSFIISKKTKDI
FT                   HGYDAVVLGVEASINLKKPQSKILEKSKITAKCKIFESRVDNLGDVVEGAKVSITHFVK
FT                   DQYVDITGYSLGKGFAGVMKRHNFKGLKASHGVSIAHRSQGSTGQCQDPGRVYKGKKMA
FT                   GQLGNSKVTVQNLKVILVDQERSLLGVRGNNIPGAKGSYVFVKDAVKKSVPKGSFPICA
FT                   EDLKLDNVV"
FT   gene            398969..399586
FT                   /gene="rplD"
FT                   /locus_tag="ECH_0410"
FT   CDS_pept        398969..399586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="ECH_0410"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by similarity to SP:P28601; match to
FT                   protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44638"
FT                   /db_xref="GOA:Q2GH55"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH55"
FT                   /protein_id="ABD44638.1"
FT                   /translation="MEVNIINVNSDRIGTIDLNPLIFSVNYRPDILKMVVDWQLSKRRA
FT                   GTHKAKTIGDISGTTAKPHRQKHTGRARQGSLRSPQFRGGAVIFGPVVRSHAYSLNKKV
FT                   RNLGLKVALSLKNSCNKLLILDSIDVNFVKTTQVLQFIKNFEHKSFLIIDKDYNKSVVC
FT                   SCRNLHNVTLLKQIGTNVLDILRHDCIILTVGAVKYLEERLL"
FT   gene            399583..399873
FT                   /gene="rplW"
FT                   /locus_tag="ECH_0411"
FT   CDS_pept        399583..399873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="ECH_0411"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by similarity to SP:P42924; match to
FT                   protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44649"
FT                   /db_xref="GOA:Q2GH54"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH54"
FT                   /protein_id="ABD44649.1"
FT                   /translation="MINYFNVIQSSIITEKAVLLNEKFNKYAVYVSVDADKQRIKKALK
FT                   VVFGLDVIRINILNQKGKKKYFKGVFGRRKNRKKVYFSLPKDQNFKYMGMK"
FT   gene            399881..400711
FT                   /gene="rplB"
FT                   /locus_tag="ECH_0412"
FT   CDS_pept        399881..400711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="ECH_0412"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:Q9Z9L1; match to
FT                   protein family HMM PF00181; match to protein family HMM
FT                   PF03947; match to protein family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45428"
FT                   /db_xref="GOA:Q2GH53"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH53"
FT                   /protein_id="ABD45428.1"
FT                   /translation="MGIKNLNSVTASLRGTVLLDKSMLWKGKPEKSLVSYKISRGGRNS
FT                   RGVITVRHRGRGHKRLYRVVDFKRNKVGVSATVERLEYDPNRTAFIALLSYDDGEKSYI
FT                   IAPNGLKKGDVVISGDGADILPGNCLLLKSIPVGTFVHNVELRPGNGGVIARSAGTYAQ
FT                   LMSKDGMYVLLRLSSGEIRKVLSDCRATIGIVSNLDNQNVKLGKAGRSRWLGIRPTVRG
FT                   VAMNPIDHPHGGGEGKTSGGRNPVTPWGVPTKGKKTRKRNKSSNKYIKRVSDKG"
FT   gene            400715..400996
FT                   /gene="rpsS"
FT                   /locus_tag="ECH_0413"
FT   CDS_pept        400715..400996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="ECH_0413"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45231"
FT                   /db_xref="GOA:Q2GH52"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH52"
FT                   /protein_id="ABD45231.1"
FT                   /translation="MSRSIKKPPFCAPHVLRLVNKAIAQNKLNSIINIHSRSSVILNKF
FT                   IGLTFGVYNGKTYVPVKVNDNMVGRKFGEFSPTRRYTGHVGDKKVSRK"
FT   gene            401023..401355
FT                   /gene="rplV"
FT                   /locus_tag="ECH_0414"
FT   CDS_pept        401023..401355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="ECH_0414"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by similarity to SP:P02423; match to
FT                   protein family HMM PF00237; match to protein family HMM
FT                   TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44591"
FT                   /db_xref="GOA:Q2GH51"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH51"
FT                   /protein_id="ABD44591.1"
FT                   /translation="MIVAKGMGLKSTPSKLNLVADLIRGKDVSVAMMYLKFCRKKSAGY
FT                   ISKVLKSAVANAQANYNIDLDNLYVKEVLVGKSFSLRRIHARARGKACRVYKHYGNVII
FT                   KLFERI"
FT   gene            401359..401994
FT                   /gene="rpsC"
FT                   /locus_tag="ECH_0415"
FT   CDS_pept        401359..401994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="ECH_0415"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to SP:P02352; match to
FT                   protein family HMM PF00189; match to protein family HMM
FT                   PF00417; match to protein family HMM PF07650; match to
FT                   protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45551"
FT                   /db_xref="GOA:Q2GH50"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH50"
FT                   /protein_id="ABD45551.1"
FT                   /translation="MGQKSNPIGLRLKIINTWDSLWYANKDYTTKLHEDFLLRKFIKKA
FT                   FYHASISKVVIARKVDVIMVNVYSAKPGVIIGKKGADIDKVKQQIVKMINNNIELNIIE
FT                   VKKPELKAVLIAENIAQQLEKRISFRRAMKRSVQSCLKIGAKGIKVSCAGRLGGAEIAR
FT                   TEWYKEGSVPLHTFRANIDYGFSEAKTIYGIIGVKVWVYLGDTKSSNE"
FT   gene            402011..402421
FT                   /gene="rplP"
FT                   /locus_tag="ECH_0416"
FT   CDS_pept        402011..402421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="ECH_0416"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by similarity to SP:Q9Z9K7; match to
FT                   protein family HMM PF00252; match to protein family HMM
FT                   TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44939"
FT                   /db_xref="GOA:Q2GH49"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH49"
FT                   /protein_id="ABD44939.1"
FT                   /translation="MFIPKKTKYKKDFKGRISGNAKGGYTLSFGSHGLKALEPSRLTSK
FT                   QIESARRSISRTLKRVGKVWIRAFCHTSVSKKPMDVRMGKGKGSVEMWVCKVKPGKILF
FT                   EIGGVPLNLAREALNKAQAKLPMKCKFVSDEL"
FT   gene            402434..402637
FT                   /gene="rpmC"
FT                   /locus_tag="ECH_0417"
FT   CDS_pept        402434..402637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="ECH_0417"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to SP:P02429; match to
FT                   protein family HMM PF00831; match to protein family HMM
FT                   TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44957"
FT                   /db_xref="GOA:Q2GH48"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH48"
FT                   /protein_id="ABD44957.1"
FT                   /translation="MDIVDIRSKSNDELRELLVNLGKELVNAVLNRKVDKSTNHFYCRN
FT                   IKKDIARVLTVLNERRKEEKHV"
FT   gene            402630..402857
FT                   /gene="rpsQ"
FT                   /locus_tag="ECH_0418"
FT   CDS_pept        402630..402857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="ECH_0418"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by similarity to SP:P23828; match to
FT                   protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45445"
FT                   /db_xref="GOA:Q2GH47"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH47"
FT                   /protein_id="ABD45445.1"
FT                   /translation="MSNKKVLTGIVVDAKCDKTIKVMVSRMIMHKTYKKIVKKRKNYVV
FT                   HDEHNQYKCGDVVKIQEHIPISATKRWIVI"
FT   gene            402871..403230
FT                   /gene="rplN"
FT                   /locus_tag="ECH_0419"
FT   CDS_pept        402871..403230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="ECH_0419"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by similarity to SP:P02411; match to
FT                   protein family HMM PF00238; match to protein family HMM
FT                   TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44826"
FT                   /db_xref="GOA:Q2GH46"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH46"
FT                   /protein_id="ABD44826.1"
FT                   /translation="MIQKNTLLDVADNSGARKVLCIGLLNGKKSASVGDVIVVSTKLIT
FT                   PRGKVSKGKVYKAVIVRVKKAVRRLDGSVIKFSSNAVVLINDQGDPLGTRVFGPIKKLP
FT                   FGLFSKVMSLAVEVL"
FT   gene            403232..403561
FT                   /gene="rplX"
FT                   /locus_tag="ECH_0420"
FT   CDS_pept        403232..403561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="ECH_0420"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44748"
FT                   /db_xref="GOA:Q2GH45"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH45"
FT                   /protein_id="ABD44748.1"
FT                   /translation="MGMKIIAGDDVIVISGKDKGKMGKVIKVLKKKHCGKDVSFAIVSG
FT                   VNVCRKSVKATQKSDGGIISVEKPINLSNIALFDSTLGIQTRVGYKFIGEKKVRFMKSS
FT                   GKVIE"
FT   gene            403573..404106
FT                   /gene="rplE"
FT                   /locus_tag="ECH_0421"
FT   CDS_pept        403573..404106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="ECH_0421"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P02389; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44606"
FT                   /db_xref="GOA:Q2GH44"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH44"
FT                   /protein_id="ABD44606.1"
FT                   /translation="MLKDLYKSHIVPSLKTKLGYSNVMQVPKIVKVCLNIGLGIRGSDS
FT                   KVMNSCVRDLALIAGQKPVATYAKKSIAGFKIRKGFPIGCKVTLRNNKMYEFLERLIHV
FT                   VLPREQDFKGLSVSQFDGCGNLSIGIKEHISFLEIDYDKIDKILGVDINIVTNAVNNND
FT                   AKLLLMEFGFPFIN"
FT   gene            404115..404420
FT                   /gene="rpsN"
FT                   /locus_tag="ECH_0422"
FT   CDS_pept        404115..404420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="ECH_0422"
FT                   /product="ribosomal protein S14p"
FT                   /note="identified by similarity to SP:P02370; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45209"
FT                   /db_xref="GOA:Q2GH43"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH43"
FT                   /protein_id="ABD45209.1"
FT                   /translation="MSRKSVIQRNLKRISICNRLKNKREELKAIIKDQSISMNDRFLAQ
FT                   VKLSKLPRDSSYIRIRNRCLITGRPRGCYRKFKVSRIVLRQLGSIGQIPGLTKSSW"
FT   gene            404442..404840
FT                   /gene="rpsH"
FT                   /locus_tag="ECH_0423"
FT   CDS_pept        404442..404840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="ECH_0423"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44671"
FT                   /db_xref="GOA:Q2GH42"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH42"
FT                   /protein_id="ABD44671.1"
FT                   /translation="MSLSDPIANFLTSIRNGQLSMNKVIVVSYSYVIHAILQILLSEGY
FT                   IDGFTEKSKGSNIKFFEVKLKYYNGAPVISQIARISKPGKRCYCSAKDMPKFYNGLGLY
FT                   IISTSKGIMSDYNARKSGVGGEILCGVF"
FT   gene            404852..405388
FT                   /gene="rplF"
FT                   /locus_tag="ECH_0424"
FT   CDS_pept        404852..405388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="ECH_0424"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by similarity to SP:P04448; match to
FT                   protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45418"
FT                   /db_xref="GOA:Q2GH41"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH41"
FT                   /protein_id="ABD45418.1"
FT                   /translation="MSRVGSMPIAIPSNVQADLVGNQLILKNNENSLKLTLDYGVLCDI
FT                   TDGKIVLHVNDKSIKSRVMWGTYRSIINNYAIGLSQGLVVELEVNGVGYKAEVNGEYLS
FT                   LSLGFSHGVKYKIPTGIVIQCVKPTQILVKGFDKQKVYMVASDICSIRKYNPYKGKGIS
FT                   IKGRYVHRKEVNKKK"
FT   gene            405410..405775
FT                   /gene="rplR"
FT                   /locus_tag="ECH_0425"
FT   CDS_pept        405410..405775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="ECH_0425"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by similarity to SP:P09415; match to
FT                   protein family HMM PF00861"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44549"
FT                   /db_xref="GOA:Q2GH40"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH40"
FT                   /protein_id="ABD44549.1"
FT                   /translation="MVYNCGTRLERRKKRVRLKLKRNSSLLRLSIFKSNRHFYVQLIDD
FT                   KCGRTFASASTLEREVVALTNRRVNSDSVKIVAKLMSDRLNKLDNCKKFIFDRGLYKYT
FT                   GIVSEFANELRSYGFEF"
FT   gene            405793..406317
FT                   /gene="rpsE"
FT                   /locus_tag="ECH_0426"
FT   CDS_pept        405793..406317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="ECH_0426"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P02356; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45314"
FT                   /db_xref="GOA:Q2GH39"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH39"
FT                   /protein_id="ABD45314.1"
FT                   /translation="MDVVKKSRNVHGSNDFSELIVSVRRVAKVVKGGRRFSFSVLVVIG
FT                   DEKGKVGCGIGKHLEVSEAKIKAVNAARKNMIRVHLRESRTLHHDVKAKFCSSKVMLRS
FT                   AKVGTGIIAGGSIRLIFEVLGVQDVVAKSIGSSNPHNVVYAVFAAFRKMLSPKQVANKR
FT                   SRKIGDIIENR"
FT   gene            406321..406791
FT                   /gene="rplO"
FT                   /locus_tag="ECH_0427"
FT   CDS_pept        406321..406791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="ECH_0427"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to SP:P19946; match to
FT                   protein family HMM PF01305; match to protein family HMM
FT                   TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45172"
FT                   /db_xref="GOA:Q2GH38"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH38"
FT                   /protein_id="ABD45172.1"
FT                   /translation="MDTVVKLNNIFSGLPKNKKSKVLGRGIGCGKGKTSGRGHKGQKAR
FT                   SGVSINGFEGGQQSIFTRLPKRGFNSLLKHRYSIVNLSTIQRLIDSKKIEDVSAITKEV
FT                   LYNLGVISSIKEKIKILGNGKLNTAVAIEYDFISKSAESQVTLLSNVSASKE"
FT   gene            406836..408134
FT                   /gene="secY"
FT                   /locus_tag="ECH_0428"
FT   CDS_pept        406836..408134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="ECH_0428"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P03844; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45362"
FT                   /db_xref="GOA:Q2GH37"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH37"
FT                   /protein_id="ABD45362.1"
FT                   /translation="MDLLSWNKDNLLGKLWFTLFCLIIYRLGTYIPIPGINPDVIDAVV
FT                   TKHSVGVLGIFNVFSGGALGRMTVFALNVMPYIVSSIIIQLLSVTIPKLNELRQNGELG
FT                   RIKINSYIRYMTIFFCMVQGFVILLGLEKMNTETSIVVIEPGLLFRIVGISSLLGGTMF
FT                   LLWLGERINKNGIGNGVSMIIFTGIVAELPGSFSSMFLLGKNGNVPIFVILLMLLVFFA
FT                   LLLLIIFIEKSYRKILVQYPKRQVKNKLYGSSSTYIPLKINISGVIPPIFANALLLSPI
FT                   TVANFHQGSPWSDFILMHFSSGKLLYMGCYALLIIFFAFFYTTFVFDSKETSEILKKNG
FT                   GFVPGKRPGNGTCEYFNYVIKRLTVLGSIYLTVICIIPELIRYNYSISFTLGGTSFLII
FT                   INVIIDTFSQVQTHLYSSRYSTLIKKSELWKIK"
FT   gene            408119..408784
FT                   /gene="adk"
FT                   /locus_tag="ECH_0429"
FT   CDS_pept        408119..408784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECH_0429"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to SP:P16304; match to
FT                   protein family HMM PF00406"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45023"
FT                   /db_xref="GOA:Q2GH36"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH36"
FT                   /protein_id="ABD45023.1"
FT                   /translation="MENKINMLIFGPPGSGKGTQCHILSKIYSTISVISTGDLLRSEAK
FT                   LDTDDGRKIRQVIESGDLVSDDIVCKMFAKSISRVKSGFLLDGFPRNLSQAEFLTEILE
FT                   EYNSRIDIVIQLQLDLETIKNRLYGRIVCKNCGQVSNLNFFDRAIDEIVCKFCKSSQLD
FT                   YRYDDKVEVIIKRVNQYDREIKKLENYYRDKIVCIDAGKPIEEVTCDIKDKIAHLIIG"
FT   gene            408843..409214
FT                   /gene="rpsM"
FT                   /locus_tag="ECH_0430"
FT   CDS_pept        408843..409214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="ECH_0430"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P80377; match to
FT                   protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45097"
FT                   /db_xref="GOA:Q2GH35"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH35"
FT                   /protein_id="ABD45097.1"
FT                   /translation="MARIAGVNIPTNKRIVIALTYIYGIGLSLANRICEGCNIDHNVRV
FT                   VNLSDDEIIRIRNFIRENYIVEGDLRKEVSMNIKFLTDIGCYRGLRHRRGLPVRGQRTH
FT                   TNAKTRKGRSKLPVAAKKK"
FT   gene            409226..409606
FT                   /gene="rpsK"
FT                   /locus_tag="ECH_0431"
FT   CDS_pept        409226..409606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ECH_0431"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to SP:P04969; match to
FT                   protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44739"
FT                   /db_xref="GOA:Q2GH34"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH34"
FT                   /protein_id="ABD44739.1"
FT                   /translation="MSVVYKKKKRNVVVGVVYIHATYNNIIVTVTDQQGHSLICTSAGA
FT                   CGFKGSKKATPYAAQETASHAVKTVVEQNGMKTVSIKVSGPGAGRESAIRAVQACNLNV
FT                   TSIKDTTKLPHNGCKLPGRRRV"
FT   gene            409729..410754
FT                   /gene="rpoA"
FT                   /locus_tag="ECH_0432"
FT   CDS_pept        409729..410754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="ECH_0432"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P00574; match to
FT                   protein family HMM PF01000; match to protein family HMM
FT                   PF01193; match to protein family HMM PF03118; match to
FT                   protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45224"
FT                   /db_xref="GOA:Q2GH33"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH33"
FT                   /protein_id="ABD45224.1"
FT                   /translation="MSDHWSKLTKPSSIKVVPSGASPNKADLIIEPLESGFALTLGNAL
FT                   RRVMMSSLRGFAVYGVEIENVLHEFTSISGVREDVTDILLNISMMRVKLSGMNSKVLSL
FT                   KVKGPCEVRSGMIPDTDDCIILNKDLLICTLDQGVDFNIKMYVNAGKGYVPAVKRKSVN
FT                   KLGDIPINFIATNALYSPIKKASFKVESSRIGQFTDYDRLIMSVETDGSILPDEAVALA
FT                   ARILQDQFQPFINFDETDEPHKKVDAKDTLPYDSNLLRKVDELELSVRSYNCLKNDNIT
FT                   YIGDLVQKTESDMLRTPNFGRKSLNEINELLASMNLHLGMKIANWPPESIESLSKQYSE
FT                   E"
FT   gene            410764..411165
FT                   /gene="rplQ"
FT                   /locus_tag="ECH_0433"
FT   CDS_pept        410764..411165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="ECH_0433"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P02416; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44764"
FT                   /db_xref="GOA:Q2GH32"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH32"
FT                   /protein_id="ABD44764.1"
FT                   /translation="MRHRVAHRKFSRTSAHRMSMLLNLCISLIKHERISTTLPKAKEIR
FT                   PYVEKLITIGKVYKEKNLVYGKRLLISKIKNPDIADKLIGILSVRYKSRNGGYTRIIKN
FT                   GFRKGDSAPMAIIELVDRQIITVESNKNS"
FT   gene            411211..413577
FT                   /gene="pheT"
FT                   /locus_tag="ECH_0434"
FT   CDS_pept        411211..413577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ECH_0434"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by similarity to SP:P07395; match to
FT                   protein family HMM PF01588; match to protein family HMM
FT                   PF03147; match to protein family HMM PF03483; match to
FT                   protein family HMM PF03484; match to protein family HMM
FT                   TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45238"
FT                   /db_xref="GOA:Q2GH31"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH31"
FT                   /protein_id="ABD45238.1"
FT                   /translation="MRFTLSWLMQYLDTDVSLDIIVNKLSDIGIEVDNVDYCEHLKTFV
FT                   VAEVLEVVPHHAANRLKVCQVFDGKETFQVVCGASNVRAGIKSVLARVGSIIPKNQSVI
FT                   EVVKLRGVESYGMLCSKDELGIVDHSNSNDGIIELSSAYNVGNTFFSCDPIIEVSITPN
FT                   RGDCLGVYGIARDLAAAGMGKLKCIDNNIVNDSTASNSSPVDICMQAEGIVKGRYIKGI
FT                   KNCESPKWLKDNLLVCGINSVSFVVDITNYIMLSFNRPLHVYDASKIKKKLIFKKADSQ
FT                   MEFSALNDKKYILGTENIIAVDSNDNIHSVAGIIGSQLSSCSLETEDIFLESAWFNPMD
FT                   IVLSSRKIKLSTDASYRFERFVDPKFLQTGLDLATKMILEYCGGEFFDVVSDENYLIND
FT                   IRLDFLPESVRKVGNVDIATKQIFDFLVKLGFFVDNSNEDVWKVTVPSWRSDIQHSSDI
FT                   VEEVLRLYGYDKICEEPIPISHVDVVDNSYDRLRSVLLSEGLMEVITWSFTSMTFAKKL
FT                   GYDSELLLLDNPINDKLNLMRPSVLLNLLQVVSDNQAYGSSEVAIFEIGQIYNIDNVCS
FT                   GNSYVVGGVRYGNNFPRNLYKLDRSVDIFDVKSDVISILRELNINSDAVEFKKSDKPYL
FT                   HPVKSADVYFNNILLGYFGELHPDIIHLYEIKRPVVCFEVFLYKIPQINVISKEFVESC
FT                   YQLVKRDFAFLIDKNISVQCLVDVTKNSNSTLIDNVVVFDLYEGDNIGDNKLSVALSVT
FT                   FRPVDHTLNDQEIKDASDRIISAVAQELGGVLRSF"
FT   gene            414009..416033
FT                   /locus_tag="ECH_0435"
FT   CDS_pept        414009..416033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0435"
FT                   /product="ComEC/Rec2-related protein"
FT                   /note="identified by match to protein family HMM PF03772;
FT                   match to protein family HMM TIGR00360"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44501"
FT                   /db_xref="GOA:Q2GH30"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH30"
FT                   /protein_id="ABD44501.1"
FT                   /translation="MLLVSIIIRKITLLLCKNLNDNRDVLIIWVPILQGIGIIIYFSLT
FT                   NEPQDDVLVYIAFLLLVGLVFICLRKYSILFISVFFILLGFVSVQIKAHYFVGSVLRHQ
FT                   VYVRDVIATVKEISIQQSNKRLVVCDIKGSKYGIKCIRLGVRTKLDDNITIGDMVQFSA
FT                   IIYPPSVAVSPFSYDFSRIAYFKNISAVGFAVSNICLFKKSRSRRVTEYIELIRLNIYK
FT                   VLLRSLTEDSANILSALLIGKKEGIKSDIMDTIRNTGIAHLFAISGLHLSFIAGLFFSL
FT                   SRSLLVLFTKFAESYDIKKISSVIAIVVSLIYLLIAGMPVSGQRAFIMVSCVFIGILID
FT                   RNHNNFCSIAVASFIILLFNPESLLSPSFQMSFAAVLALVASHNIFLRLVVMNNIVQYF
FT                   SSIVLSSLIASLATLPYVVYHFNYFSIAGVFANLLAIPITTFFIMPLGLLYIVLGIVNL
FT                   EFCVSWMLESTVNLLIYIVKYIAKIDGLVVLFHAFSSVSILIITLGFLFLCLWKGNMRF
FT                   CGLILVILGFFVGISYVTPDIMFNQHNIVVKELNGKLYAINQKAHLTSFINLTWARQNG
FT                   QKKMLKHYSGNNQYLSCERAGCIYNKLGRNVLIAYNADYVMQNCQDVDLIIQAKKFMYP
FT                   SECLTQHINYNNTSKSYVIWITNNEIKIDGMFGNRIWNT"
FT   gene            416581..416682
FT                   /locus_tag="ECH_0436"
FT   CDS_pept        416581..416682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44499"
FT                   /db_xref="GOA:Q2GH29"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH29"
FT                   /protein_id="ABD44499.1"
FT                   /translation="MLLEYKLLQSSTRLIRYLVKYVDLLLGTLHFYY"
FT   gene            416756..416854
FT                   /locus_tag="ECH_0437"
FT   CDS_pept        416756..416854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45010"
FT                   /db_xref="GOA:Q2GH28"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH28"
FT                   /protein_id="ABD45010.1"
FT                   /translation="MAKKNKIDEVSGEIRRFIIRYTTFLLLSIICF"
FT   gene            complement(417083..418387)
FT                   /locus_tag="ECH_0438"
FT   CDS_pept        complement(417083..418387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0438"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="identified by match to protein family HMM PF01235"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44978"
FT                   /db_xref="GOA:Q2GH27"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH27"
FT                   /protein_id="ABD44978.1"
FT                   /translation="MSILNLVLSFPAVFLLLFTGIYLSIKSKFLQITKLPSAISLITMK
FT                   KYRDKSFSIGALCTIIGGNLGVGNISGTAVALKSGGPGFALWMIIIVTLCSIIKYVTCY
FT                   LSIETRVKVNKQYIGGPAIYFKNAFKSKKAVIVFTILMLICSIAIGNFVQVNSLSIPME
FT                   LINKPPIIAGLFMCAMFFAVTILRLEIITALISRLVPGMAIAYIILASFVLYKFNDNII
FT                   PSIKLMFANFLTFDSFKSGMIGAFILETFHIIQVGTFRGIFATDIGLGLEGMVHSSINS
FT                   NSKNFNTHQSMISLISPFIVVIVTLVTTLVILVTNAWSGPLESTNMCIAAFKSAFDSEY
FT                   INYVIILIMFCFSFTTVFTWFVCAKSTLYCLTDGKDSLLIKMWKILYTIIIPIGALGKV
FT                   QLLWDIADISISLILISNTIAILILLPKYKNIFKV"
FT   gene            complement(418457..418816)
FT                   /locus_tag="ECH_0439"
FT   CDS_pept        complement(418457..418816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0439"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45442"
FT                   /db_xref="GOA:Q2GH26"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH26"
FT                   /protein_id="ABD45442.1"
FT                   /translation="MRLKGVVTVKKRKCFLFARNNGTFVGGNGLFLQVAKEPNGLLEDG
FT                   CVRVGFTVSKKVGKAVVRNKVKRRFRVLAQSVLVKYAIKGYYYILIGNRYTPKVNFKEM
FT                   SLRLKSYLNTPSLYS"
FT   gene            complement(418807..418941)
FT                   /gene="rpmH"
FT                   /locus_tag="ECH_0440"
FT   CDS_pept        complement(418807..418941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="ECH_0440"
FT                   /product="ribosomal protein L34"
FT                   /note="identified by similarity to SP:P02437; match to
FT                   protein family HMM PF00468; match to protein family HMM
FT                   TIGR01030"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44636"
FT                   /db_xref="GOA:Q2GH25"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH25"
FT                   /protein_id="ABD44636.1"
FT                   /translation="MKGTFQPSRIVRKRRHGFRSRMSTKMGRRILNRRRAQGRRVLCA"
FT   gene            419238..420113
FT                   /gene="ubiA"
FT                   /locus_tag="ECH_0441"
FT   CDS_pept        419238..420113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="ECH_0441"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by similarity to SP:P26601; match to
FT                   protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44553"
FT                   /db_xref="GOA:Q2GH24"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH24"
FT                   /protein_id="ABD44553.1"
FT                   /translation="MCKIKDIISNFRKYHLLLRLHSVEIILLLIFPSLASIALVSHSVL
FT                   RACGYMFLCSIGAFIMRPAGCIINDIFDRKIDSEVKRTQNRPLANNSLSVFQALKILAI
FT                   LLLCACVLLVLTNMYTIKIAIVSMVLIVLYPLAKRYFAWPQLLLGIVFNTGILMGCTMT
FT                   VGHLTLSCVLLYIGCIFWTVGYDTIYAAQDKEYDIKLGLQSTAIKFGNDIRLWIGRLYM
FT                   ITVTMWLSAGIIAVLHPIFYLAILIIAAIFYYQYKKSDFDNPEKCMYMFKVNIYVGLIL
FT                   FLGTVFGRIL"
FT   gene            420160..420654
FT                   /locus_tag="ECH_0442"
FT   CDS_pept        420160..420654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0442"
FT                   /product="putative flavin reductase"
FT                   /note="identified by similarity to GB:BAB18470.1; match to
FT                   protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45058"
FT                   /db_xref="GOA:Q2GH23"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH23"
FT                   /protein_id="ABD45058.1"
FT                   /translation="MQIGDWSKTHIKSCFSEFVTGITVVTTVSQNGSMHGITVNSFNSV
FT                   SLVPPMVLFSIEKSASRFEIFHTCSKFIVNILSDKQKSISQNFAECDVQNWEDFSYSVL
FT                   DGIPIINGIMSYIYCAKKYVYDGGDHKIIVGEVINCAKLNNDDKPLAYYKGKYMVIGGV
FT                   L"
FT   gene            420651..421454
FT                   /gene="dapB"
FT                   /locus_tag="ECH_0443"
FT   CDS_pept        420651..421454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ECH_0443"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by similarity to SP:Q52419; match to
FT                   protein family HMM PF01113; match to protein family HMM
FT                   PF05173; match to protein family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45540"
FT                   /db_xref="GOA:Q2GH22"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH22"
FT                   /protein_id="ABD45540.1"
FT                   /translation="MTRVNIGIVGCLGKQGRRLVSEISASPYAQVSGGLVRSGNPHVGQ
FT                   ILGEVVGCDCSVKITDSLEHLFETSDIVIEFTNPDMLLECIKMAEQKKKPLLSGTTGPA
FT                   ATEMVFEDYIKSIPFLWTTNVSFGVNILAKLVQEAAKKLFDYDIEIWEMHHRYKKDSPS
FT                   GTSLILGKAAAKGRNVPFQMAQYVRGTPQEARKDVNTIGYSVSRGGADLSDHRVMFVSD
FT                   EEMIDFNHRTLNKNLYAKGALKAALWLVKQPPGVYTMSDMMAAVE"
FT   gene            421474..422235
FT                   /gene="pstB"
FT                   /locus_tag="ECH_0444"
FT   CDS_pept        421474..422235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="ECH_0444"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44797"
FT                   /db_xref="GOA:Q2GH21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH21"
FT                   /protein_id="ABD44797.1"
FT                   /translation="MSQRIHASARNLSLWYDTNQILYDINLDVYKREVTAFIGPSGCGK
FT                   STFLRCFNRMNDFISNCKIKGSLNVDDIGVYSVNTNVVLLRAKVGMVFQKPNPFPKSIY
FT                   DNVAYGPKLHGLAKNKKKLDEIVEKSLTSVGLWEELCDRLKDNAFELSGGQQQRLCIAR
FT                   AIAVRPTMLLMDEPCSALDPVATNVIENLIQNLKKNFTIIVVTHSMKQAKKISDRVAVF
FT                   DSGRIVEYNTTQEIFQNPQSSKTQRYIVDQL"
FT   gene            complement(422526..423716)
FT                   /gene="tgt"
FT                   /locus_tag="ECH_0445"
FT   CDS_pept        complement(422526..423716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ECH_0445"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by similarity to SP:P28720; match to
FT                   protein family HMM PF01702; match to protein family HMM
FT                   TIGR00430; match to protein family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45434"
FT                   /db_xref="GOA:Q2GH20"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH20"
FT                   /protein_id="ABD45434.1"
FT                   /translation="MYKNFNFKIIHQHNNARLGTILTPHGIINTPAFIFCATKAAIKSV
FT                   DISKIKESNTQIILSNTYHLMLQPGEDIIEKLGGLHKITGWNKPMLTDSGGYQIFSLGY
FT                   GSVSHEIKSAGRKYTSKTLVSINEEGAIFKSYINGSTYHLTPEKSIQIQQKLGADLIVV
FT                   LDECTPFHVSYDYTKNSMNMSHRWAVRCIDQFKKNNNYSQALYGIIQGGIHEDLRINSC
FT                   SFINDMPFFGHAIGGSLGACKQQMYDIVSLTTSNLDKNRPIHLLGIGNIDDIFQGVKAG
FT                   IDTFDCVYPTRIARHGGALVKPNHRKEETRTKEHINLRNERFKIDTNPIEPDCLCFTCC
FT                   NHSRGYIHHLLKAQELLAYSLISIHNIYFMNNLMESIRKAILNNTLAEEQNQWVIK"
FT   gene            423860..424045
FT                   /gene="rpmF"
FT                   /locus_tag="ECH_0446"
FT   CDS_pept        423860..424045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="ECH_0446"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44659"
FT                   /db_xref="GOA:Q2GH19"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH19"
FT                   /protein_id="ABD44659.1"
FT                   /translation="MAVPKRKKSKSRRNMHRSHCRLKVPNIGIDKTTGEYKLSHHVCLG
FT                   GYYNEKQVLEVDSSNV"
FT   gene            424074..425087
FT                   /gene="plsX"
FT                   /locus_tag="ECH_0447"
FT   CDS_pept        424074..425087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="ECH_0447"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by similarity to SP:P71018; match to
FT                   protein family HMM PF02504; match to protein family HMM
FT                   TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44515"
FT                   /db_xref="GOA:Q2GH18"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH18"
FT                   /protein_id="ABD44515.1"
FT                   /translation="MSIISIAVDAMGGDFAPEAVVSGLDFALTNLLDDQNVSFNIYGQG
FT                   SQVLPILDKYKDLKEHSVFIDTPEVVLANDKPSFALRKRRSSSMWCAIDSIKSGVTSGV
FT                   VSSGNTGALMAISRFLLGTLPNIDRPAICTALPSRGEEYFVLLDLGANIESSSNALFQF
FT                   AIMGSAFAKAVLNIASPKVALLNVGQEEVKGTDVIREAFLLLKQAEGRINFCGYIEPID
FT                   ILGDKVDVVVTDGFCGNIVLKVAESIAYTFKSVFEKSVTSSIISKFAGLLLKSQMKKDF
FT                   MRFNPKMYNGAMLLGLNGVVVKSHGNADKVAFAHAIKVTVNAVRNDINAKIIHELS"
FT   gene            425097..426056
FT                   /gene="fabH"
FT                   /locus_tag="ECH_0448"
FT   CDS_pept        425097..426056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="ECH_0448"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P24249; match to
FT                   protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45059"
FT                   /db_xref="GOA:Q2GH17"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH17"
FT                   /protein_id="ABD45059.1"
FT                   /translation="MKRSTILGIGSYLPKKIVTNDELALTVETSDEWIVKRTGIKQRHI
FT                   AENNEMTSDMAANAARLALTDACVHKDDIGLIIVATTTPDRTFPSCATIVQDKLECKNA
FT                   FAFDIQAVCSGFVYAISIADNFIKSGQVNTALVIGAEIMSRILDWQDRSTCVLFGDGAG
FT                   AVVLGNNSEKDSGIISTILHSDGAFCDLLYTTGGTAYNGHAGTICMNGTIVFEHAIEKL
FT                   SASILEILDQNDLEINDVDWFVLHQANIRIIELVARRLKIPYEKMVVSVNWHGNTSAAS
FT                   IPLALSYAKSSGKLKKHDIAILAAIGGGFTWGTCLVRI"
FT   gene            complement(426120..426542)
FT                   /locus_tag="ECH_0449"
FT   CDS_pept        complement(426120..426542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0449"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45232"
FT                   /db_xref="GOA:Q2GH16"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH16"
FT                   /protein_id="ABD45232.1"
FT                   /translation="MKLAISKAQEDLLEVPVGAVIVHNNEVISSANNSNIHDIDPTAHA
FT                   EILAIRNACKILSTHILNQCDIYVTLEPCAMCAQAISFSKIRRLYFGAYNKKYGAIENG
FT                   ARIFQFCHHVPEVYGGILEAENTKLITDFFKKLRKE"
FT   gene            426697..427125
FT                   /locus_tag="ECH_0450"
FT   CDS_pept        426697..427125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14136.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44743"
FT                   /db_xref="GOA:Q2GH15"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH15"
FT                   /protein_id="ABD44743.1"
FT                   /translation="MYFDILIYLVLALGILGICIALFTFYKSYIRESIFKIFVDNDYDE
FT                   DQLTDEEKYKRYIEKKQKELIKHQMLINDVARDQVEYKSNIKIINVMEPIGQWTKLVMS
FT                   EKLQRFAGLKFDKEQTGFWQMFVSMRSLSQGKYRGRSK"
FT   gene            427624..429090
FT                   /gene="dnaB"
FT                   /locus_tag="ECH_0451"
FT   CDS_pept        427624..429090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="ECH_0451"
FT                   /product="replicative DNA helicase"
FT                   /note="identified by similarity to SP:P37469; match to
FT                   protein family HMM PF00772; match to protein family HMM
FT                   PF03796"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45117"
FT                   /db_xref="GOA:Q2GH14"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH14"
FT                   /protein_id="ABD45117.1"
FT                   /translation="MELKSNTSKNFGQLMSELPCNIEAEQILLGSMLRDNRICDAVEDI
FT                   ITSDVFFDSLHRRIFEQIVKINKRGLVANEVSLKMFFDNDEDLIESGGVDYLAKIAAKA
FT                   SIIFDIKNVANIVVDTYLRRCLISFGQDLISGAYNYDVDNSAVYQIESAAQKLFLLGNQ
FT                   GKSDKTYHQFALLVANIKKRIEFAKNNEGTLQGVSVGFRDLDQLLNGLQKSDLLILAAR
FT                   PSMGKTALALNMALNACKILSNSSQYNGQHIGFFSLEMSAEQLASRVIAIESDVSSYKA
FT                   LSGKISGEELKKVLDASTKVCNLPLIIDDSSSISISSLRTRIRRMHQLYNLEAVFIDYL
FT                   QLVKGTTKRSGENRVQEVSEVTQGLKAIAKELNIPVVALSQLSRLVEQRDDKKPQLSDL
FT                   RDSGSIEQDADVVMFLYREEYYELRKQPSEGTAKHVEWQERMNSISNVADILISKQRNG
FT                   PIGNIKLFFEAEKGRFRDYTAKYNPADFNF"
FT   gene            430003..431067
FT                   /locus_tag="ECH_0452"
FT   CDS_pept        430003..431067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0452"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44800"
FT                   /db_xref="GOA:Q2GH13"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH13"
FT                   /protein_id="ABD44800.1"
FT                   /translation="MNKKAGVVGAGLVGRLLALRLLHDGWQVTLFDKFGKNDRRSCGAI
FT                   AAGMLALYSESEKMEQIVFDLGIKSLNLWPKILNSMLGNTSFKMLGSIVVAHRNDMSDL
FT                   ERMMMLIKRKSHVSNLEIIDENALKIFEPDLSFPYGLYIPGEAQIDSSQLFYNIMRTLE
FT                   QYNVTWYEHVVVDKIIDEIVVIESGKEYRFDFVFDCRGIGAKSDLPNIRGVRGEVLLLH
FT                   APQVNLNRPIRMVHPRYSIYIVPRQNFQFVIGATEIESCDMSEVSVQSVLELLSAAYSV
FT                   HKGFAEARIIDMSVNCRAAFSDNLPKIYVHNNLIRINGLYRHGYLLAPSLIEEVVLLLN
FT                   GNLNTHSSIIEMVS"
FT   gene            431326..431466
FT                   /locus_tag="ECH_0453"
FT   CDS_pept        431326..431466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45582"
FT                   /db_xref="GOA:Q2GH12"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH12"
FT                   /protein_id="ABD45582.1"
FT                   /translation="MFIIILSGLMVCIGIGIFISSVVVEEIVLLLNGNLNTHSSIIEMV
FT                   S"
FT   gene            complement(431740..432648)
FT                   /locus_tag="ECH_0454"
FT   CDS_pept        complement(431740..432648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14837.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45448"
FT                   /db_xref="GOA:Q2GH11"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH11"
FT                   /protein_id="ABD45448.1"
FT                   /translation="MKKIFYRLLYVCLTIVAITLVGKALTILYTKTTLNQHTNLSNKPY
FT                   KINVNHSLTHIIGYDLLRPIIESRIDYYIKINGLVDYLEHIKHKTIKPDLFKIHDIVEG
FT                   NGKKALCGQNISAIIHKFLYDSESKNILSQALKNIPQEVTFKLGESIIKELNYTIAGME
FT                   EEGERIIILTDQEGNLKEQYYVKLISINSSYPDEVNDILIFNNTIENYEGTVNKIHCGD
FT                   SVSVKYTVRESNGKVLLEDQELKVEIGKNEAPLAIELGLINMRSDMTRSMIVSPKLFTN
FT                   FEKPENFDENSIKIIDMNIIE"
FT   gene            complement(432655..433458)
FT                   /locus_tag="ECH_0455"
FT   CDS_pept        complement(432655..433458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0455"
FT                   /product="putative geranyltranstransferase"
FT                   /note="identified by similarity to SP:Q08291; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44734"
FT                   /db_xref="GOA:Q2GH10"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH10"
FT                   /protein_id="ABD44734.1"
FT                   /translation="MKHHSSLLVKQLESILPENNQDILLTSMRYSMFAPGKHIRPFLVN
FT                   ASAQIFNVNVDRILPVSAAVEIIHVYSLIHDDLPGIDNENIRRGQASSHKKFNEAIAIL
FT                   TGDALLTLAFEILSTIDESPFIRCCMIKALAKALGYQGMIQGQILDTETIAKDTNDIQA
FT                   IHVLKTAQFFSVACELGGILGNASNIELNALANYGLNLGHAFQVKDDIADANQDKSKNN
FT                   ILNILNNEDAQNYLNSLIDKSIEHLTILSHKADILHSLAEFIRNL"
FT   gene            433557..433670
FT                   /locus_tag="ECH_0456"
FT   CDS_pept        433557..433670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45395"
FT                   /db_xref="GOA:Q2GH09"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH09"
FT                   /protein_id="ABD45395.1"
FT                   /translation="MVVIKDLYYLLFNFLAILSFLLIDILYNEHILVCIFT"
FT   gene            complement(433580..433714)
FT                   /locus_tag="ECH_0457"
FT   CDS_pept        complement(433580..433714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45553"
FT                   /db_xref="GOA:Q2GH08"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH08"
FT                   /protein_id="ABD45553.1"
FT                   /translation="MNISIVKHYSQQFTYYVNIHTKICSLYKISIKRNDKIAKKLNKR"
FT   gene            433734..433806
FT                   /locus_tag="ECH_0458"
FT   tRNA            433734..433806
FT                   /locus_tag="ECH_0458"
FT                   /product="tRNA-Glu"
FT   gene            434039..435826
FT                   /gene="nrdA"
FT                   /locus_tag="ECH_0459"
FT   CDS_pept        434039..435826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="ECH_0459"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45079"
FT                   /db_xref="GOA:Q2GH07"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH07"
FT                   /protein_id="ABD45079.1"
FT                   /translation="MGTVIVDYERDNNLTAFGKAVLSDRYLLENEDYQQLFVRISEYYS
FT                   DNPEHAQRLYDYMSQLWFMPATPILSNGGTNRGLPVSCFLNETEDSLRGIVNLWNENVW
FT                   LASKGGGIGSYWGNLRSIGEKVRGSGKTSGIIPFIVVQNALTLAISQGSLRRGSSAVYL
FT                   PVWHPEIEEFLDLRKPTGGDPNRKALNIHHGVVLSNKFMKCVENDEPWDLISPKDQSVL
FT                   FTIKARDIWIKILTTRVETGEPYILFIDQVDNNKPEIYKRLNLDIKMSNLCTEITLTTG
FT                   YDHLNKSRTAICCLASLNLEYYEQWKDNSLFIEDVMRFLDNVLTDFIEKAPSEMERAKY
FT                   SAMRERSIGVGVMGFHSFLQSKMIPFESVAATIWNKKIFSHIRKHADAASYNIAMEKGS
FT                   CLDAQDAGIVERFVNKLSIAPTASISIIAGNTSPGIEPYAANVFTHKTLTGSFIVRNKF
FT                   LQKLLKLKGKDNEQVWSSISTNEGSVQHLDFLTEEEKLIFKTAYELDQRWIIEHTSDRS
FT                   KYICQAQSVNIFLPANVHKRYLHKIHFLAWRKGLKSLYYCRSKSIQRADKVSHGALEKS
FT                   IEQYKQITNFDYNECLSCQ"
FT   gene            436874..437344
FT                   /locus_tag="ECH_0460"
FT   CDS_pept        436874..437344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0460"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="identified by similarity to GB:AAS13897.1; match to
FT                   protein family HMM PF03652; match to protein family HMM
FT                   TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45383"
FT                   /db_xref="GOA:Q2GH06"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH06"
FT                   /protein_id="ABD45383.1"
FT                   /translation="MLYKNVDEFIKVIDKTKRIMGLDFGEKKIGIALSDRTNLIAIPYS
FT                   VYVRRSSRKDLGSLYSIFVENDVGSIVIGWPLELSGVENELCQKVVMFANRIITRYKIN
FT                   ICLHDERYSTAMATRLAKLANIKRKESQAIDDKISAVLILQQVLDIIKVYQM"
FT   gene            complement(437845..439137)
FT                   /gene="purA"
FT                   /locus_tag="ECH_0461"
FT   CDS_pept        complement(437845..439137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="ECH_0461"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44893"
FT                   /db_xref="GOA:Q2GH05"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GH05"
FT                   /protein_id="ABD44893.1"
FT                   /translation="MVNIVVVGLQWGDEGKGKVVDWLSTNADAVVRFQGGNNAGHTIVI
FT                   NDKVYKLNLLPSSVLQNNKLSIIGNGVVLDPYALVSEIDNLKSSGINITTQNLAISESC
FT                   PLVLSVHKQADILFEQLRQDTIGTTNKGIGPCYADKISRRAIRVCDLLDTKDLLYSKVN
FT                   HLLIYHNLLRKSLNTPPIKAEDIVNELLNIAPKILPFVQPVWKTIYNLTQQNKTIIFEG
FT                   AQGTFLDIDHGTYPFVTSSNTIASQAWVGCGINPSNKSYILGLVKAYTTRVGNGPFFTE
FT                   QNNDIGKIMFKTGKELGTVSNRKRRCGWFDAVLARQAIMLSGVSGLVMTKLDVLDQFSE
FT                   IKICVKYKYGDKTYDYLPASPHIQSNLEPIYEILPGWQTSTFGSVSYKDLPQNAILYIK
FT                   KIEEILKVPIHLISTGPERNSMIILNNDFLQ"
FT   gene            complement(439445..439972)
FT                   /locus_tag="ECH_0462"
FT   CDS_pept        complement(439445..439972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0462"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45512"
FT                   /db_xref="GOA:Q2GH04"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH04"
FT                   /protein_id="ABD45512.1"
FT                   /translation="MKHKLVFIKFMLLCLILSSCKTTDHVPLVNVDHVFSNTKTIEKIY
FT                   FGFGKATIEDSDKTILEKVMQKAEEYPDTNIIIVGHTDTRGTDEYNLELGKQRANAVKD
FT                   FILERNKSLEDRIIIESKGKSEPAVLVYSNNPEEAEYAHTKNRRVVITLTDNLIYKAKS
FT                   SDKDPSSNKTEQ"
FT   gene            440484..440630
FT                   /locus_tag="ECH_0463"
FT   CDS_pept        440484..440630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45003"
FT                   /db_xref="GOA:Q2GH03"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH03"
FT                   /protein_id="ABD45003.1"
FT                   /translation="MLYCANIINYHYQLYYWKLCDDFLYQYFCINVLPGVVYIGMRCVI
FT                   SIF"
FT   gene            440717..442186
FT                   /locus_tag="ECH_0464"
FT   CDS_pept        440717..442186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0464"
FT                   /product="putative carboxypeptidase"
FT                   /note="identified by similarity to SP:P42663"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45116"
FT                   /db_xref="GOA:Q2GH02"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH02"
FT                   /protein_id="ABD45116.1"
FT                   /translation="MKHYKFLEQVFGKIGNINSIINVLETSEGNFCDKIEHICTLKEIK
FT                   HEILNSEMIGDMIQHSVANKAQLNDWEIANLNHIELIHKNSSAVPVELVLDLYRAQVKC
FT                   KNSWVLFRNGDASIQDIVALLSDVVRLVSDIASIKAESLKISKYDVILGLQDSKLNTRK
FT                   VDAIFTEIGAFFRQFITEVGDKQKHNKICYPKGINEEKQILLGYDALSSFGMTNSNIIN
FT                   SDYVNNRYSFGKDLPFLVNYSEDDYRIGLKTLFRKIGYALYALNLPEKWHKQPVGWNLN
FT                   NILSEILGLLTSNHLMMSKEFVKFISPNLKKRFSFRGKVGHYENIQLYFNEVQPNLLMH
FT                   KSDEVTLLAHIMLRYTLEKEMISDSLQVQDLPDAWIQGMKHYFNVAPKNDLEGFLQDDY
FT                   WVSGIFGYFPCCMISAIIASQIFSTMKNTDVQVLSQVEKGDLSSFILWINKNVCDYSTK
FT                   YSSMDLLKKVTGQKLNVNFYKNYLTNKYLNM"
FT   gene            442242..444233
FT                   /gene="tkt"
FT                   /locus_tag="ECH_0465"
FT   CDS_pept        442242..444233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="ECH_0465"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45474"
FT                   /db_xref="GOA:Q2GH01"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH01"
FT                   /protein_id="ABD45474.1"
FT                   /translation="MDNEYNDMVNMANAIRVLSVDAIQKAASGHPGMPLGMADVATVLF
FT                   AKFLKFNPKDPNWFDRDRFVLSNGHGSMLLYSILYFLGCLDIEEIKRFRQIHSLTPGHP
FT                   EYGYTPGVDATTGPLGQGLACAVGMAIAEKILSEKFGSEIVNHTTYVMVGDGCLMEGIS
FT                   HEAASLAGHLQLNKLIVLFDDNNISIDGPISLSVSDDVKARFLSYQWDVFEIDGHDFGQ
FT                   IESSIKNAQKSEKPSLICCKTVIGKHLSSKENTCAAHSWPFSEEEVMLMKEKLNWQCNP
FT                   FNIPEEILQLWKNVSSRSEDEYNMWLDRSAKYSKTFDDFVDMMKEGVPDSVFLGLKEFK
FT                   KELYALNLSEATRRTSGRVLEVIAKHTSKLIGGSADLTNSNNTKPQLISIINRSNFNGS
FT                   YLHYGIREHAMAGCMNGMALHGGMIPYGGTFLVFSDYCRPAIRLSALMKKQVIYVMTHD
FT                   SIGVGEDGPTHQPIEHLSSLRSIPNLYVFRPADAIEVLECWEIALKLTSSPSVFILSRQ
FT                   NVGSVRSVSVDENLSNKGAYVIREYEKDLDVTIFATGSEVEIALKASDILKSKGLGTRV
FT                   VSIPCWELFVQQDKKYIFNLLNNKSIKAAVEAASSFGWHRYIGENGIFVGLEDFGISAP
FT                   YKDLYKHFGITAEGLVNKILDKLKINTN"
FT   gene            444556..444864
FT                   /locus_tag="ECH_0466"
FT   CDS_pept        444556..444864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0466"
FT                   /product="monovalent cation/proton antiporter, MrpF/PhaF
FT                   subunit family"
FT                   /note="identified by match to protein family HMM PF04066"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45184"
FT                   /db_xref="GOA:Q2GH00"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GH00"
FT                   /protein_id="ABD45184.1"
FT                   /translation="MYILILSLLSLDEMLVFTACVLLFCMGMMLVYLVTSKTIYDKILA
FT                   ANLFGTYSIVLIVVIGIINDTFSLLIDVSLVYACINFISTIGFMRFFLHGSFGDIKK"
FT   gene            444861..445160
FT                   /locus_tag="ECH_0467"
FT   CDS_pept        444861..445160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0467"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit family"
FT                   /note="identified by match to protein family HMM PF03334;
FT                   match to protein family HMM TIGR01300"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44531"
FT                   /db_xref="GOA:Q2GGZ9"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ9"
FT                   /protein_id="ABD44531.1"
FT                   /translation="MMEYISIVVLALGIFLVITSVVGVMRFPDFYTKLHPAGITDSLGA
FT                   PLILIGLAMRSGFSIFTIKVLLLICFLWITGTTASYALARSAYYKEKKGKDDAD"
FT   gene            445147..446107
FT                   /pseudo
FT                   /locus_tag="ECH_0468"
FT                   /note="putative monovalent cation/proton antiporter
FT                   subunit, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by similarity to PIR:C97744"
FT   gene            446148..446483
FT                   /gene="mrpC"
FT                   /locus_tag="ECH_0469"
FT   CDS_pept        446148..446483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpC"
FT                   /locus_tag="ECH_0469"
FT                   /product="Na(+)/H(+) antiporter subunit C"
FT                   /note="identified by similarity to SP:O05260; match to
FT                   protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44870"
FT                   /db_xref="GOA:Q2GGZ8"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ8"
FT                   /protein_id="ABD44870.1"
FT                   /translation="MILSCFNYIVSIILMVIGLYVTTANKNLVKKLIGLNIFQTSVLLF
FT                   YISIGYVSDGNVPILNDKVILYTNPLPSVLMLTAIVVGVAILAVGLSIIVKIRRAFSSI
FT                   NNKEIRR"
FT   gene            446614..448434
FT                   /locus_tag="ECH_0470"
FT   CDS_pept        446614..448434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0470"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45387"
FT                   /db_xref="GOA:Q2GGZ7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ7"
FT                   /protein_id="ABD45387.1"
FT                   /translation="MSNHNKRILIDAVYQDGIRVAVLRDGQVVEFDQESKNKKCLKGNV
FT                   YCAVVKRIEPSLQAVFIEYGANKHGFLPFSEISLDYYNISEEEKEKLYQVLYEDSDVKN
FT                   DDDVKSVDDSVACDTKDQDNVSDCNDKLTLLKKDNLRNGKSKLPFYKLYKVQDVIKLDQ
FT                   KLMAQIVKEERGNKGATFSTFITLVGRYCIFMPNSGNKNSGISRRIEDADDRKILKNFL
FT                   SAIKLPKESGIIIRTAGSNKNQKEIEQDLSYLQSTWRSIQNSYISVTMPLLLYVEGDII
FT                   KRTLRDYCDENTQDIIVSGSYAYELAKECVKFMFRNRVRLRIYKGSVPIFSYYKIESQI
FT                   CELYGNVVNLPSGGYMVITPTEALVSIDINSGKMTGEDSIEETAYKTNMEAVKEIARQV
FT                   NLRGLSGLIVIDFIDMLKYRYCRSVESEIKEAFKYDKAKVQFGYISTFGLMEISRQRVK
FT                   QSILEANTVQCSHCKGVGRVRSLESSSGDILRDIRYCANKNRNKLINISVAGQMVEYFF
FT                   NNKRQHIAEIEEEFSVSVKLTVNQNTSSVSDFNISVENDDMLNQGKDAVNVFTVDYKIS
FT                   EDNKLKEEIQKTPTGNMWIKKWLTRIFSHI"
FT   gene            448535..450442
FT                   /locus_tag="ECH_0471"
FT   CDS_pept        448535..450442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0471"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45018"
FT                   /db_xref="GOA:Q2GGZ6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ6"
FT                   /protein_id="ABD45018.1"
FT                   /translation="MAVIGIDLGTTNSCVAVMEGGDAKAIENSEGARTTPSIVAFTDSE
FT                   RLVGDPAKRQATTNAKNTIYASKRLIGRRYQDVKDIKSSYDVVSAKNGDAWIKVLGKEY
FT                   SPSQIGAFVLEKMKETAERHLGHKVEKAVITVPAYFNDAQRQATKDAGRIAGLDVIRII
FT                   NEPTAAALAYGLNKSDKQKVIAVYDLGGGTFDVSILEIADGVFEVKATNGDTMLGGEDF
FT                   DHAIMNYLMDDFKKTTGIDLHNDSMAVQRIKEASEKAKIELSNRMETDINLPFISSDST
FT                   GPKHLSLKLTRAKFENLVDDLIQRTIEPCKKALKDAGISADKIDEVVLVGGMTRVPKVI
FT                   QKVKEFFGREPHKGVNPDEVVAIGAAIQGSILAGDVRDVLLLDVTPLSLGIETLGGVFT
FT                   PLIERNTTIPTKKSQVFSTAEDGQTAVTIKVYQGERKMAADNKLLGQFSLEGIPSAPRG
FT                   MPQIEVTFDIDANGIVHVSAKDKASGKEQAIKIQSSGGLSDDEIQRMIKEAEQKAGEDE
FT                   KRKKFIELKNNGENLVHSTEKSLNEYGDKIPNSDRLEIENAIRDVKDGLSSSDMESVDV
FT                   LQQKVDHLMKVSMKLGEALYGNAANNPSSAENSTASNNEEEDSKVVDSDYQEIDKKDSK
FT                   "
FT   gene            450457..450591
FT                   /locus_tag="ECH_0472"
FT   CDS_pept        450457..450591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44885"
FT                   /db_xref="GOA:Q2GGZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ5"
FT                   /protein_id="ABD44885.1"
FT                   /translation="MSYVTIELIGPLYCVRIALGVSVLYVEVKLIPRARLIFLGSCHC"
FT   gene            450511..450672
FT                   /locus_tag="ECH_1158"
FT   misc_RNA        450511..450672
FT                   /locus_tag="ECH_1158"
FT                   /product="6S RNA sequence"
FT   gene            450713..451177
FT                   /locus_tag="ECH_0473"
FT   CDS_pept        450713..451177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0473"
FT                   /product="aromatic-rich protein family"
FT                   /note="identified by similarity to GB:AAS14711.1; match to
FT                   protein family HMM PF03364"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44962"
FT                   /db_xref="GOA:Q2GGZ4"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ4"
FT                   /protein_id="ABD44962.1"
FT                   /translation="MSNNEYNLNDSEIINFSAIDLFNIVLDVEKYPDFLPWCKAVYVKE
FT                   RRGNVIVADLLASFKGLSGQYTSNVMFKEPTVDQEGWIKVEAVEGLFKFLHNQWTFIPK
FT                   GESQTLVQFYISCAFKIPMLQSAFNLVCDTAYKRIMSSFKNRANSLLLPK"
FT   gene            451794..453383
FT                   /locus_tag="ECH_0474"
FT   CDS_pept        451794..453383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0474"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44807"
FT                   /db_xref="GOA:Q2GGZ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ3"
FT                   /protein_id="ABD44807.1"
FT                   /translation="MTEYLANRFSIISFIPKLAFLVFVVLELLLYDTRTETYNYSLILF
FT                   FVFSFIIVLIFLYIWNIKKHETILYLLYYLSSIAAISSGNLLSLVISFEFMALSALMIV
FT                   AVNSFGANKNSVIHYSCIHFLSGVLLLIGASGGFLGIINGEYYYKLFFLIGLLINCACF
FT                   PLSSWVTDAYSAALNNGILILSVFTTKVSAYVLLFFFQGEKILLFLGIATSVYGIIFSM
FT                   LENNIKRLLCYNLVGQMGLVITAIGFSYNDGVDIYGIIVLQIVLSIIYQTLLFMVAISV
FT                   INSTQKFNLSEIGGLFNKMPVEAVCSAIAIFTMGALPGTGGFVSKFLITHNINNVDLAS
FT                   VLMGKLFLICSILLFVSVGIKFFWYAFISKAIESPIVRKVCAASKLSMLILTLVCTFFG
FT                   VFGSYYLFHDLDSEKLSSIVLQCGLIFGSILFFICFHPVFKGRVNFTMDIDWVYRVLFM
FT                   SVILFINNFLLCIYNILITMLNNVLSTRILLYFKDGRKILGISSIDPLGFTIIFGMLFI
FT                   IIMVVVYLCLSL"
FT   gene            453368..454714
FT                   /gene="ffh"
FT                   /locus_tag="ECH_0475"
FT   CDS_pept        453368..454714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="ECH_0475"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45462"
FT                   /db_xref="GOA:Q2GGZ2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ2"
FT                   /protein_id="ABD45462.1"
FT                   /translation="MFESLTSSLTNVIQKMQSKHVISSEDFDAAMEEVKVALLEADVSL
FT                   AVVKDFISNVKEKIVGGTTVKGVLPTQMIIKKIQDCLIEVLGSEKCELDISKPLSVIMM
FT                   VGLQGVGKTTTTAKLALKLKNKKKEVVMASLDVYRPAAQKQLEILGKQIDVQTLPIIEN
FT                   QAPIDIVKRAMDNAQQANCDVLILDTAGRLHVDQVMMEELRAIKDLTSPSEVILVVDSM
FT                   IGQDAINVAKSFNDNIGITGIILTRIDGDSRGGAALSMKMSVGSPIKFIANGEKLSDLD
FT                   DFYPERIAKRILNMGDVVSLVEKATEAVGKHAIDEMQKKAQKGKFDLNDLVQQLKALNK
FT                   LGGIANILKFMPNFGADVKRQVSGIANDSRVKQYIAIVNSMTKKERENPKILNGARKAR
FT                   IAKGSGVHVNVINMLIKQFNQMSSLMNKFSKVDYSKIKNTDFMNMFNKE"
FT   gene            455262..456152
FT                   /gene="era"
FT                   /locus_tag="ECH_0476"
FT   CDS_pept        455262..456152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="ECH_0476"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by similarity to SP:P42182; match to
FT                   protein family HMM PF01926; match to protein family HMM
FT                   PF07650; match to protein family HMM TIGR00231; match to
FT                   protein family HMM TIGR00436"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45234"
FT                   /db_xref="GOA:Q2GGZ1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGZ1"
FT                   /protein_id="ABD45234.1"
FT                   /translation="MDHISKKCSMNAIVGTTNAGKSTLINMLVGQKVAAVTPKVQTTRV
FT                   RMHAVLNNENVQLIFIDTPGIFSPKTKLEKFIVKHAWMSLKGIENVILLLDVKNYLNKH
FT                   IEKIISRIKQSNINAILVVNKIDTVPTSSVDKAIEHMYSLHSFSKTFTISALHDIGLSR
FT                   LVDYLCEISPNGPWLYPEDQISDAPLKFFMAEITREKLFLSLHHELPYSLSVVTEALEE
FT                   KEDGSLVVKQVIYVTKDSHRTIILGKKGEMIKKISMESRSDLAKILDLKIHLFLFVKVR
FT                   EFWQNHLDECVGYVE"
FT   gene            456142..456969
FT                   /locus_tag="ECH_0477"
FT   CDS_pept        456142..456969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14435.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44728"
FT                   /db_xref="GOA:Q2GGZ0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGZ0"
FT                   /protein_id="ABD44728.1"
FT                   /translation="MLNSLLVFDIETIPDVDVCRNLLSDFDETVELSEKREALINYHLD
FT                   ITDGKNPFLRQPFHKVVAISFLKADIKKMGEYESFHLQEIRSGGKIDSVEKDLLKGFFQ
FT                   YVSSLRPRFVSFNGRTFDFPVLKYRAMVHGIQAGCLYKIGDKWNNYFQRYSIDWHCDLL
FT                   DYLSDFGTSARIKMNEVCSVLNFPGKFGLDGSKVTALYDSGKISEIRDYCETDVINTYL
FT                   VYLRMMHYQDRITTLSYNDSINDLLSYLDSSGREHFKQFRIEWDKSCGGNFYL"
FT   gene            457052..457570
FT                   /locus_tag="ECH_0478"
FT   CDS_pept        457052..457570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13980.1; match to
FT                   protein family HMM TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45157"
FT                   /db_xref="GOA:Q2GGY9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY9"
FT                   /protein_id="ABD45157.1"
FT                   /translation="MRNVKYVLFWLGFIVLVMLFSGTKDDIGGNKYFNKFFPNAATQNN
FT                   KVNYVEGGVEFYRAKDGHFYIEAMIHGIPVNFLVDTGATDVVLSVEDAKRLKHHLKYLN
FT                   KKKTYHTANGTVKALYVEISEMQVGKFVVNNVKASVNVSPMRTSLLGMSFLQYFHFNMS
FT                   GDKLTLHSY"
FT   gene            458144..459868
FT                   /locus_tag="ECH_0479"
FT   CDS_pept        458144..459868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0479"
FT                   /product="metallopeptidase, M24 family"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44564"
FT                   /db_xref="GOA:Q2GGY8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY8"
FT                   /protein_id="ABD44564.1"
FT                   /translation="MKNRLNQLIGLMEEYEIDVLLLQNTDEYQCEYVHINKQRIRWLCG
FT                   FSGSNATLIISREGKQNFFTDGRYTLQATRELDCSYYQIHNVCELTPWQWCVENCLSHT
FT                   VVAYESALFTLSQIRKYEDCGIFLKPIDQILIDKLWIRDFAIEHDIVQHSLEYSGVESY
FT                   TKSCEVAKYLSDKDAALITNTDVISWMLNIRNKKFLYNPSVLSRAILYKDGRVDLFIDD
FT                   VYSVNVKYEHLNICSLNNLFNVLKSVKSVVVDASTIPMSIFLSLQQQDVLVNDADFCLL
FT                   MKARKNDVEIQGAINAHVRDGISIVNLLYWLNMQLDNNQKITELDVESKLLDFRKQQSL
FT                   FQGESFSTISGFQENGAVIHYRANNDTNKLICKNGLYLLDSGGQYLDGTTDVTRTVAIG
FT                   EPTSEQITNFTLVLKGHIALAMAVFPLGTTGGMLDILARQYLWKSGLDYQHGTGHGVGS
FT                   FLSVHEGPCAISYKNDVVLQPNMVLSNEPGYYKNGEYGIRIENLMYVEEYMNGFLRFKQ
FT                   LTCVPIDLRLIDVDMLNHEEINYIDQYHNFVYNTIAPHVSEEVKHWLCHACQSLKGK"
FT   gene            complement(460239..460928)
FT                   /gene="hemD"
FT                   /locus_tag="ECH_0480"
FT   CDS_pept        complement(460239..460928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="ECH_0480"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45226"
FT                   /db_xref="GOA:Q2GGY7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY7"
FT                   /protein_id="ABD45226.1"
FT                   /translation="MKSLLVTRPKKDSIKIKEYLNKQGFNVYIEPLFSIKYLITKININ
FT                   DFDLIISTSQHSIIALSKITKNWNIPIVTVGNNTMNTAQELGFTSVKSLNGNIDNVISY
FT                   IKNHNRANILYIRGKEVTYNLKKSFNHYHNFQEIILYNTIDRKYLSKCCYNALLQNKIS
FT                   GILLYSSRTAKILIELIAKHNIQDKTRDITIYAMSDKIASTAKQACWKAIKTSDQPTNK
FT                   SLLSLIP"
FT   gene            461075..461188
FT                   /locus_tag="ECH_0481"
FT   CDS_pept        461075..461188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44512"
FT                   /db_xref="GOA:Q2GGY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY6"
FT                   /protein_id="ABD44512.1"
FT                   /translation="MANCGSKVICSIDLVFILHYINLVVALTLILSISLIY"
FT   gene            461235..462209
FT                   /locus_tag="ECH_0482"
FT   CDS_pept        461235..462209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0482"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44988"
FT                   /db_xref="GOA:Q2GGY5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY5"
FT                   /protein_id="ABD44988.1"
FT                   /translation="MKFICRMKYAIIIVLFFIILFIPCTSVSVGCVRYDQKDIVVGLIS
FT                   TEFISYPNEYKTALGITQLLQSYGVRVVLMDYNVIMQLVKDEIVKINKTYKANCKISRY
FT                   DIIESVVLKFIEEHNINRIFIPGNHYNISSLPIAPSLDRQLVTNAVVKIIHNQNHCIHL
FT                   LGVCGGLQGIMYANGIKITRVKDIVNSDISVKSHTVSMPDPRSVYANLHKIKIFPNTRL
FT                   SNIAVDLKLAKDQIIYFPDAHSEAIDSNVENVMKMYNLGYKIAAMSEDGVIEAIEDKYG
FT                   NIYFQFHPEYLMINAERKFGDNTSRDTSIMLADAIIKDFLFRD"
FT   gene            462508..464484
FT                   /gene="priA"
FT                   /locus_tag="ECH_0483"
FT   CDS_pept        462508..464484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="ECH_0483"
FT                   /product="primosomal protein N'"
FT                   /note="identified by similarity to SP:P17888; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851; match to
FT                   protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45472"
FT                   /db_xref="GOA:Q2GGY4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY4"
FT                   /protein_id="ABD45472.1"
FT                   /translation="MIAEILLPVPINKTFYYTIPENDMFCVGEYVLVPFGARTLVGVIL
FT                   KLNDMIPSDCNVEKLQLKVVISKNSLPRVNVALLNFIKWVSDYNIVPAGLVLKMVFSNV
FT                   VNAKSFSKLKFYAKQNDRCNSVEINLSNEQRIAYNSIVNKISGYSVIVLDGETGSGKTE
FT                   VYCEVIRELIKRDSTAQALILLPEIVLTLQLIKRIKHYFDSYYPVEWHSNLTLKNRKEY
FT                   WLSIAYGQSLIVIGARSALFLPYKNLKMIIVDEEHDSSFKQECGVLYNARDMSIVLAKN
FT                   LDIPIILSSATPSLEAINNVLKSQYYHVKLTQRFGNAKLPSVRIVDLCKSKMVNVWLSN
FT                   KLYNSILETLQRQDQVMLFLNRRGYAKLRLCKACGFKINCKNCATWLVEHKKKNILLCH
FT                   YCGYSCPMQDECTNCSDKSSLISYGVGVEKIAEDIVALIPNAKVAIISSDISSKDVSVM
FT                   IDMIMRNEVNVIIGTQVIAKGHNFPRLTLVGIIDADLSLNNSDLRATERTYQLLHQVSG
FT                   RSGRFADNGEVILQTYDTNSPLIKSLSSYNRELFYSLELESRLLTKMPPYTRLIGIIIS
FT                   GKDETHVINVSKQIVKSLPHTLTVLGPAPAPISFLNRKYRYRILIKVQHNVIIQKLLAK
FT                   YKEYYAKANKIRITIDVDPVNFM"
FT   gene            464699..465001
FT                   /gene="rpmB"
FT                   /locus_tag="ECH_0484"
FT   CDS_pept        464699..465001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="ECH_0484"
FT                   /product="50S ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44802"
FT                   /db_xref="GOA:Q2GGY3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGY3"
FT                   /protein_id="ABD44802.1"
FT                   /translation="MSRVCDITGQGKSFGNKVSHSNRKTKRAYLVNLHNVTLVSDILNR
FT                   KFKFKVSSRTLRTVNYKGGLDLYLLNTSSRKLTDKAQKIKKLVKNAVAKGVKVSL"
FT   gene            complement(465870..467132)
FT                   /gene="lysA"
FT                   /locus_tag="ECH_0485"
FT   CDS_pept        complement(465870..467132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="ECH_0485"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45270"
FT                   /db_xref="GOA:Q2GGY2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY2"
FT                   /protein_id="ABD45270.1"
FT                   /translation="MIFLANPFFHYKNNILSIENVNVLDIAKNVGTPVYCYSLNAIKNN
FT                   YRQFQENLPNNSIVCYAVKSNSNLSILSLLNSLGAGADVVSEGEIRRAIAAGISPNKIV
FT                   FSGVGKTEQEINFALDNRILQFNVESIEELSLINTIACQKNIIAPVSIRINPNINADTN
FT                   DKITTGLKVNKFGIPEELLDQIFNKDFTWIKIIGISVHIGSQISNLHIFQNTIDKIKKI
FT                   IKIFKQHNTQIIRVDLGGGLGIPYKSSDTFPTIQEYANLLKKNFENENYQIICEPGRAL
FT                   VGNTGILLTKVLYRKYNQEKSHIILDAGMNDLIRPALYNAEHTIIPAISSTSTQLQPCD
FT                   IVGPICESDDTFAHNYHIHNLQNGEIVAICTAGAYGSSMSSNYNSRLLIPEVMVNNSSY
FT                   DIIRSRQTYEDMLKDEIILEF"
FT   gene            complement(467410..468423)
FT                   /locus_tag="ECH_0486"
FT   CDS_pept        complement(467410..468423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0486"
FT                   /product="ribosomal large subunit pseudouridine synthase,
FT                   RluA family"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44663"
FT                   /db_xref="GOA:Q2GGY1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY1"
FT                   /protein_id="ABD44663.1"
FT                   /translation="MITVYYFDINYNIKMLEKKIFIKSGDENNRLDKFIASKLNISRNQ
FT                   VQQLIKDSKILLFDTIIRDNNHITKVNDIYNISIPIKTISDTITPNHYIPISVVYEDHD
FT                   IIIINKAPGITVHPGAGTNNNTLVNALVAHYGNSLSHVGKATRPGIIHRLDKDTSGLMV
FT                   IAKNEKSYYFLSDLLLKKQIKKEYLAVVWGLPNPKSNTIKNYICVKPNNKQMMTVTHLP
FT                   HKGKLAITEYQTQKSFSNIASLIKCRIHTGRTHQIRVHMSYIGNSIIGDQKYGKNNSKS
FT                   VKYAKQSTIINTLKRQALHAYKLGFTHPTSNTYIEFHSYIPNDIQMLIDELEQLSQ"
FT   gene            468541..470508
FT                   /gene="pccA"
FT                   /locus_tag="ECH_0487"
FT   CDS_pept        468541..470508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccA"
FT                   /locus_tag="ECH_0487"
FT                   /product="propionyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.3"
FT                   /note="identified by similarity to GB:AAL66189.1; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02785; match to
FT                   protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45182"
FT                   /db_xref="GOA:Q2GGY0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGY0"
FT                   /protein_id="ABD45182.1"
FT                   /translation="MIKKILIANRGEIACRVMRTARKMGISCVAVYSNADVYSLHVLSA
FT                   EEAVNIGPAPVNQSYLNMEKICEVACNTGVDAVHPGYGFLSENADFPEKLEQYNIKFIG
FT                   PSSTSIRMMADKITSKKIAESAKVNIIPGYMGIVDSVHEAKEIAKSIGFPVMIKATAGG
FT                   GGKGMRIVKSSEEIEQAFTSATNEAAKNFRDGRIFIEKYVELPRHIEIQIIADKHGNIV
FT                   CLGERECSIQRHNQKVIEETPSPFLDEETRQKMYQQCVNLAKKVGYYSAGTIEFIVDQD
FT                   KQFYFLEMNTRLQVEHPVTELVTGIDIVEEMIRIADGEELRFTQQDVKFTGSAIEARVY
FT                   AENPTKNFLPSSGRIAYYSAPMPNDNLRIDSGVFEGAEVSMFYDPMIAKVCTYGKNRDE
FT                   AVSFMQRYLNEFYIGGIANNIDFLLSVFHHPVFISGNINTKFIEQFYFDGFQGNPLTKA
FT                   CIKLFILTSLCIFFQDEYGIHGVELCENRELAVYVDGQKYLISAKYENGRVLAIYDQCE
FT                   YLVVSTWNVNFKILQIQVNNDEVFHVKVDSRLNKYQLKYSAMSALCAVYKPCVSDLLPI
FT                   MPQISGEELYSSNVCSPISGMIVKIYVKQGEEVQPGQPLLVIEAMKMENVIYSDVKSIV
FT                   KSVLFSEGNSVATGDVIIEF"
FT   gene            470792..474883
FT                   /locus_tag="ECH_0488"
FT   CDS_pept        470792..474883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44508"
FT                   /db_xref="GOA:Q2GGX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX9"
FT                   /protein_id="ABD44508.1"
FT                   /translation="MIQIDNVRLENHFLYIDIIYNSDDDRKKILNVLPRGVIQEDLVDC
FT                   RLTVKKSDLIFFKTQLHNPFRATAGNNEYNIRLMMYLIFEATDLWELHCCDIYSSIKGH
FT                   YQHDQRECKGIFQQLMSYFFKSKECVGRMGEDCVRDLNPLCFPNPELLRSKLCIHSDGK
FT                   YYVFLSTIKEYEDSVLFKVITKKLQMLELESAKSSDDSVLLKILDQKKCLQYFIACLSD
FT                   VNCFNSLAVPFHVFLEALNILISDQVIVKEIEGLLRERQLHDMINHVAYKFFQDKKQYG
FT                   IDVYGQGLEKAHDIYYELYGNNLPEDNLAVKKAILSLQNVKFNITANLDFFIKMNSDKG
FT                   ILRAQQYFRGLTALVEAEINFLQKFQDVLVIKDLDLFLKVTCKNVHDDINRLLAAYDFF
FT                   MQKKIVDRNAILKFTKKELLELTQYTNSRVLLLKEIVRYMNDSIRAKNINKSFLSERVI
FT                   GFIVDNHPILSTQLLKDNRLISSIDFPGLIDSIVCVNGKWIIRNKEKNKWLLRQLKLHS
FT                   LIDYLDINIDCLDILDELWDKKISDSKFLGILRVIINNSHTDKKFIYDVKVSKSLRVLQ
FT                   VLYRISHFIPFSSIWRYYINPSRYRTTPGYVGDNVKEKLYTQNKKIPVTSFSSKIIENI
FT                   KLCNSEERYVQSYYEAKFLKKRIRKDNNIAGRFEKLKIRLLSNRFVAYVLFGLMFVIIL
FT                   ISAIVGRILMHFNIIPGVFIGKFIYGMQGIFDSLCVVVGLDTIVDKGLSLILDTAGIIV
FT                   RVLDFILLCGLLSECIRFFIKLVYLICKHVYKVCENIYEFLKIYGFKYSCIILLSKIWF
FT                   IKHREFETCQQQRESSEQGYDINGGLIEALEQIYGKVKVSDGLSSRIISMTRELSSQID
FT                   QILCCNKPKPEFLLKEFESHTSKLPQDVVGNVNYIKLKYEFSYLLNNYTEKINYCSDTD
FT                   RLNILNSFQKRSALYDKITAVNLQTRYFHKDSCVKICNTRDVERIFAEANTMGDIVTVE
FT                   LLDAKIASLKWAIHMLDVHDVYNIKNRSEPVFLNTKVDHSMTVVLYDCILRLQNYRKQL
FT                   QFGKLISKKFIDTDIDSNFSPYIRDVYHVLQSLDDNSMLNSQTSSIRIFVENFFDSNSL
FT                   LLKKPSDKAKDLANYIKIDKGTVSCMSRIKKSIYEFIEYFQDPKSISISFILYYLLRLT
FT                   NSITLLSIADYVTQITDHALDIVMLDGLYEYFTCTDFGKLLLVEFYQKGILFKDIMFMC
FT                   SEFDLGLLYNNIQTVQGSLHCQDINYSIYSSSFHRGNPAQEKISQMINGFIEVLCEGLF
FT                   IKGVQQLVNYFKKKVVYNIQYFMLHENMASNSVLFNTKCVSDCYYSADVKVVQEVGCRR
FT                   QRGELFLSDVDHTLELSIDR"
FT   gene            474931..476295
FT                   /locus_tag="ECH_0489"
FT   CDS_pept        474931..476295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44811"
FT                   /db_xref="GOA:Q2GGX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX8"
FT                   /protein_id="ABD44811.1"
FT                   /translation="MVDDKSYKTKSSSLNGLSEDANEKVSDVLHDVKTLAFSNINEDDD
FT                   FRFLGKVKLEDLEVQESILELDGAFNKFLIEHSGEYSGVIQSHEYDYDASAGEVQNLDL
FT                   DNFEIEESFLQKILDFFSELCEQNEDYIDFDYELDPLKRKRKKKKFILESIIEFLKRFL
FT                   RSGRSLNLKELLDEQISELQEELVNELDPERRKLLQERLMLLTELRAQMIQYGIGSNLL
FT                   FRFFLFASFVSSLIGLQQDTSSAKQYVKLAEVLGLSLHKGNEKVLDANSNSIVASQTLV
FT                   VTPPLSFFVYGYTLDVFRGKINDVSYKLQDQYFFVRDASLQLGPQYGVQGIFFAVATIM
FT                   NAIDQALRKVANAVKKAVDKLDIFEHSNKSSGLHDFDRVGQQSHSTIDYACTARMNFVQ
FT                   STATDFQCTTGLLSSLNYHRELKFSCSGVYNNSYLDNISVVQCSIQSNTMIYRGH"
FT   gene            477049..477942
FT                   /gene="lipA"
FT                   /locus_tag="ECH_0490"
FT   CDS_pept        477049..477942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="ECH_0490"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by similarity to SP:O05941; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44699"
FT                   /db_xref="GOA:Q2GGX7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGX7"
FT                   /protein_id="ABD44699.1"
FT                   /translation="MRSKPDWLKVKMPTGDTFYQVRNLMKLYKLNTVCEEAACPNIGEC
FT                   WNKRHATVMILGSTCTRACAFCNVVSGIPDKLDPHEPQNLAKAVGLLKLEHVVITSVDR
FT                   DDLEDGGSGHFVECIEEIRKNDQNVTIEVLTPDFLNKHGAIEKVADAAPDVYNHNIETV
FT                   PRLYAKIRPKARYFHSLYLLKTVKYKNPKVFTKSGIMVGLGETKEEIYQVMNDLRSADV
FT                   DFITIGQYLQPTPKHAAVDRYVTPEEFDHYKYVAYSKGFLMVASGPLVRSSYHAGEDFQ
FT                   RLKKNRAAMFMHAKSN"
FT   gene            478291..478363
FT                   /locus_tag="ECH_0491"
FT   tRNA            478291..478363
FT                   /locus_tag="ECH_0491"
FT                   /product="tRNA-Arg"
FT   gene            complement(478543..479811)
FT                   /locus_tag="ECH_0492"
FT   CDS_pept        complement(478543..479811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0492"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44577"
FT                   /db_xref="GOA:Q2GGX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX6"
FT                   /protein_id="ABD44577.1"
FT                   /translation="MHIRKKLGKLLKYRHIASRISLKNRKDRILSILSMTALVSSLGIL
FT                   FIILGSIVNNGYNALTTTKILLSITINNDTIEQQDKLTLRNNLIYFIHQSLEELFSNVI
FT                   DLSNPDNRKIIYNIINDTAHHNLADFLLKNPKSTKFNIWFQSSTTFNKAIKNKNINHAI
FT                   YQKVIAKLQNENRIKVSFNDALFTKYNSRSPENTGILGSLIGSMFTIIICLTFALPIGI
FT                   TSGICLSELIPKNKISSIIEISITNLASVPSIIFGILGLAIYINIFDIPRSSALIGGMT
FT                   LSLMMLPNLVTSTKQAFAAVPPSVKDAAFSLGASNMQVILHHSFPIALPSIMQGAILSI
FT                   ARILGESSPLIMIGMVAFIVDIPKDFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVAL
FT                   LLMLLILNLIVTFIRKKFDHFIF"
FT   gene            480037..480654
FT                   /gene="sodB"
FT                   /locus_tag="ECH_0493"
FT   CDS_pept        480037..480654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="ECH_0493"
FT                   /product="superoxide dismutase, Fe"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by similarity to SP:P37369; match to
FT                   protein family HMM PF00081; match to protein family HMM
FT                   PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45189"
FT                   /db_xref="GOA:Q2GGX5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX5"
FT                   /protein_id="ABD45189.1"
FT                   /translation="MFTLPELPYQQDDLVPYLSLEILGYHYNKHHQGYVNTLNTLVTGT
FT                   DFSKCTNEDLPKVIEVTSGDLGSRAIFNNAGQVWNHNFYWESMKKNGGGSPTGKLLDKI
FT                   NEDFGSMDGFNNAFINAGKSHFGSGWVWLVFDVNEQKLKIVCTSNGDTPITQYPKTHPL
FT                   LTMDVWEHAYYLDYFNVRQNYVETFLQHLVNWDFAAQKFLAI"
FT   gene            481051..481344
FT                   /gene="virB3"
FT                   /locus_tag="ECH_0494"
FT   CDS_pept        481051..481344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="ECH_0494"
FT                   /product="type IV secretion system protein VirB3"
FT                   /note="identified by similarity to GB:AAM00402.1; match to
FT                   protein family HMM PF05101"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44690"
FT                   /db_xref="GOA:Q2GGX4"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX4"
FT                   /protein_id="ABD44690.1"
FT                   /translation="MAGTVKADQLFKGLTRPTMLFGVSYIFAMLNFMICIMIFMYTNDF
FT                   RALFILGPGIHSVGFLASSKEPLFLELFMLRMKKCSKCLNRFYHNANSYDVM"
FT   gene            481344..483746
FT                   /gene="virB4-1"
FT                   /locus_tag="ECH_0495"
FT   CDS_pept        481344..483746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4-1"
FT                   /locus_tag="ECH_0495"
FT                   /product="type IV secretion system protein VirB4"
FT                   /note="identified by similarity to GB:AAM00400.1; match to
FT                   protein family HMM PF03135; match to protein family HMM
FT                   TIGR00929"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44837"
FT                   /db_xref="GOA:Q2GGX3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX3"
FT                   /protein_id="ABD44837.1"
FT                   /translation="MLKFQQLQTKKRKVIKREYHESNFIPYSEHWNSSTLMTKDGSMLK
FT                   VIKLSGYAFETADDEDLSIQNSIRNQMLRSISSASFGLYFHVIRRRRNAFSEGFASDKV
FT                   SSSFANYVNVRWREKHATKQSFTNDLYITIVREGGKKGVEFLSSIFDKFGKVASQDSWI
FT                   KDLQAISEDLDEVTNRVFTSLRNYAPRILGIRETPKGVFSEIMEFLLQVVNCGSFQRVL
FT                   FHVGNVSKYLPMHRLYFGHKTIQIVAHNECKYAGLISLKEYGQTTSAGMLDAFLQLPYE
FT                   FIITQSFKFTNRQSAITKMQIQQNRMIQSADKAVSQVVEISQALDDAMSGRIAFGQHHL
FT                   TILCTERSLKTLDNALSLIESELSNCGVYPVRERVNLEPAFWAQLPGNFEYIVRKAIIS
FT                   TLNMAGFASQHNYPIGKKFNNHWGEAVTVFDTTSGTPFFFNFHIRDVGHTAIIGPTGGG
FT                   KTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRALSGVYMVIEPRHPTGFNPLHLDDTP
FT                   DNRTFLMEWIKSLISVFNDKFTSEDITRINDAIEGNFKLKKEHRVLCNLVPFLGLDGPN
FT                   TLAGAISMWHSSGSHAAIFDNAEDLLDFNKSRVFGFEMSHLLKDPVSLAPVLLYLFHRI
FT                   SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSAIS
FT                   DTLVQQTATQIFLPNLKATSAYRNVFMLTEREYTLIKHTDPSTRFFLVKQGVGAVVARI
FT                   NLSGLEDIISVLSGRAETVLMLHDLIKEVGDDPNVWLPIFYERVKHV"
FT   gene            483786..486266
FT                   /gene="virB6"
FT                   /locus_tag="ECH_0496"
FT   CDS_pept        483786..486266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="ECH_0496"
FT                   /product="type IV secretion system protein VirB6"
FT                   /note="identified by similarity to GB:AAM00403.1; match to
FT                   protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44935"
FT                   /db_xref="GOA:Q2GGX2"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX2"
FT                   /protein_id="ABD44935.1"
FT                   /translation="MLKVSKSIIYVLMLFLINVNFICAKSTLAAEVESEKVAVYRTTIA
FT                   SNPLYAKVSEHAKYIGIAGFTAGFALIIGSIFFLNPATWYVALGMFLAGMAAIAFAAAK
FT                   AAPFFACNWSFVRHPIMRFDTHDAKRNGNTEGSYKECEEPTKNYPDCTNRDFGSEEEYF
FT                   RCLVTGDKDSTKPVSINNAKQNEPVCASQKFKKVDKYYWPKNRISSSNYIEVCYRNPIG
FT                   SLNPITMIKRASEASSGNVTELLKKGEYPREGDYSTQEIKVAKYAMQGEVKCEVLQAGQ
FT                   EKVIHTITFQAVEKADKLCVYATKSIGIPLWPQVEIGCHMRPSGPPVPMCEKSTPVMSD
FT                   DNKRIVSYDNSKCYSCYIDPACRGEVGPHIKSVFPMTSIIVSCIKGSLSNILTGQCGQN
FT                   ASKKVGFLKVAQDKLKKAVMAVLVLALILFAIKAALGGIQSPAELYMLIIKFALVVYFT
FT                   QGSAMSHYYDQIVKLSIGLSDMVLQAGGSQTICDYSQSDYEDKYKYIAPWDRLDCRVLF
FT                   YLGQQVNGGAATIVLGVLLSAGLFFATMLFNMKLMLCLIAIFAVIMLLLIMIWLVYIFL
FT                   LSLIALTILILISPLMIPMVLFQATKGFFDGWIRQLMVYTLYPVILFAFLALLFTVFDN
FT                   LYFEDLKFKRKEVNVLGQKRITFTLNDPRECDDPKYDNNLACMFGNIEFITKPAFFGFN
FT                   AYAPDFKHGAEMLWMKLLMMVLIGFLFYHFLSSIAYIAAELAGDPRAGHVGSSFTPKSM
FT                   LASIVGLAAKVQGSVGEQAKKAITDKLDDRKKSASDGGGKDELSGGSSEGAGDAAEGAG
FT                   GGAGGSGAASGGGG"
FT   gene            486464..489232
FT                   /locus_tag="ECH_0497"
FT   CDS_pept        486464..489232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0497"
FT                   /product="type IV secretion system protein, VirB6 family"
FT                   /note="identified by similarity to GB:AAM00403.1; match to
FT                   protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45132"
FT                   /db_xref="GOA:Q2GGX1"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX1"
FT                   /protein_id="ABD45132.1"
FT                   /translation="MFKIVLIISIFLLSSCGYHGCIKPQSVLFDEYSTTVEAGLEDGKK
FT                   EHVAWVKSDLVLAGRQFLTIKVDTVNVNFCNNTKDVVNIFSSEGSTLDSSAKKFPVNIP
FT                   NIMKGEKLNFRLSPALKFTVDKDICKNNNPKVYVQNTSKCMEDYLDTEYYIPVDNYDFQ
FT                   MNNLMYLKDRGSANKDKEKSWINFPLKILYHLDRKTYRDVSQMNISKLSSDRYQNNNDL
FT                   FYLCVTDKRLNEYVTKIVEDMLNKTSSGNTAYSGDKKEQLISEKKESLLRKRDAVRKKY
FT                   QKLYDAYTVNMLCGNLCNIPGYDKQKLDKNCFVVETNNMLNSCTIEKSGISGCNLNEAG
FT                   QYSTVLPFLYLTHDSGITNFITVDDAVKKWQADNNSSSDIGLLTNHQYSISKDLDKNLY
FT                   LELRVKDDLELIGKYTIEVTKDCSNHVKDSLYYTISKGPPTVKPGEQGTTPLNFINNED
FT                   TIVKLTGNDEVGELYFGVKDNGDGYENNTGYFNITVIAKKKIPKVISYMVERLKDSLER
FT                   GLYGTSSTNSGGVNIIYNSIIENMHFIKIVNSLLVLYILMNALFYCAGFSKASIFELLT
FT                   ITLKISIIIYVIGPNSWDFFNNHLFKLFTEAPIQLISIMTGQDPDTSTSFEFLDIILYR
FT                   FSLSESWLQILALLFAGPVGWVSVVLIFWGLVVLFLTIATAVITYLISIILIGLLLSIA
FT                   PFFIICILFRRTKAIFDSWIKSLVQTAMQPVIIFASFALLTQVIDNIIYAMFNFESCDV
FT                   CVLRPEFDIGITTIGFCLLEFLLPLGFSPVSVFTDNVRDSVNSDTVMFIGLPMPIVNIL
FT                   IFVIMANATKHFVGSSGEMCTSIFGSFANLSMVAEGAKESALGIIGMDQNSRMQRSRYQ
FT                   QMNEMNNQDSDGERRRDPLDLHSPSRSDDSTNRTSRGGVSIPENPPSSFGR"
FT   gene            489236..493642
FT                   /locus_tag="ECH_0498"
FT   CDS_pept        489236..493642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0498"
FT                   /product="type IV secretion system protein,VirB6 family"
FT                   /note="identified by match to protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44489"
FT                   /db_xref="GOA:Q2GGX0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGX0"
FT                   /protein_id="ABD44489.1"
FT                   /translation="MKKFIILLLFFVTGCGVNCIEGSKGISGNSVVVEVSPTVKKVSKV
FT                   LQPNWIDTELRVSKDQPPMRVAVTGALNMCPKDFLNPKNLIVPAVSCISDIKDISYKDE
FT                   STYQNIKDVCSNASLRTKAANSEYLSGVAHTVSAFRLNKGDAFKVSLIPRKVKVTDCSS
FT                   AALKELGVIYYSDDEIFEDSNCQQAIPAENICQNGVPKFYVKVNQECKESGGMAGAIPR
FT                   LQGTEVSALVDNTDTPYGNKIFYSEDAKKNWINAPFVYDARIIKNQKVNVETLKKHCTI
FT                   IKELNEKKIINHVDTISTSQFEYYQKQKAQGDITTDIIKELIDVINNFTTYDINCVCGT
FT                   ICNSKSKLVTGKEIATISNYGSDGNCIISGSYEYNKDATFEEISKAKLEDISKNANNSD
FT                   PIIQGLTAFFGTRVTHKQEKDARNYYCFPQKVQGGSCYADISSQNIDSNSLKSNISYAY
FT                   DSDESVTLRFAVIGEKQKYASYSGGYNIHVERICNFMYGKKLYMYIGDNPPTIFPGDPG
FT                   TIELFVPDPENPESGTGVYMINKDGSEKKSGKIYLGIDVRGYENQFDYSSLPGIESANK
FT                   YFVDFFIKRWNPNFSKVFVMIRDFLLRILYGVPKDTQVDNIAQALDVARTSKSQGAIQS
FT                   IYANQTGAGSLWRALQALCSLYIVFTVLGYAIGVVKFTKYDLGVRIAKIAIVVGLISQG
FT                   SWEFFSDHFFSIFIQGTSDLVAAFNGELDGDNSFRFLDTTLGILLTGEVWIRLLTLILT
FT                   GPIGWLIFYIIFWAFFVFFMCVIEAIIAYLLTIVAVAFLATLAPIFITFIFFQLTKTLF
FT                   DAWVKMLVNFSLQPIILFAALAFLNQVVLTVLYKVTSFTVCNQCYLGFDLPTSAVEEGA
FT                   PYDICLVSVLLPVGYSPDLSITESIRESYVQGNGGLLGLPFDIASALILLLAAHAMRGF
FT                   KGMSETIAHSISGSVAGLSASVYGATQALASIVGRDQETQNIIKEAMRNRKSTGKSDVD
FT                   IVSRSNPNPESRGESVERSGGSDSDLPPKGHDGGLRTGISDKGDNVPQQPQSGDDIKED
FT                   SKTGRASEQLHNDVSPLSSSSVLDTTPFTLSYNEMQGADNLDSNPSVTRNDTSADGTSG
FT                   MDSQDASSDAGSELHGDGDTGNVATTQDTGDNEGDGAQNGSRDNGENAGNASNVTEQDT
FT                   SSGENDEVQGGSRDNSESADDASSITEQDSSSGESDEAQGGSRDNSESADDTSSVAEDT
FT                   SSDESDEAQGGSRDNDENGDSTLSVAEQDTSSDESDEAQGGSRDNDENADDTSSVAEQD
FT                   TSSDESDEAQGGSRDNDENADDTSSVAEQDTSSDESDEAQGGSRDNDENDDSASSVTEQ
FT                   DADSVSDGTEVSTSDGDNNLGNDQSTDNTLDGNENTSGNNDTDVQEEAGKASSVVESSD
FT                   SDDSDGRKRGRKDINFLDGPQRKRLYMDEYSSVAEKIAGHESAIAVEEESYERGIVKKR
FT                   GKKDQQE"
FT   gene            493681..501957
FT                   /locus_tag="ECH_0499"
FT   CDS_pept        493681..501957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0499"
FT                   /product="type IV secretion system protein,VirB6 family"
FT                   /note="identified by match to protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45088"
FT                   /db_xref="GOA:Q2GGW9"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW9"
FT                   /protein_id="ABD45088.1"
FT                   /translation="MCNFIKKGFIKLLLLLVITACESNQHPVPRCVPADVFTETRTASV
FT                   SAYFDSRSEDFIADNKSLGNIVKNDQVVRWKYTGYVTDGRPIVLKAEGMWTAWVNDVSA
FT                   EKSVSFGDEDSEHYNQILSVERICGPYNKIEKTFVPDGHSECKVSCELITGVKDDLERG
FT                   AYGPPCWFKNGYGAYLLFKRPDDPEPNETLDHMRYPVSPVMHIGYKPLELAGSDVFSTK
FT                   NKPIMNSLCQKVQLEPGWKIYVKILDKYYYDNVGGYAITFLEGVKTEKQFSVFEWVRKQ
FT                   VRGELDKAGEQVFRHLVGNPIFKNFIFSVLTLFLVFGALAYIFGMVQSPFGDIIIRILK
FT                   ISLVILLISPSSWEFFYNHLLALFIHGIDQIIALINSHTGSYNPKEPFSFLDDMIVNKI
FT                   FSPVIWKIKIRALIIADFSSIFAVCVIIIAVFIYIALCMYGCVIYLTAFVGITFLIGLF
FT                   PLFLLGILFSQFKSLFDGWLTQCVSFAMQAILMFTLISLFGALIMNYYYRIFGFTTCYN
FT                   EWLKVKICVLGKIGCIVDQSIFGWTPGQTYDPKVIGLTTDFNLNDRKSSGSARYKFTGG
FT                   GAYIDVPPDRKHKDFRYVDYPFLDPDAKTDGNPFGVTVSQDSPFRQLSYYINALLSSNK
FT                   KYVAARLVKDIEDELDVLEKNGTISLNSKNKVLQIIQQRRTKDNSEKKSELEKYKDEDF
FT                   KSQIIDSIIADVIGSAAQERTPQEELNKQYDYWLILRVRAGYLIFWTEVGSLLLAALLI
FT                   WQMRAFVQSVAVSLAGGNMMSQTIASMYEGGFMKIFSGIPVVGVVFQKIDQGIDGLKFA
FT                   VGNYITAVARMPLNALKSIPYLGAAVKFTAGVTGALTSSYNEYDRSFSNNFKRLNYARA
FT                   FIGAHLGFSPLDALKYLGGHVAGKMLGNRDGGLIHNAIEDRKAALDSLKAHILGPEKHR
FT                   PSPYIPNKKKETEDDDARNPFSKETVGNKSGTVSPDEYKGGDKNHIIREGLRSEAGSAL
FT                   SDDYKDGDKSHIIREGLRSEAGSALLDGYKGGNGSDIIKGGLPTEGSTLLDRYGNVCVS
FT                   EGNIEHALEVREQLKTMLDNAENDTALQTIQYDCDRLDNALHEYLGDKFDDVTQGYASS
FT                   RDPMGHPQDLITEDLSKISASSDFRDLNAIDLGTQVQVGSDIGSDVLQQGSADGNRSEV
FT                   EVSMDISKRDALLEQMELKGMEAASGTEAQLYDSAELSTPLDVTSSINNVSSEVSQQDL
FT                   ASNGEIEVSLDKDLELKNLDVVSGDIPDVEVTSSSDDVTQIYDSAQDRDSCLDIISSAD
FT                   DASSEVSQQDLASNGEIEVSLDKDLELKNLDVVSGDIPDVEVTSSSDDVTQVYDSTEDR
FT                   DSCLDIVSSADDTSSEISQQDLEGNDGYEIDKDMGSSNESMLDEIPGGFADVIQDCSDA
FT                   SLSTPLGMSARDDTDATDTVEDPKENVLPQDVDLEDLDTTHSTNDIADFSGESSLFDAT
FT                   SESDSAAFVGEQSIDFSTEEGSDLPSEVVAQHDVDSQDSSVSVSDMAVADMEQGTEDSK
FT                   YTDVDGLSDSVLDLGYLEGNVDNPDIEPEHDMSQQYSTETEELSDMLSDDVIEPEGVSE
FT                   TDTQVDSEESQDDSGTAGQVEDERVHDEVPYDTQDSTSGDKGDIAEHDDKDGVVEHEDT
FT                   VDQSIDDTHEEEGKFTEGIVSESVTEPEGVSETDTQVDSEESQGDSSASDQVEDERVHD
FT                   EVPYDTQDSTSGDKGDIVEHEDKDSVVEHEGTVDQSIDDTHEEEGKFTEGIVSESVTEP
FT                   EGVSETDTQVDSEESQGDSSASGQVEDERVHDEVPYDTQDSTSGDKDDIVEHEDTVDQS
FT                   IDDTHEEEGKFTEGIVSESVAEPEGVSETDTQVDSEESQGDSSASGQVEDERVHDEVPY
FT                   DSQDDTQDSTSEDEGDVVEHGDKGDIVAHEDKDSVVEHEGTVDQSIDDTHEEEGKFTEG
FT                   IVSESVTEPEEVSEADTQVDSEESQGDSSASDQVEDERVHDEVPYDIQDSTSGDKGDIA
FT                   EHGDKDDIVEHEDTVDQSIDDTHEEEGKFTEGIVSESVTEPEEVSEADTQVDSEESQGD
FT                   SSASDQVEDDKVHDEVPYDSQDDVEHGDKGDIVAHEDKDSVVEHEGTVDQSIDDTHEEE
FT                   GKFTEGIVSESVAEPEGVSDVDTQVDSEESQGDSSASDQVEDDKVHDEVPYDSQDDTQD
FT                   STSEDEGDVVEHGDKGDIVEHEGTVDQSIDDTHEEEGKFTEGIVSESVAEPEEVSEADT
FT                   QVDSEESQGDSSASDQVEDERVHDEVPYDAQDSTSGDKGDIAEHGDKDDIVEHDDKGGV
FT                   VEHEDTVDQSIDDTHEEEGKFTEGIVSESVTEPEGVSETDTQVDSEESQGDSSASDQVE
FT                   DERVHDEVPYDSQDDTQDSASEDEGDVVEHGDKGDIVEHEDKDSVVEHEGTVDQSIDDT
FT                   YEEEGKFTEGIVSESVTEPEEVSEADTQVNNEESQGDSSASDQVEDERVHDEVPYDAQD
FT                   STSGDKGDIAEHGDKDDIVEHDDKDGVVEHDDKDGVVEHEDTVDQSIDDTHEEEGKFTE
FT                   GIVSESVTEPEEVSEADTQVDETLQDLEHEDLKEGADDISDSETDENSSGNSDSVSDVE
FT                   GLASLASIGEESTITQNVKTQSVQSSAILSMKDRDGVLDNKGIPSDQLDVKDTEKKKKE
FT                   SSKSKVENSDKKAKSTKATVTPKSLKKTFKVILSQCTQELSNKLSEAFDKLFIDPQSGK
FT                   QKRRLSKQDIALMIEQLKAMIESLKDRKAQVTDPDEMKAIEESIKQAESTIQNLLNQE"
FT   gene            complement(502109..502708)
FT                   /locus_tag="ECH_0500"
FT   CDS_pept        complement(502109..502708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14953.1; match to
FT                   protein family HMM TIGR02217"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44551"
FT                   /db_xref="GOA:Q2GGW8"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW8"
FT                   /protein_id="ABD44551.1"
FT                   /translation="MTFHEIRFPEDISYGSTGGPEFSTNIIETNNGSEYRRINLSYPRN
FT                   KYNVMYNTKSKDQLVRLIHFFYIHKGKAIGFRFKDWLDYKAKKQQIGIGNDQQKNFQII
FT                   KTYSIDQYSYTRIITKPVMNTVKIYYNNIIKADGFSINFLNGQIEFNNPPHNGVKIHVD
FT                   YEFDVPVRFDSDYLPYSINNYKEYNCNNIALIEVKV"
FT   gene            complement(502914..503381)
FT                   /gene="dut"
FT                   /locus_tag="ECH_0501"
FT   CDS_pept        complement(502914..503381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="ECH_0501"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44924"
FT                   /db_xref="GOA:Q2GGW7"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW7"
FT                   /protein_id="ABD44924.1"
FT                   /translation="MEHSIIPNMSIKVIKLTKNNLPLPSYSTDNSSGMDLYSAVVTDVI
FT                   LEPGCRVCINTGIAISVPNGYEAQVRPRSGLALKFGITVLNTPGTIDADYRGEIKVILI
FT                   NLGNEAYTIKYGDRIAQMIIAPITRISWDLVEDFDNDKTKRGAQGFGSTGI"
FT   gene            complement(503528..504487)
FT                   /gene="ispH"
FT                   /locus_tag="ECH_0502"
FT   CDS_pept        complement(503528..504487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECH_0502"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by similarity to SP:P22565; match to
FT                   protein family HMM PF02401; match to protein family HMM
FT                   TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45537"
FT                   /db_xref="GOA:Q2GGW6"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW6"
FT                   /protein_id="ABD45537.1"
FT                   /translation="MHQNLKKNVEVILANPRGFCAGVSRAIEIVKLAVKYHSDNRKVYV
FT                   LHEIVHNKYIINSLKEMGVIFIDTLDQAEDGSILIYSAHGISKEIEHLGQSCNLEIIDA
FT                   TCPLVNKVHKEVQAYDKKGYQIILIGHKGHREVEGTMGQITNPVLLVQNLSDIDNIEVT
FT                   NSDKLAYVTQTTLSVDDTKEIINKLKQKFPNIKGPDLKDICYATQNRQTAVKQLSELVD
FT                   IIFVLGSKNSSNSNRLKELAELKTPAFLIDSYQEINLDILKDVNKIGITAGASAPEILI
FT                   TEVIDLLKQHMNIKLSDLEVIRENVAFNIPKQLREYKL"
FT   gene            complement(505048..506163)
FT                   /gene="carA"
FT                   /locus_tag="ECH_0503"
FT   CDS_pept        complement(505048..506163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECH_0503"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by similarity to SP:P00907; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00988; match to protein family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45433"
FT                   /db_xref="GOA:Q2GGW5"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW5"
FT                   /protein_id="ABD45433.1"
FT                   /translation="MSQLTSYYNSILVLSDGKHFFGKSIGKKISTVGEVCFTTSMTGYQ
FT                   HTITDPSFAGQIITFTFPHIGNVGINYKDFEDRKILTHGIIVKTISEDSHSSSYSNLEL
FT                   WMIENNLTGISEIDTRALTCHLRQHGSQNGIIYHFDNINSINLAKLQKKASQYNYRDHC
FT                   SSISFVNNYNSTDDDTLLYNIVVINFGIKLSILDALSKLRCKIHMISGNEDNLSEKVLF
FT                   IKPQGIVLSNGPGDPSAIPENIIKQIKTIIESKIPILGICLGHQLISLALGAKIIKMLF
FT                   GHRGSNHPVYNKINNNIEITSQNHGFTVKEDSLPTNVQVTHRSLFDNTIEGIQVNDYPI
FT                   ISVQYHPEGSPGPNDASYIFNHFINLIREND"
FT   gene            506393..507721
FT                   /gene="engA"
FT                   /locus_tag="ECH_0504"
FT   CDS_pept        506393..507721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="ECH_0504"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by similarity to SP:P77254; match to
FT                   protein family HMM PF01926; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44763"
FT                   /db_xref="GOA:Q2GGW4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW4"
FT                   /protein_id="ABD44763.1"
FT                   /translation="MLKIAIVGLPNVGKSTIFNRLTSQKSAIVSNIPNLTRDRREGDAD
FT                   LCGLKFKIVDTGGVDNTIKLSSLVLDQVKLSIEESDIIFFVVDARIEHDDKNIEFAKYL
FT                   RKKVKKPIILIANKCESQKRCYSIDYLGYFDFIGPVYISAEHNLGLVDLYEALLPFIKE
FT                   YDLNTLDLHNIKLSIVGRPNAGKSTFINRLLAENRMIVSPEPGTTRDSIDVEYTYRGQK
FT                   FTLIDTAGMRKKAKVTESIEVTSVHKTIESINRSDIVILMIDSVYGIEQQDLSIAELAI
FT                   QKGKAIIIALNKWDMIAKKDRSELLKDICNYNKLNFKVPVIEVSALKNINCNKIIETSI
FT                   ELYKCLTMRISTSVLNKWLKLAVEYHKPPLCNGKVVKIKYITQVKVIPPTFIAVVNGSY
FT                   SIDLTYRQYLMSSLRKHFSIDGIPIRLNFKKNKNPYDDSYSKS"
FT   gene            complement(507783..509288)
FT                   /gene="gpmI"
FT                   /locus_tag="ECH_0505"
FT   CDS_pept        complement(507783..509288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="ECH_0505"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by similarity to SP:P39773; match to
FT                   protein family HMM PF01676; match to protein family HMM
FT                   PF06415; match to protein family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44599"
FT                   /db_xref="GOA:Q2GGW3"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGW3"
FT                   /protein_id="ABD44599.1"
FT                   /translation="MTNHSVILCILDGWGNSENSQFNAIAQSYKPCWDNTILQYPKSQL
FT                   ITHGLNVGLPDGQIGNSEVGHVNLGSGRIVLQDLCKINNEIKYIKNNRYLLEFIKKIKQ
FT                   NNGICHIAGLLSDGGVHSLHTHMLDIIDTLSNFQIQIAVHIFLDGRDTPPISAIKYINI
FT                   LREHIKHLNNVNIATISGRYYSMDRDNKLDRTRTAYKAMAFADAKRYTDPSLAIQDSYN
FT                   AGITDEFILPCVIGDYNGMNPQDGFIMTNFRSDRAIQIIKMIIGDIKTDNHITLENTIG
FT                   MVKYSESINIPCLFPNNNITNTLGEVIANHKLHQLRIAETEKYAHVTFFFNGGREDTFE
FT                   NEDRIIIPSPSVTTYNLMPEMSAKEVTNTVIERIKLQKYSLIILNYANADMVGHTGNIE
FT                   ATKQAITALDQCLNKILNCIQGTNYVLVITADHGNAEEMFDVKNNMPYTAHTLNPVPFI
FT                   ICNYSKQIRLKNGRLCDVAPTILEILNIEKPKEMTGISLIEYI"
FT   gene            complement(509422..509712)
FT                   /locus_tag="ECH_0506"
FT   CDS_pept        complement(509422..509712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45585"
FT                   /db_xref="GOA:Q2GGW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW2"
FT                   /protein_id="ABD45585.1"
FT                   /translation="MLQFKILSCKAIVLLLSMYSILCFQYLNFYRISQHNKIYTSLLNN
FT                   VFYSSKLLFEYFYTILNTLFITSKHTIITKSTISHYKSHINLNITDFQRLN"
FT   gene            509562..509681
FT                   /locus_tag="ECH_0507"
FT   CDS_pept        509562..509681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45380"
FT                   /db_xref="GOA:Q2GGW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW1"
FT                   /protein_id="ABD45380.1"
FT                   /translation="MMSKIHYLKVKYRFCYAGIFYKNLSTESRVLNTLIGVEQ"
FT   gene            510129..511283
FT                   /locus_tag="ECH_0508"
FT   CDS_pept        510129..511283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0508"
FT                   /product="PQQ enzyme repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45108"
FT                   /db_xref="GOA:Q2GGW0"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGW0"
FT                   /protein_id="ABD45108.1"
FT                   /translation="MIRSSIVLLIVLVFFNPMLLLASEVIEEHDLYKASDNYDVEHIKD
FT                   HDVQYDSLISKDKISLKMHKNAIPVFVGNKIVFLAKDGVLRSVDSGNVKKCYWELGITK
FT                   HTNLYRASILYSENMIFYIADDNVYCIDFETGEIKWQKELRSVIAGSPVIIGNHLMVVT
FT                   VDNCLYFFNVSDGSLISSNQESLPEVKSYSSLSSASYGETVIFSFSNGKIAAFNSLSGL
FT                   KIWESDASNTNVAFAHGISLEATNGTVIAVDKLHSISNIDIESGKTRWSKNLKVKGISK
FT                   IERGNIATVIDNKLVLMDISTGDFLWQYDLLQHGKPKNQWNAPIIMNDEVLVIGDDGCV
FT                   VLIDYKSGALKLINHILPSTYYVPVFVNSSLYVVTNKGKVVIFH"
FT   gene            511305..512696
FT                   /gene="lpdA-1"
FT                   /locus_tag="ECH_0509"
FT   CDS_pept        511305..512696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA-1"
FT                   /locus_tag="ECH_0509"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44626"
FT                   /db_xref="GOA:Q2GGV9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV9"
FT                   /protein_id="ABD44626.1"
FT                   /translation="MQNYDMVVIGGGPGGYKCAIRGAQLGLKVACIDKNEILGGTCLRV
FT                   GCIPSKALLHFSHEYYHLKNNLSEVGITFDNLNFDLEKIMSFKDKNIAELGNGISYLFS
FT                   SHKIDYLCGVGKIQSVGPNNFIIVISGNNGKQEIISRYVVIATGSDVANFPDIDEERVV
FT                   SSTAALSFKEPPKRLIVIGAGAIGLEMSSVWSRFGSEVTVVEFSDKIAPSMDGDIGKAL
FT                   LTSLKKQGINFKLSTKVSSIDKKGSNLAVHLESVKDGKSEIIEADKVLVSIGRVPYTNG
FT                   LIDNNSIECDARGFIKVNNKYETNIPGVFAIGDVIGGAMLAHKAEEEGIAVAELISGHV
FT                   PHVDYEIIPSVIYTHPAVASIGKTEESLKKVNYSYNVGKSNFSANGRSKVTDNVSGFVK
FT                   VLASKENDAILGVHIIGAYADTMINEAAVAMAYRASSEDIFRICHSHPDVNEAFKDACE
FT                   AAFLK"
FT   gene            512716..513792
FT                   /locus_tag="ECH_0510"
FT   CDS_pept        512716..513792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0510"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44718"
FT                   /db_xref="GOA:Q2GGV8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV8"
FT                   /protein_id="ABD44718.1"
FT                   /translation="MLHKLLRVKLQYKIAFVILLLAIVWISSGVLKKYNQQKEEGVVIH
FT                   DNSPNIKVVESNAQDRVVYLSLTGEVEAFRYVNIVPEVAGKVSDVLVKDGEYVTEGNIL
FT                   VKIEKYEKEEQLKQTKALLKQRELEYKASQSLNEHGYRSEINDALSFAALESARADVKK
FT                   AQISLESTEIKAPFSGFVDKVNVQVGELVSASSGLSVLQLVNFDKIRVVTYVPEKYLSK
FT                   LKLGDVCKVLIAKNEEVDAPIVFISKIINRSTRTYRIEMVLDNNDLKIFTQGAVYSVKV
FT                   PIGSYRAHRISPSALDLQDDGDLGIKVIVDKRVKFIPVEVIDSEDNGDVWVANSPDTIQ
FT                   LITLGHEYVKDNAYIGIR"
FT   gene            513947..514195
FT                   /gene="infA"
FT                   /locus_tag="ECH_0511"
FT   CDS_pept        513947..514195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="ECH_0511"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44709"
FT                   /db_xref="GOA:Q2GGV7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV7"
FT                   /protein_id="ABD44709.1"
FT                   /translation="MVTKEGIIEAEGIVIKLLRDATFMVRLNDNYEIIAHASGKIRKSK
FT                   IRILMHDRVLVEISTYGINKGEVGKGRIIRRLKVTDA"
FT   gene            514188..514766
FT                   /gene="maf"
FT                   /locus_tag="ECH_0512"
FT   CDS_pept        514188..514766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="ECH_0512"
FT                   /product="maf protein"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44795"
FT                   /db_xref="GOA:Q2GGV6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGV6"
FT                   /protein_id="ABD44795.1"
FT                   /translation="MLKFDNLILASSSEQRLSLLEQIGVIPGQVVSPDIDEVVLKKELP
FT                   KVYSIRIAKEKGTKVRVLYPDKFILSADTVVCCGRRVLPKAETEEQALECIRLISGRRH
FT                   RVYTTVCLYTPYNKLHCRNVMTIVKFKHLSMQEINSYIMSGQWKGKSGACSIQTSAGKF
FT                   VLSINGSYSSVIGLPLYETYSILSQYFSI"
FT   gene            complement(514781..514924)
FT                   /locus_tag="ECH_0513"
FT   CDS_pept        complement(514781..514924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45466"
FT                   /db_xref="GOA:Q2GGV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV5"
FT                   /protein_id="ABD45466.1"
FT                   /translation="MLTMLAIATILSKKFIIINYSTIISVQYKIVTPLIATYNYSLDLL
FT                   HQ"
FT   gene            515091..515957
FT                   /gene="rpsB"
FT                   /locus_tag="ECH_0514"
FT   CDS_pept        515091..515957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECH_0514"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by similarity to SP:P02351; match to
FT                   protein family HMM PF00318; match to protein family HMM
FT                   TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44907"
FT                   /db_xref="GOA:Q2GGV4"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGV4"
FT                   /protein_id="ABD44907.1"
FT                   /translation="MVNLPKFTMRDLVESGVHFGHKASRWNPKMAPYIYGVHNDIHIIN
FT                   LQNTVVLLKNALKALYDIVLKRGRVLFIGTKVQASAIIADEAVRCGQYYINNRWLGGML
FT                   TNWETISLSIKKLKEYEKLIENVDNQFTKKELLLFEKKRAKLDRSIGGICNMGGLPHAL
FT                   FVIDTNKEHIAIKEANKLNIPVIAVLDTNSDPAGIDYPIPGNDDAVRSIDFFCKIVSDT
FT                   ILEAIRSDLAKSGINVDGIKDFSVEKREDLLRANNRDHKNNKNNSTIDNAENLKEENLV
FT                   GGSNNES"
FT   gene            515947..516813
FT                   /gene="tsf"
FT                   /locus_tag="ECH_0515"
FT   CDS_pept        515947..516813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ECH_0515"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by similarity to SP:P80700; match to
FT                   protein family HMM PF00627; match to protein family HMM
FT                   PF00889; match to protein family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45414"
FT                   /db_xref="GOA:Q2GGV3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGV3"
FT                   /protein_id="ABD45414.1"
FT                   /translation="MKVDINAVKELRNLTGAGVGDCKEALNSCGGDIEKAKNYLREQGI
FT                   AKAYKKSTKDVSDGLVAVHVNGNQGAILEVNSETDFVARNEKFQKLVLNLVSLANQYAV
FT                   EDIEDFLKHEYVSGTSIHDEIMTNIAVIGENIHLNKIGYLSVNAGVVGGYIHSPVVNNL
FT                   GKIGAIVALESTADNDKLNVLARQIAMHIVAARPEALSVDLLDKDILDKEREIIKKQVD
FT                   QLNKPVSVAERIIDGRIAKFYQDVVLLEQIFVMDNQLTISELIKKKESELGASINLVGY
FT                   KLFVISK"
FT   gene            517178..517540
FT                   /locus_tag="ECH_0516"
FT   CDS_pept        517178..517540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14090.1; match to
FT                   protein family HMM PF04635"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44629"
FT                   /db_xref="GOA:Q2GGV2"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV2"
FT                   /protein_id="ABD44629.1"
FT                   /translation="MDITPIICANKNVITGYGTGEFFINDNVYLGSHIVFPNKIISCLD
FT                   LNIFNLENIIELLDETLDIVLIGTGKNHIFLPNEVKNNFLKRGFNIEYMSTGAVCRTYN
FT                   VLLYEDRNVCAALISL"
FT   gene            517547..518350
FT                   /locus_tag="ECH_0517"
FT   CDS_pept        517547..518350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0517"
FT                   /product="putative cation ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to GB:AAK33470.1; match to
FT                   protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44840"
FT                   /db_xref="GOA:Q2GGV1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV1"
FT                   /protein_id="ABD44840.1"
FT                   /translation="MFFEIINEYFFVNGIIAILIVSLVTGSLGSFMIWKNLSYLGDSIS
FT                   HASILGVALAVLLDISISSGILCISIIFALLLSYSINKIYSIDTVLNIVTNVIMSSGMI
FT                   LLSFFPSASNNIIHSLFGDVLMLTNRDLIIMALVALVIITLVIYRWKYWLIISVSNDLS
FT                   ASEGVNVGFIKLEFLVILSVFIAFAAQLVGILLITAFLVIPAAAARLMSKTPLQMIVIS
FT                   TIISIFSGITGLLLSEKFDIFPGPLIIMVSFLFLLVMYCINRLID"
FT   gene            518439..519314
FT                   /locus_tag="ECH_0518"
FT   CDS_pept        518439..519314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0518"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45453"
FT                   /db_xref="GOA:Q2GGV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGV0"
FT                   /protein_id="ABD45453.1"
FT                   /translation="MSSFKNLIIRTTGFVIGSLLLIFSINMLMRRCSKRSNNVSIAVIL
FT                   LFSIGITVFFQIYGRNEHSLTFVNIKMYVMLLASSLIMFCIANLVLRKESECYSKFREQ
FT                   NKKIYFLKIDIANLEIQLNIMKREIEWFFDNLCSDTKICVDIKQEYLLPANKKFYDIGF
FT                   LCKTAKFVTFSIALVVFLCESFYSVLSQKFDLVGLFMYYVLISLFLFTFIIDRLALYSE
FT                   KNYKSISQNSKSIIDTLNTELNVKKRMYTVLLQEVSKYNILTEKELVNENNIRTLEKYK
FT                   NKIFDILDRV"
FT   gene            complement(519648..519779)
FT                   /locus_tag="ECH_0519"
FT   CDS_pept        complement(519648..519779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44967"
FT                   /db_xref="GOA:Q2GGU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU9"
FT                   /protein_id="ABD44967.1"
FT                   /translation="MHNTRLHYKSNIRLYKYILLIYYPFYTVTLYYFLTLILSNKTM"
FT   gene            519817..520380
FT                   /gene="petA"
FT                   /locus_tag="ECH_0520"
FT   CDS_pept        519817..520380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="ECH_0520"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P23136; match to
FT                   protein family HMM PF00355; match to protein family HMM
FT                   TIGR01416"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44971"
FT                   /db_xref="GOA:Q2GGU8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU8"
FT                   /protein_id="ABD44971.1"
FT                   /translation="MNNDEDKYSVFKTKVKRRDFLGLTTLSMAGIGLFSSVYPLIKFLS
FT                   PSAEVIAQSTVEVNLSDIKEGKTKVIKWQGKPVFIRKRTTQEIEEARAVKIDSLRDPQS
FT                   DQERTHQGREEWLIMVGICTHLGCVPVEVDDGKKGWYCPCHGSKYDTSGRIISGPAPLN
FT                   LPVPDYYFSQKDVIVIGVKGTDVA"
FT   gene            520405..521631
FT                   /gene="petB"
FT                   /locus_tag="ECH_0521"
FT   CDS_pept        520405..521631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="ECH_0521"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P23134; match to
FT                   protein family HMM PF00032; match to protein family HMM
FT                   PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45567"
FT                   /db_xref="GOA:Q2GGU7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU7"
FT                   /protein_id="ABD45567.1"
FT                   /translation="MSEHDNIKKTEGRGIRAWIEYRMPIGAFLKELASYQVPKNLNYAW
FT                   NFGSLAGIALMLQIITGIFLAMHYTPHVAHAFSSVERIMRDVNYGWLIRYTHAVGASFF
FT                   FIVVYIHILRGLYYGSYKSPRELVWFVGIFIFFAMMATAFMGYVLPWGQMSFWGATVIT
FT                   NLFSVIPLIGQDVVQWLWGGFSVDNPTLNRFFALHYLLPFIIVMLASLHVIALHRFGSG
FT                   NPSGIEVKSSKDTIPIYPYFIVKDCITFGIFFILLFLFVFYIPNYLGHPDNYIEADPMV
FT                   TPAHIVPEWYFLPFYAMLRSIPNKLLGVVTMIGSIAVWFLLPVLDKCKVKSGSHRPIFR
FT                   IFYLFFVVNFCFLAWLGGQEVREPFVTLSRLSTLYYFSYFFIVLPILSKYEKPVVLPKT
FT                   ISDAVPEMK"
FT   gene            521631..522389
FT                   /gene="petC"
FT                   /locus_tag="ECH_0522"
FT   CDS_pept        521631..522389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="ECH_0522"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P23135; match to
FT                   protein family HMM PF02167"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44580"
FT                   /db_xref="GOA:Q2GGU6"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU6"
FT                   /protein_id="ABD44580.1"
FT                   /translation="MILMRFLLIVYFVCVSFVCAAEEFKHLSPKKINWKFDGILGSFDK
FT                   QSIQRGYQVYREVCSSCHSMKRIAFRNLRDVGFSEEEVKAIAASYQVLDGPNDIGEMFE
FT                   RPGIKSDYFIPPFPNKEAAMAANKGAFPPDLSLIIKARHNGANYLYSLLTGYESHDPDE
FT                   SGLYTNPYFTTGKMSMAPPLSDGLVQYTDGTDSKVENMAYDVVNFLQWAAEPEMETRKK
FT                   LGIKVISFLLVLTIFVILANKRLWKDLYKK"
FT   gene            522829..524298
FT                   /locus_tag="ECH_0523"
FT   CDS_pept        522829..524298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0523"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS14436.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45211"
FT                   /db_xref="GOA:Q2GGU5"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU5"
FT                   /protein_id="ABD45211.1"
FT                   /translation="MKNLFVISAFTSLLMMSSYNAFSDEILDGIFGSNNKFINNTKNSF
FT                   SGINNKALVKGGRIKFAGDMISYTWYSSDDTRNSNKFSRVSKRFDIDTGGNINNVGAKH
FT                   DGMFSIEIDSNPDKHGIVYGAYSQINIPHVAGKSFGNNAAFNRGSKIFAKTPYGNFSVG
FT                   YQEGVESMMKLNAFSIVAGDDSNIWTKHLRNILHEKKDGQSGYSVYYFNFNSGLYSESL
FT                   FRNSDNIVFDDIDYYLGTGIISRSFINNLPFRLSYQSQNFMGLRFGVSYSPFGYDQRLF
FT                   ELQKDRNSDTLILVGPRYRHIVSGGISYTYNIKNLKFSASVIGEYGDEEHDYKAHYNRY
FT                   YRHNTLKAVSIGWNVGYDKIELAGSYGKLNSAGIPYDKCVIHGVPYEYVYRSVIHWLYL
FT                   KDMDYYWDIGIAYKYAPLSLSVIYFMSNRVGNELSDVNVGIEYDILKYSGFKSSLFANY
FT                   NYYTFRQFSDTYRIHVNGKGSILLVGAKLSF"
FT   gene            complement(524591..524716)
FT                   /locus_tag="ECH_0524"
FT   CDS_pept        complement(524591..524716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45221"
FT                   /db_xref="GOA:Q2GGU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU4"
FT                   /protein_id="ABD45221.1"
FT                   /translation="MLKKIIISIKNKIIKYWTHLAYEVKEVVKNRISTTWQYHNT"
FT   gene            524844..526844
FT                   /locus_tag="ECH_0525"
FT   CDS_pept        524844..526844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0525"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS14436.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44796"
FT                   /db_xref="GOA:Q2GGU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU3"
FT                   /protein_id="ABD44796.1"
FT                   /translation="MKFTLVASALASFFVLYGNILFSADMLGDVGIFNPNDGNNKQSNG
FT                   INGKNLFKTKDSGNGEYDRSSKVGRALVSGQAISYMWASSDEKKSFYDISGSADDWGMN
FT                   CDAILRLGAEIKSNDSGVKYGADFQIAIPHVQGKNFEKKAALNRGSRIFASTPYGDFSM
FT                   GYQEGVESMMKIDSSNIVAGDESSSWTQHLRGVLSEKKNALGYTMYPFLFSAGLYSENV
FT                   FRNNDNMTSTVDGSKDFINNLPFRISYQSPNFMGLRFGFSYSPLGYKFQHFGRTLDIYS
FT                   VKANKVVNQLPTFEVKLPSATVNLSELVKKLGTAKLDAELELSKQQELDKNALHIKFKD
FT                   KEEGYLPCKGKIELLGVPGAGVSSHDPIEFGIEVDSIEEVKIPISQIELKNLTITLPDL
FT                   EKFDSNLPVIQKGDTQVTKKGERESIVTKRSKNKSDQVFFGAKYEHILSGSIAYSYDLS
FT                   NGFKFSTSLVGEYAHPRLHFNTQNYDIYPENYNLQGISIGSLLSYSNVSFAIAYGYLGH
FT                   SGFAKHYILHKKTARNGESNAIYTMCERSNTYYWDIAFGYQYKSSNISVTYFKSNRSSN
FT                   ILQDISLGVEYHLLKEQSKMKCKLFGNYHHYKFSEITIAVDNVRYDDGYDNSAKPGISP
FT                   VIGTGLDKSNVIRNASNGSGNIFLVGAKLEF"
FT   gene            527303..528790
FT                   /locus_tag="ECH_0526"
FT   CDS_pept        527303..528790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0526"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS14436.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45066"
FT                   /db_xref="GOA:Q2GGU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU2"
FT                   /protein_id="ABD45066.1"
FT                   /translation="MKKFSFATAFVSFLLLYNVDAFSVDNIDKNHENQKKLVNLIKNNE
FT                   YVKQASLHPSIKSYHRIDLGGKVLSYAWFTNNSEKMQDHGVKLDGVLNIKSINNNSDLG
FT                   IFYGGNFQLAIPAMKSENFIPSMKAYNRGAQLFVESGYGNLSFGYQEGVESIMKIDASS
FT                   IGAGDNSIAWLQYTNLSNLDGKVQYQVFPGLYSESVFNRSNNNVISIKDKDFVNNLPFR
FT                   ISYQSPNFMGVKFGISYSPTGYDSNLFESVSSYNIKKLTLPPVISADTTSEIQANPNDK
FT                   DNILYNALGKEKVQDVTIEGIVPSKIEFLQARYENIVSAGLSYNHSFNDIDFQASVVGE
FT                   YGSTDIDKLKSYSKYPSAENLAAFAIGTSVTYRDVIVAGSYGYLGKSGYINTIYSATEA
FT                   PLKMFSPDNQYTYYWNIGAKYVYSNASISTSYFRSNKVNTHFYDFSLGIDYNLSLSSSH
FT                   KGQYKVFGNYHYFNIDNKNFKVSRDGSVLLLGVKYEF"
FT   gene            529077..529795
FT                   /pseudo
FT                   /gene="dnaQ"
FT                   /locus_tag="ECH_0527"
FT                   /note="DNA polymerase III, epsilon subunit, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAS13863.1"
FT   gene            complement(530003..530950)
FT                   /gene="thiL"
FT                   /locus_tag="ECH_0528"
FT   CDS_pept        complement(530003..530950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECH_0528"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by similarity to SP:P77785; match to
FT                   protein family HMM PF02769; match to protein family HMM
FT                   TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45033"
FT                   /db_xref="GOA:Q2GGU1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU1"
FT                   /protein_id="ABD45033.1"
FT                   /translation="MQEFEYIKNYIYKLDDDSLIGDDAATINCTQNKLLVTKDILIEGV
FT                   HFLKQCNPNILAKKALRSNLSDIAAMGAIPYGYCLGLVLPNNISQDWWKNFTDSLREEH
FT                   EKFCIKLLGGDTTSHKQDEIIVSITAFGTSNGNILKRSGAKIGDFIYVSGNIGDAALGL
FT                   LVYQKIINKNYYKLKNKYDIPQPRINLGISINKIASSCIDISDGLIQDIEHICNSSQVG
FT                   ASIYLDKIPLSNEAKEIINNTPQYINYILSGGDDYELVFTINPKFSHLIQDISCKNKVK
FT                   ISKIGEITLGNCVTLYDNNRNIITPTNKGFNHFM"
FT   gene            531104..531928
FT                   /locus_tag="ECH_0529"
FT   CDS_pept        531104..531928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0529"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45039"
FT                   /db_xref="GOA:Q2GGU0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGU0"
FT                   /protein_id="ABD45039.1"
FT                   /translation="MLKEKIKCLLKCIYYAMVDMIRHDGIEHAGYLSFIILLSIFPFLV
FT                   FFMALVSNVAQLLNHYDISINDKLIILINDNIPHEVISGLMPRIQEIISGPPHSLLTLA
FT                   VIGTIWTASSAVEGIRTILNKACRVSSPPSYIFRRLLSIFQFLVITLTIIIAMVCIILL
FT                   PVIYEMLNKDLGYLKYTVSELVLFISITLLYFIVPNIKQSLMDVIPGAILVTLLWTCSS
FT                   FVFTWYIKTFHQLNIIYGSLASIIASLLFFYILSIFFIYGAELNYRLKNMFI"
FT   gene            532032..532199
FT                   /locus_tag="ECH_0530"
FT   CDS_pept        532032..532199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45369"
FT                   /db_xref="GOA:Q2GGT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT9"
FT                   /protein_id="ABD45369.1"
FT                   /translation="MFFWFFHREVAYRVILFYTSCCALGIPCIVDCLTTEDGGLLLSWP
FT                   SSSDVFLNLC"
FT   gene            complement(532082..532609)
FT                   /locus_tag="ECH_0531"
FT   CDS_pept        complement(532082..532609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45218"
FT                   /db_xref="GOA:Q2GGT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT8"
FT                   /protein_id="ABD45218.1"
FT                   /translation="MIHNGNKKHSATNALLNVATVVSALVMTFSAFCTIYSGLNLAFNI
FT                   KIPGTPQTSMGLFLAFVLTFTAGSLSLISAAVANRLSQPFVLTQETSRNTSQQNTSEDD
FT                   QHRLRSTSQQNTSEDDQHRLRNTSQQNTSEDDDQHRLRNTSELDGQDNNSPPSSVVRQS
FT                   TMQGIPSAQQEV"
FT   gene            complement(532745..534247)
FT                   /locus_tag="ECH_0532"
FT   CDS_pept        complement(532745..534247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0532"
FT                   /product="magnesium chelatase, subunit D/I family, ComM
FT                   subfamily"
FT                   /note="identified by similarity to SP:P45049; match to
FT                   protein family HMM PF01078; match to protein family HMM
FT                   TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45508"
FT                   /db_xref="GOA:Q2GGT7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT7"
FT                   /protein_id="ABD45508.1"
FT                   /translation="MMARIKSIGFYGIHTINVDVQIHVAKGIPAFNIVGLPDKAVAESR
FT                   ERIRAALNSINISLPTQRITVNLSPADLFKEGSHYDLPIAIGLLMIIGIIPKINDLPYI
FT                   ILGELSLDGSITSVSGILPAAISAYKQKTGIICPYNNGAEASFIKDIAILSPKHLISLI
FT                   NYFNNNEPIPVSNDKLSIENPEYLDMKDIKGQLIAKRALEIAAAGGHNILMVGPPGTGK
FT                   SMLAKRLPGILPDLTYEEIIEINSITSIIKKSNKSISTIRPFRDPHSSLSIAAMVGGGK
FT                   NIKPGEITLAHQGILFLDELPEFSRSVLDSLRQPLENKEILISRVNTHIKYPANFQLIA
FT                   AMNPCRCGYFGDLSKSCSKTPKCAIEYQSKISGPLNDRIDIHIEVPYINMLSYDNHKKV
FT                   ESSKTIKERIILAKKFQKNRYGKFFNDMIVSEDIITKFLTPDKSGIQLLKHVLKKQNIS
FT                   ARQYTKILKVARTIADLSLQELISYDHIAESLSYTQQKHIKI"
FT   gene            complement(534405..535043)
FT                   /gene="rrmJ"
FT                   /locus_tag="ECH_0533"
FT   CDS_pept        complement(534405..535043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="ECH_0533"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to GB:AAS13832.1; match to
FT                   protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45105"
FT                   /db_xref="GOA:Q2GGT6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGT6"
FT                   /protein_id="ABD45105.1"
FT                   /translation="MSSTRWLHRQLNDPYVSLAKKQGYRSRATFKLIEMDSKFSIFKKG
FT                   QYVLDLGSSPGGWSQFAAQRVSHNNNNPVFAVDIQNMDAIPNVIFIQCDIINDIELLSD
FT                   KFHNKKFDVILSDMAPKACGNKQVDHANIINLCEISLDIVVRFTRENGVFITKILQGEY
FT                   EKEFYQSMKTYFQSVKYFKPKASRKDSSEMYLVGLGFKKDSQDIKTIES"
FT   gene            535189..535265
FT                   /locus_tag="ECH_0534"
FT   tRNA            535189..535265
FT                   /locus_tag="ECH_0534"
FT                   /product="tRNA-Pro"
FT   gene            complement(535421..535981)
FT                   /locus_tag="ECH_0535"
FT   CDS_pept        complement(535421..535981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44574"
FT                   /db_xref="GOA:Q2GGT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT5"
FT                   /protein_id="ABD44574.1"
FT                   /translation="MEGNESGGINVSALQSYLHQQNTGSGGAPEDEETVFSVFVFLAWF
FT                   YKNVPCFLDSATGNVIASTTCLGANLPTTVVFGSEMTKNIFGLPKLLPDSQSGDASGEG
FT                   GGEDAAAASGENDGEGIQAAHPDDPYAHDDYPHANQEVAEATGNGLNNVNHELQQEPEY
FT                   HHDRSPSPTPTTHQPSQYDHDFH"
FT   gene            complement(536184..536918)
FT                   /locus_tag="ECH_0536"
FT   CDS_pept        complement(536184..536918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0536"
FT                   /product="putative DNA repair protein RecO"
FT                   /note="identified by similarity to GB:AAS13963.1; match to
FT                   protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45251"
FT                   /db_xref="GOA:Q2GGT4"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGT4"
FT                   /protein_id="ABD45251.1"
FT                   /translation="MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLAKYSKKATHR
FT                   LQIGDYVNVTWSSRLISNLGCFKYELIKSTLYHYIQDNLKTMCIAFSTVILDQVLPENE
FT                   ENYIIYNCLDIFINSIQFQDINWKIKYLRLELTLLSELGFGLDLSRCAVNNTNENLTFI
FT                   SPKTGKAVSKTVGLPYSKSLLPLPQLLYDVYNNYEYKYSKTDFKLSLNVLGYFFKKHFL
FT                   TEKNTILIKYREEIIKLIDLRD"
FT   gene            537290..539020
FT                   /gene="argS"
FT                   /locus_tag="ECH_0537"
FT   CDS_pept        537290..539020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="ECH_0537"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by similarity to SP:P46906; match to
FT                   protein family HMM PF00750; match to protein family HMM
FT                   PF01406; match to protein family HMM PF03485; match to
FT                   protein family HMM PF05746; match to protein family HMM
FT                   TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44762"
FT                   /db_xref="GOA:Q2GGT3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGT3"
FT                   /protein_id="ABD44762.1"
FT                   /translation="MNLINTVKNCIVEKLHILSDKKLIVLDDVILSKLIVDYPNNHNHG
FT                   DLYTNAALILSSHIKKSPLEIAEILLSEFSNIKEISSINVVKPGFINFSISLYVWYEVV
FT                   ASINMLKEGFANVNIGNGQKVNVEFVSANPTGPMHIGHARGAIFGDVLANLLEKVGYQV
FT                   VREYYINDAGTQIDVLVESVYLRYKEATGQDIVIGSGLYPGLYLREIGKLLYEKYGTDL
FT                   LEMSFVRKMKIIRDVSLEYLMNLIKEDLALLGIEHDVFTSEAELLKNNIVEKCVKLLED
FT                   KQLIYYGVLEQPKGTEMQNWKPRTQMLFKSTDFGDDVDRALQKVDGSWTYFANDIAYHF
FT                   DKISRGFQHMILELGSDHIGYVKRLKAAVKALSNNNATVDIKLHNTVNFLDDGVQVKMS
FT                   KRSGEFLTIRDVIEKVGKDVVRFMMLTRKSDVVLDFDFAKVVEQSKNNPIFYVQYAHAR
FT                   VCSLMRNAPNILGIEDTDFSVLSSKEEILLIKLLAKWPNVVEMSAKTAEPHRITFYLIE
FT                   VAEAFHVLWGYGNKNANRRFIIDNDVNLTSARIYLAKSVAYIISSGLKIFSIVPLEEMH
FT                   "
FT   gene            complement(539133..542501)
FT                   /gene="ileS"
FT                   /locus_tag="ECH_0538"
FT   CDS_pept        complement(539133..542501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ECH_0538"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45347"
FT                   /db_xref="GOA:Q2GGT2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT2"
FT                   /protein_id="ABD45347.1"
FT                   /translation="MCIVKYLYSIINIMTEHYSQLTGEPDFPSIEEEVLKFWKENDTFK
FT                   KSVDNRDENKRFIFYDGPPFANGLPHYGHLLTGFIKDTVARYKTMAGFKVDRRFGWDCH
FT                   GLPAEMLSEKELGISGKLAIEKFGIEKFNNHCRNSVMKFSKEWQQYVDRQARWVDFEND
FT                   YKTMNPSFMESIMWSFHELWNKGLIYESVKIVPYSWACQTPLSNFETRIDNAYRQKTSK
FT                   TVTVAFELLENPKFPTIENVKKYKMLVWTTTPWTLPCNLALAISASIKYCGAIINQEMF
FT                   IFAKGYLKIFEEHCKKNKIEYQLYNKDILSINLENLHYKPLFEYFADIKNAFKVLTADF
FT                   VVEGEGTGIVHIAPGFGEDDFILCQKQGIPNIDGDTSSLLSTICPIDDGAKFTNKISDF
FT                   ANMHVFDTNDEIISILKQKNLYFKTDQYLHNYPHCWRTDTPLIYRAMSSWYVKVTKIKD
FT                   KMIELNKTVNWIPNYIRSGQFGKWLENAKDWAISRNRFWGTPLPVWKSDNPNYPRIDVY
FT                   GSVKKIFDNVRALEEDFDISSINDLHRPYIDNLVRPNPDDPTGKSMMRRVNDVFDCWFE
FT                   SGSMPYAQLHYPFENKEFFENYFPADFITEYIAQTRGWFYTLFILSTALFDKPPFINCI
FT                   CHGVVLDTQGQKLSKRLNNYADPMQMFKQYGSDAMRFLMLSHTVLYGGDLLLDKEGTMI
FT                   RDVLRNVIKPVWNSYNFFTIYANIDKIKAEIITDLNGINNIMDRYIIYECISTIKSIFN
FT                   AMEELDKCSNNFGYNIKLACNNITQFFEILNNWYIRRCRSRFWSSEINQDKIDAYNILY
FT                   TVIYFMIKVSAPFLPIITEAIWQKLNFQKEESVHLSSLPNMNNFMLSDKDQQNTQFMKL
FT                   TISICNYVLSIRNIHNIRVRQPLNKIVIYSYNCPELLNLPIEYQNILLEEINVKSISFK
FT                   SDISDIASFQLKLNFPELGKRIPDKIKRLIFLLKNNQWEILENNQLLLGTKEAEHYIIN
FT                   NNEYTLTLKVHNDFACTINLDQNLLGVVLLDHELSDDLIMEGIARDIVRVIQHSRKDNK
FT                   FNISDKIDVMIYTKDKIVQDSIKTWSQYIAQQTLSISLIACEEITDVKNITEYCKTTIK
FT                   DKDVSVFLKKSNTSV"
FT   gene            542604..543047
FT                   /locus_tag="ECH_0539"
FT   CDS_pept        542604..543047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0539"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45484"
FT                   /db_xref="GOA:Q2GGT1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT1"
FT                   /protein_id="ABD45484.1"
FT                   /translation="MTVEIGDDAPHFKGIDAYKGEKNIVLYFYPKDDTPGCTREAKDFQ
FT                   DAMDDFADLNTVVIGVSKDSEKSHENFKKKHNILFELISDESSELSKQYGTWVEKNMFG
FT                   KSYMGIDRSTFLIDKNGKIRKMWRNVKVSGHVDNVLEIIREIM"
FT   gene            543059..543784
FT                   /locus_tag="ECH_0540"
FT   CDS_pept        543059..543784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44999"
FT                   /db_xref="GOA:Q2GGT0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGT0"
FT                   /protein_id="ABD44999.1"
FT                   /translation="MIQKAKKLNVRLYVDCTLSKSSIVILDNIASHYICHVMRAAKLDE
FT                   VKLFNGRDGEWIGEIFELSSNTKIRVNELIRRQYVPKSLTLCLSIVKNTALQNVIRQAT
FT                   EMGVTFIQPIYTQHIATSNINLSKCKKWAIEAAEQCGRLDIPDISFPIDFIDLKQLKTD
FT                   DNNFVICDETGKGHPPSEVLKGKNNVHIIIGPEGGFSNDELSFAYSFCDGLSLGTTILR
FT                   VDTAVVSALAYVKEYYGML"
FT   gene            543792..544313
FT                   /locus_tag="ECH_0541"
FT   CDS_pept        543792..544313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0541"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44919"
FT                   /db_xref="GOA:Q2GGS9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGS9"
FT                   /protein_id="ABD44919.1"
FT                   /translation="MVVEDIVNKKAELRKKYRKLRKEVKNKKEASYSLLQNYVNNVIIE
FT                   EMSIISGYIPIDGEIDVLPLMDYLMQQKHIVAIPVIEENSKILLFHQWNTINSVIPNIL
FT                   IVPLIAFDKCLNRLGFGGGYYDNTISKLKPNCKVIGVAYDIQLCDIVPTESHDQILDMV
FT                   ITEKKVYKNI"
FT   gene            544520..545413
FT                   /gene="mraW"
FT                   /locus_tag="ECH_0542"
FT   CDS_pept        544520..545413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ECH_0542"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44511"
FT                   /db_xref="GOA:Q2GGS8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGS8"
FT                   /protein_id="ABD44511.1"
FT                   /translation="MHTPVLLNEMLDILNPQDGKVYVDATFGAGGYTRAILKSANCQVY
FT                   AIDQDECTNVFYEKLVNDFPGKVHFCVSKFSKIKQILHGAQLKKVDGIVFDIGVSSMQL
FT                   EDASRGFSFSKDGPLDMRMSTSISNVDASVFVNTAFEEEIANVIYQYGGEKYSRKIAKA
FT                   IAESRKKKPIKTTGELASIVRSVISRSKNHSIDPATRTFQAIRIWVNKELEELEQGIID
FT                   SADLLNPGGKIIVVSFHSLEDRIVKVMFKSLCSGSSVISPIGFQLINKKVIRPSFEEIL
FT                   NNPRSRSAKLRAILKI"
FT   gene            complement(545444..546466)
FT                   /locus_tag="ECH_0543"
FT   CDS_pept        complement(545444..546466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0543"
FT                   /product="GTP-binding protein, GTP1/Obg family"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45515"
FT                   /db_xref="GOA:Q2GGS7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGS7"
FT                   /protein_id="ABD45515.1"
FT                   /translation="MSFIDEAKVYLKAGNGGNGCSSFRREKFIEFGGPDGGNGGNGGNI
FT                   VFATSNHINTLLYFRYKQHIKAENGNPGSGKKKSGSSGKDIIIKVPIGTQLYDEDGILI
FT                   ADLSSENQKVIVAQGGKGGTGNANYKTSTNRAPRYFTLGEAGEEKYITLKLKIISDIGI
FT                   IGLPNAGKSSFLASCTDSKTKIADYPFTTLEPHLGVAFIDNRELVLADIPGLIAGAHLG
FT                   YGIGDKFLKHIERCSTLLHIIDCTLDDIIDSYECIRKELLLYNKELINKPEFIVLNKSD
FT                   LLEKKEITKKKQLLSQYTKKEIFVSSIKDNRYAILSTLIQYIHKKNANAEPYIYDPFNI
FT                   "
FT   gene            complement(546463..547728)
FT                   /gene="eno"
FT                   /locus_tag="ECH_0544"
FT   CDS_pept        complement(546463..547728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="ECH_0544"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by similarity to SP:P37869; match to
FT                   protein family HMM PF00113; match to protein family HMM
FT                   PF03952; match to protein family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45381"
FT                   /db_xref="GOA:Q2GGS6"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGS6"
FT                   /protein_id="ABD45381.1"
FT                   /translation="MFNITISKILARQILDSRGYPTIEVETILSNDIKAKACVPSGASV
FT                   GKFEAVELRDNDKNFYNGYGVTKAINLINSEVAPQIISMNTLNQEKIDNALIEIDGTDN
FT                   KSRIGANSTLAISLAIAKAAALALNIPLYQYLGGITAKVLPTPLINVINGGMHADNNLD
FT                   FQEFMIIPNGANKFEDAIRMSAEVFFQLKQILKHKKLNTNVGDEGGFAPNIRINTEVFE
FT                   IIIDAVEKSGYKMYEDFSLGLDIAASTFYKDQKYKFADYELNTQELVEYYKKIISQYPI
FT                   ISIEDPIAEEDINGWKLITQELGNKIQIVGDDLFVTNCKLIQNGIDNNMANAVLIKPNQ
FT                   IGTLTETFNAIRLAQKNNYNVIISHRSGETEDTTISHIAVATNCGQIKTGSLSRSERLA
FT                   KYNELLYIEKLLGISAIYYGSL"
FT   gene            547916..548224
FT                   /gene="rplU"
FT                   /locus_tag="ECH_0545"
FT   CDS_pept        547916..548224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="ECH_0545"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45292"
FT                   /db_xref="GOA:Q2GGS5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGS5"
FT                   /protein_id="ABD45292.1"
FT                   /translation="MFAIVETGGKQYKVKEQDVIKIEKLNASVGEEVTLDKVIALADVN
FT                   NNIVFTHNAIVTASVLEQCRNDKIIVFKKKRRKNYRRKNGHRQYMTVLRVTKINNME"
FT   gene            548227..548493
FT                   /gene="rpmA"
FT                   /locus_tag="ECH_0546"
FT   CDS_pept        548227..548493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="ECH_0546"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44879"
FT                   /db_xref="GOA:Q2GGS4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGS4"
FT                   /protein_id="ABD44879.1"
FT                   /translation="MATKKSGGSSGNGRDSRGRRLGVKKFGSEKVIPGNIIIRQRGTKY
FT                   HPGKNVGIGKDHTIFSKISGFVHFRKGVYNKTFVDVLEASSVS"
FT   gene            548511..548587
FT                   /locus_tag="ECH_0547"
FT   tRNA            548511..548587
FT                   /locus_tag="ECH_0547"
FT                   /product="tRNA-Ile"
FT   gene            548735..550018
FT                   /gene="nuoF"
FT                   /locus_tag="ECH_0548"
FT   CDS_pept        548735..550018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="ECH_0548"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF01512;
FT                   match to protein family HMM TIGR01959"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45524"
FT                   /db_xref="GOA:Q2GGS3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGS3"
FT                   /protein_id="ABD45524.1"
FT                   /translation="MLKDSDKVFTNLSGQYSPFLRSAKSRGIWSNILEILNLGPEHIIQ
FT                   EIKKSGLRGRGGAGFSTGLKWSFMPKTRKEGQPAYLIINADESEPGTCKDRDILRYDPH
FT                   RLIEGILIAGFAMNVTTAYIYIRGEFYNEYLVLSKALEEAYKAKLIGKNACNSGYDLDI
FT                   FIHRGAGAYICGEETAQLESLEGRKGMPRLKPPFPAAIGLYGCPTTINNVETIATVSEI
FT                   MRRGSDWFASLGRENNTGTKIFCISGHVNNPCNVEEELGIPMKELIEKYAGGVRGGWDN
FT                   LLAVIPGGSSVPMLPKSICDTVNMDFDSLRAVQSGLGTAGLIVMDKSTDLIAAIERLSH
FT                   FYMHESCGQCTPCREGTGWMWRIMKKMVKGDATSESIDLLLNITHQVEGHTICALGDAA
FT                   AWPIQGLIRHFRNVIEDRIRDYNNDKLT"
FT   gene            550236..550823
FT                   /locus_tag="ECH_0549"
FT   CDS_pept        550236..550823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45128"
FT                   /db_xref="GOA:Q2GGS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGS2"
FT                   /protein_id="ABD45128.1"
FT                   /translation="MHLTLLLLRNGMPVLLPEAACKYDKSLGVAYTMDPIMNEQLGIPT
FT                   SDSPYSYLYRSNFTKFAVVSGANSEMNVMFIFGNSPVLSCPVFMVFTLPYGVVRDVTKN
FT                   GIMLDNTLIPLHGKVSEDLLGLSTEEQVIKLFNELKSNLKINASSGQCRMQMFNYVNGN
FT                   GELFHTSFHNTALDRVTVNPVDGSRRYIMKIE"
FT   gene            complement(551089..551190)
FT                   /locus_tag="ECH_0550"
FT   CDS_pept        complement(551089..551190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0550"
FT                   /product="putative NADH dehydrogenase I, J subunit,
FT                   truncation"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44609"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGS1"
FT                   /protein_id="ABD44609.1"
FT                   /translation="MIYFLFHFFAVLIVLSSISVVYLSNPVYSVLSL"
FT   gene            complement(551608..552183)
FT                   /locus_tag="ECH_0551"
FT   CDS_pept        complement(551608..552183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45499"
FT                   /db_xref="GOA:Q2GGS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGS0"
FT                   /protein_id="ABD45499.1"
FT                   /translation="MKLISLLTQNGLALIPENECIYDKSSDEYIPKDQNINIITPVPNI
FT                   HPDYVHLIHKAKFGQHCLISNAVLANDIFFMYGKNPQGKELYLGFVAQHGSLHNIYSLG
FT                   LMLNDGRLITCGEITTPGISPEEHTINLFRNSREWIKIPFRTNSSCTYRFDFFNMSGEV
FT                   FHREYSTTHLDHIIVDPVSNENVFIMRF"
FT   gene            553065..553667
FT                   /gene="nuoJ"
FT                   /locus_tag="ECH_0552"
FT   CDS_pept        553065..553667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="ECH_0552"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF00499"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45020"
FT                   /db_xref="GOA:Q2GGR9"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR9"
FT                   /protein_id="ABD45020.1"
FT                   /translation="MIYFLFHFFAVLIVLSSISVVYVSNPVYSVLFLILTFFISSTLFI
FT                   LLGAELIAMLVIIVYVGAVAVLFLFVVMMLDINYSRLKSGFTKYLAIGLLCGMILFVNI
FT                   VFVIKQSATTELVTGSVSYVSNVIAIGNLIYTKYMYVFHLSGILLLISIIGSLVLTLRT
FT                   KNGNVYRQSVGAQVNRSSTVKYVNVKVRQGVDYENSN"
FT   gene            553651..553977
FT                   /gene="nuoK"
FT                   /locus_tag="ECH_0553"
FT   CDS_pept        553651..553977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="ECH_0553"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by similarity to SP:P50940; match to
FT                   protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45220"
FT                   /db_xref="GOA:Q2GGR8"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR8"
FT                   /protein_id="ABD45220.1"
FT                   /translation="MKILTEAGITLDHFLILGAILFTIGVSGIFINRKNIITILLSIEL
FT                   MLLAININFTAFSVYLDNILGQVFVMFILTVAAAESAVGLAIIVVYFRNCGNINVETAN
FT                   KMKE"
FT   gene            554029..555894
FT                   /gene="nuoL"
FT                   /locus_tag="ECH_0554"
FT   CDS_pept        554029..555894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="ECH_0554"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by similarity to SP:P29924; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   PF00662; match to protein family HMM PF06455; match to
FT                   protein family HMM TIGR01974"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44581"
FT                   /db_xref="GOA:Q2GGR7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR7"
FT                   /protein_id="ABD44581.1"
FT                   /translation="MVKVELLCVFLPLMGSIFASMMNNRLMSQLVATSLVVCASLLSWY
FT                   LFFNFKDSYVITLFPWIELYKLKVSWSLYIDSLSMIMLIIVNTVSAVVHIYSMGYMSHD
FT                   VGVSRFLSYVSLFTFFMLILITSDNFAQLFLGWEGVGLCSYLLIGFWFEKASATKAAMK
FT                   AFIMNRIGDFFFILGIVAVFWVFGSLEFNKIFNMLDSIYVEGVVNFFGYPIPYLDMICL
FT                   LLFIGCMGKSAQIGLHTWLPDAMEGPTPASALIHAATMVTAGVFLVARCSPLFELSVMA
FT                   RNVILIVGAFTCLFAATVAIVQSDVKKIIAYSTCSQLGYMFIACGLSAYSVAIFHLMTH
FT                   AFFKALLFLCAGNIIHATHEQDIHKVNASWRQIPFTYVLTWIGSLALAGIFPFAGFYSK
FT                   DLIIESSYHVSKIAFIICNLVAFLTAFYSWRLIILVFHKVRSTSLSIHESGKVMLVPLL
FT                   ILAIGSIFSGMWGQNLLLINDVAFWKGSIKIHEHVEVGLFVKLLPLFLSILGIVCAYLK
FT                   YFYNCFGNFYCNRLFKFLYNKWYFDELYNLIFIIPVRYIASFFSKVVDKKIIDYFGLGG
FT                   ITKIVNCCSKGSVKIQTGFIFDYAFIMLLGLISIIMWLIYNNIRF"
FT   gene            555900..557351
FT                   /gene="nuoM"
FT                   /locus_tag="ECH_0555"
FT   CDS_pept        555900..557351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="ECH_0555"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by similarity to SP:P29925; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45061"
FT                   /db_xref="GOA:Q2GGR6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR6"
FT                   /protein_id="ABD45061.1"
FT                   /translation="MLFLMVLLPILGSCLLAVSNFKASSLSIRVISLLCAGTSFFINII
FT                   VAVKFDYLYKGFQFIHNLAPGFVVGIDGLSLPLLLLTTFLFLLSVVFALYNMQSNNLRI
FT                   FLALLLLLEGLTVGVFVSLDIVMFYIFFESVLIPMFFIIGMWGHEDRIYATFKLFLYTL
FT                   SGSLLFLIAILYIYFFSGKISDIGQLTYILSNYLNLKAQKWVWIAFFISFAIKIPVIPF
FT                   HTWLPDAHVQAPTVGSVLLAGILIKVGTYALLRFSLPMLPEASMYFSNFVMILSIIGVI
FT                   YASLISFVQTNIKKLIAYSSIAHMGFVTAGIFSFNEYGISGAVFQMISHGLVSAALFIC
FT                   VGILYNRTHTLEIVRYSGLAKTMPKFSIMFIFFSMASIALPGTSGFIGEFLSILGIFHY
FT                   SKLFSIFITIGVILGALYMLFLCKRIIWSVQNCDLINCNLNKNELFILVILAAFILLFG
FT                   LYPYYILLKCLTPFIEQLSLRNFVL"
FT   gene            557373..558782
FT                   /gene="nuoN"
FT                   /locus_tag="ECH_0556"
FT   CDS_pept        557373..558782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="ECH_0556"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by similarity to SP:P50973; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   TIGR01770"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44550"
FT                   /db_xref="GOA:Q2GGR5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR5"
FT                   /protein_id="ABD44550.1"
FT                   /translation="MYWNNFVYIIPEIFLVSSSLIFLLLGIVLNKKVIHVFSLVSLLVT
FT                   IGIVIINLDVEPKLIFDGLLKSSLYISIAKIIILFSSSSVLFMMLASGREYCYEFSIMI
FT                   LLAVFGLITLISANNLLSFYLSFEIQSVTLYALTCFDKNAIRSSESGIKYFVLSALSSC
FT                   IMLYGISMLYGYTTQVDFYELYNFFSYSEYIPLGAVLGVVLVLISMFFKLSAAPFHMWV
FT                   PDVYQGTSTVMTAFFSIVPKSTFVFLLIRILNEVLPSLSKDWQHIVICVSILSIFVSAF
FT                   GAMRQNNLKRLFSYAAVGHMGYMLISLAMNTVASNIATIMYLLLYIVMNIGLFSILIQY
FT                   RDDDCNLLNLKGLHNRSPVIAFCIAVIMLSMAGIPPLAGFYAKYDVLLSLVENGFIKVA
FT                   IAFVIVSVISCYYYLRIIKVMYFDFSDTSNNISLADRNLSFILLFTVLINCIFFVFVGD
FT                   VRRLIGYFFTF"
FT   gene            558851..560011
FT                   /gene="dxr"
FT                   /locus_tag="ECH_0557"
FT   CDS_pept        558851..560011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ECH_0557"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="identified by similarity to SP:Q8RA28; match to
FT                   protein family HMM PF02670; match to protein family HMM
FT                   TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45202"
FT                   /db_xref="GOA:Q2GGR4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGR4"
FT                   /protein_id="ABD45202.1"
FT                   /translation="MKTVSIFGSTGAIGQMIIDIIFADLDKYQVKVLVAKSNVQLLAFQ
FT                   AKLINAERVVIANVDLYQELKDLLVGTNIKVSAGDSGMVMATSLDVDYAMMAIVGMAAL
FT                   IPMTYLINSGIKVIALANKESIVCGGTLLLSLAKEKNVNIVPVDSEHNAIYQILSSSKK
FT                   NLEKITLTASGGPLLSMDYDQIKNVTVQDTVKHPIWKMGKKISVDSATMINKSLEIIEA
FT                   YYFFSIKAEKLDIIIHPESIIHAIVSYVDGASIAFMSVPDMKIPIMYTLSWPDRSAILC
FT                   KKLNLASCNQLTFIKPDVYKFPGIKLGFEVLKTSNVHANSIILNAANEVAVDAFLNKKI
FT                   RFLDIVSVVCETLNLVNYGRINSLSSILDCDLVSRRVASSAIDKLY"
FT   gene            560279..562030
FT                   /locus_tag="ECH_0558"
FT   CDS_pept        560279..562030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0558"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44749"
FT                   /db_xref="GOA:Q2GGR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR3"
FT                   /protein_id="ABD44749.1"
FT                   /translation="MFRRNILNVLLVLIFCFVISCSNKSRYQFSKKYSPVYNPDGEAFD
FT                   SDVGFSRAYSIYKERRNALVSGIDESSKKVSVRRKVKPKVQVRDVDLLKEYGDLLKEEN
FT                   CDLMVDGNGVNLVDVAGAKFIDPIENDDDVIDHDNRHVDVKSSVVKTKDKNKLQDVKDN
FT                   KPSDVKLPVIKAEDKNKLQDVKDNKPSDVKLPVIKAEDKSKLRDVKDNKSTDVKLPVVK
FT                   AEDKNKLQDVKDNKPSDVKLPVIKAEDKSKLRDVKDNKSTDVKLPVVKAEDKNKLQDVK
FT                   DNKPSDVKLPVVKAEDKNKLQDVKDNKPSDVKLPVIKAEDKNKLQDVKDNKPSDVKLPV
FT                   VKAEDKSKLRDVKDNKPSDVKLPVIKAEDKSKLQDVKDNKPSDVKLPVIKAEDKSKLRD
FT                   VKDNKPSDVKLPVVENMIIDTSKLNDDGDHKADKKEKGLRSLLKFTKIENDSKGSDNNV
FT                   AGNIANDSEEPTFSQPKSDVESPKQVSESDEQKNSHKAVHFLSFLNEPSEDQNDTTEEL
FT                   QNTEDKKDNLLEENVKISEKDDQQVVISIEEENQMLLQSIKKMKEYDEDYSITYYYDDD
FT                   GMAYYED"
FT   gene            562145..563374
FT                   /gene="ispG"
FT                   /locus_tag="ECH_0559"
FT   CDS_pept        562145..563374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="ECH_0559"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44873"
FT                   /db_xref="GOA:Q2GGR2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR2"
FT                   /protein_id="ABD44873.1"
FT                   /translation="MFNCIANKNKITYEVKVGDVVIGGNNPVVVQSMALGGSGDVYKDA
FT                   HEVLELAQAGSELVRVAVNSEQAMKNVPYIRDVLVDHGFSAKMIIGCGQYEIARLVNEY
FT                   PDCAAALGKIRINPGNVGFGNKRDKNFEDIVEFAIKHDIPIRIGVNWGSLDKYLASKLM
FT                   NDNALLINPKPDYIVLQKALVISAITSAKRAEEIGLSKNKIVISCKTSKIQDLIPVYTV
FT                   LSNVCNYPLHLGLTEAGSGTKGMVSSAAGISYLLLNGIGDTIRVSLTQQPGEARSIEVK
FT                   LCQEILQSIGLRNFSAQVTSCPGCNRTNPKYFHQLAKDINDYIKQRMPVWRNDNPGSEN
FT                   MTVAVMGCIVNGPGESKHANLGISLPGYGERPVAAVYQNGEKLCTLEGGNIFEQFVSII
FT                   ENYVNVYYKQ"
FT   gene            563396..564145
FT                   /gene="tatC"
FT                   /locus_tag="ECH_0560"
FT   CDS_pept        563396..564145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ECH_0560"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /note="identified by match to protein family HMM PF00902;
FT                   match to protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45490"
FT                   /db_xref="GOA:Q2GGR1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR1"
FT                   /protein_id="ABD45490.1"
FT                   /translation="MESTTGEMLFFKHFEELRYRVFFCFAFFCIMFGVCYFFSERIYNF
FT                   LLIPLIDLEGANSEFSLIYTDLTEAFFVYLKVATMAALLGSFPVFAWQFYMFLAPGLYK
FT                   KEKLILLPYLIATPVLFILGAAMVYYYIFPLAWRFFIAFENRDASMGVPIEFMPSVSEY
FT                   LDLVLQLMFAFGVAFQIPIFLTLMSRIGIVSAKGLSRKRRVAIVVIFILAAILTPPDVL
FT                   SQIGLAIPMLLLYEASILACKYIERSK"
FT   gene            564222..567320
FT                   /locus_tag="ECH_0561"
FT   CDS_pept        564222..567320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0561"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45083"
FT                   /db_xref="GOA:Q2GGR0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGR0"
FT                   /protein_id="ABD45083.1"
FT                   /translation="MRKIAEIFLQRNRVSIFLLMVILIFGCYSYFYIPKEKNPEIKKPI
FT                   LSIHTTLQGMSSEDVEKFLVYPIEQEIKSVKGISRITSMAKNGYANVILEFSAGFNHRE
FT                   ALENVRSKVDVIRAKLPQEATFPIINEENFSLFPVLSIALVSDLPNRTLFKVASDLQSR
FT                   LESLPNIESVKIIGNSKDIIEINISPGVINSYNLQMQDVIMAVLNNNQFLNIGNLDSTV
FT                   GKYTLHLSGILKNIEDIMNIPVKTDGYSVVTVGDIATIKPIYQDNKEFVRVNNQPCLVL
FT                   EISKQTGKNIIETISQVKELMNNLKNILPNNLSVIYLQDESEEISNVLNELQNSILISV
FT                   LLVVIIMMVFMGTKTALLVAVSIPGSFLFGIIIMYLLGYTLNIVILFSLIMAVGMLVDD
FT                   AIVVTEYADRKMIGGLNKMEAFKQAAHDMFWPVASATLTKLVVYIPLLFWPGTTGEFMK
FT                   YIPIALITTLSGSWIMALIFIPVLGSLIGMPSVTDKKSVAEIIAINTGDFVHLGRFTRG
FT                   YSRILNNVLNHPKKFVCVIVSILFFSTFGYFMVGPGVEFFPNIESERMLITIRSNNNLS
FT                   VHERNDILREVEQRISDIGGIKFFYVKAGLFEYSLDVDNVIGKIQVELKKCSICRKSDK
FT                   ILNEIRNKLQDVKGVIINIVEERMKPVTGKPIRIDISSRNVNKINDTTDKIISIMNNSL
FT                   GFENVTDNRSSLEIEWKIDIDKNKAMRSGVDISILSKFIKMIAGGVLLNRYHPDNINDE
FT                   VDIILRFPKEYRNLNTLSNLFVNTLHGYTAVSDFIIHKAQRKEGGINHINGIRTVSIMA
FT                   DLSQGYLLEKMINFLNQKFKEELDSEVLVEIKGEIKDQEESQKFLIKAFVIIVVLIMLV
FT                   LITEFNSIYNTLIIMTAIFLSTTCIFFGFFITSHVFSVVMGGVGIIVLAGVIVNNNILL
FT                   LDAFYINMNTICNKKEAIVRAALSRVRPILLTVVTGIIGLVPMMLRVSFDFINRQVIYN
FT                   SPSSQLWFELSYTIAIGLCLATVITLFFTPALLMIGKYNKINK"
FT   gene            567487..569040
FT                   /gene="nusA"
FT                   /locus_tag="ECH_0562"
FT   CDS_pept        567487..569040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ECH_0562"
FT                   /product="N utilization substance protein A"
FT                   /note="identified by similarity to SP:P03003; match to
FT                   protein family HMM PF00013; match to protein family HMM
FT                   PF00575; match to protein family HMM TIGR01953; match to
FT                   protein family HMM TIGR01954"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44624"
FT                   /db_xref="GOA:Q2GGQ9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ9"
FT                   /protein_id="ABD44624.1"
FT                   /translation="MVNLQNFDNLELIRVAKDIADQKGLNLDVIIRAIEEAIQLTSRSR
FT                   YGNCKIKVTVDKKTGVVATYRQVLVINNNGDISVPEGKENEIDFSDVSKYKLITLAEAK
FT                   QIDKNVEVGDIMLEPLPVIDLDYSSAKIAKQKIAQVIISEERKKQYEDFKDRVGDIVYG
FT                   TAKRIEYNNVIVDLNGNEGYLSASNLIKGEVFRVGDRVKAHIEDVRKENSGPQIFLSRI
FT                   NKGFMEQLFKQEIPEIYDGIVTIKAIARDPGSRSKVAVFSSDKNIDPVGACVGARGVRI
FT                   QGIISELHGEKIDVILYSPELAKFIVNAIAPAEVLKVIIDEDKEKVELIIPENQLSLAI
FT                   GRYGQNIRLASELVGWKINVIGDETESSRKAKELSAGSKIFVEGLDVEEIIGQLLFTEG
FT                   FVSIEDIDQASVSDISAIDGFNEEIAEELKSRAADYLVRKDAEMKQILDNLSVDKDVTM
FT                   LPFLRPSDIIALSKNGINSLEDIAGLCTDEFFDIIPDIALTKDQVDSVILESRKKIGWL
FT                   "
FT   gene            569101..571593
FT                   /gene="infB"
FT                   /locus_tag="ECH_0563"
FT   CDS_pept        569101..571593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="ECH_0563"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44916"
FT                   /db_xref="GOA:Q2GGQ8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGQ8"
FT                   /protein_id="ABD44916.1"
FT                   /translation="MSGKIERTTLKLSDKLKLSSNIHQGTKFSLKKSVTTVEVRKSKKR
FT                   KDINNIEQASVVLQNDNAYQDNESNNSLTIQEQISRMNALQNANICEKKEDIKEDTSDV
FT                   NLQVTESTSVEKSESDDVTLEEESSKKVEEQVVEEAHDNTDTVSLNVVENVQEESQVDN
FT                   QVESSNISDILQPKGIEEKKLKKYEKEHEEKKGNPKKGVSNNMYSKHVKLVIEEELEDN
FT                   NKQVIQTHKSRKNRSTSSVKNKITRKVLIPKKITVQELASSMSERVKDVQHMLFQMGRR
FT                   DIKPTDFLDSDHASVIVEAFNHTFKLVNDGKLEEDLYADGNDKELLPRAPVVTVMGHVD
FT                   HGKTSLLDAIRKSNVADGEFKGITQHIGAYQIMLDGDKRITFIDTPGHEAFTAMRACGT
FT                   NVTDIVVLVVAADDGIMPQTIESINHVKAANVAMIVAVNKIDKHDANIDKITNSLLNHG
FT                   VVAESLGGDVIVVPVSAKERINLDQLKSSILLMAELLELKAVYDTRASGVVIESKVDRN
FT                   CGVVATLIVQKGTLKAGDIIVVGHNSYGKVRNMFNSDGRSEKVAIPSMPVKVLGLNNVP
FT                   NSGTNFIVVDSEKQARELISYRQELFNAELEANAKPKMDANSILACGVVDELNVILKCD
FT                   VMGSVEAICYSISKITHEDIKLNVLYKGVGNVTKSDVLLAETSNSIILAFNVKTDASVK
FT                   ELAKQKCIEIKHYSVIYDIIDDVKKILSSMLKPLQQEVQVGTLSIRKVFSSGSIGSVLG
FT                   CYVTNGIVRKGALVKLIRNNNVIHEGKIKVLRRFKDDVKEVAAGFECGILLDYSKEIYP
FT                   ESDIIHILEIVEEIRVIK"
FT   gene            571590..571934
FT                   /gene="rbfA"
FT                   /locus_tag="ECH_0564"
FT   CDS_pept        571590..571934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="ECH_0564"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45050"
FT                   /db_xref="GOA:Q2GGQ7"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ7"
FT                   /protein_id="ABD45050.1"
FT                   /translation="MIYKSESFRNLKVASVLNRAISRVLMQDICLFNSHITISKVEVSS
FT                   DIRDATVFVIISQECSDKEALIKELNDSSYFIRKAIFSYVDLRYIPRLYFKLDYCFDNL
FT                   VRVNQILESK"
FT   gene            571934..572080
FT                   /locus_tag="ECH_0565"
FT   CDS_pept        571934..572080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0565"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45415"
FT                   /db_xref="GOA:Q2GGQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ6"
FT                   /protein_id="ABD45415.1"
FT                   /translation="MHSAAAGIKSNILEYSKKEYYYIHCFTFFSYYIYSFSNYRKSRLL
FT                   SRS"
FT   gene            complement(572229..572915)
FT                   /locus_tag="ECH_0566"
FT   CDS_pept        complement(572229..572915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0566"
FT                   /product="membrane protein, TerC family"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44799"
FT                   /db_xref="GOA:Q2GGQ5"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ5"
FT                   /protein_id="ABD44799.1"
FT                   /translation="MESYITQFFTLLILEIILGVDNIIFISLAVTKILPELRNKAKYIG
FT                   LSLALIMRIAVLYGASAILAMNNPIISLFQLDISPNNLFMVFGGIFLIYQSLSEIWNDI
FT                   FKKNGKIHNLKSNFYYVILQIIIVDLIFSIDSILTAIGITHNILIIQIVFVVSIISTIL
FT                   FSHYIIKAITTYSNIKTIAIMFVLVLGILLTLNGIHIKVSHNYLYFTFAFSIITEGINI
FT                   IRKKVK"
FT   gene            573069..575366
FT                   /gene="clpA"
FT                   /locus_tag="ECH_0567"
FT   CDS_pept        573069..575366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="ECH_0567"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpA"
FT                   /note="identified by similarity to SP:P15716; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02861; match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45261"
FT                   /db_xref="GOA:Q2GGQ4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ4"
FT                   /protein_id="ABD45261.1"
FT                   /translation="MKLEMSVLSKNLEASLHKALSIAFDFHHEYATLEHLLLALTDDID
FT                   ARRVFYAFRVSIDKLKITIINFLRYEIPTLIDKGISEVKPTAIFERLIHRAIIHAHTSG
FT                   KSEVTGANILAEILSEKDSYSACFLHEQNIKYIDVVNYTSNNNLYAGEFNVDQEFVKYN
FT                   EYGKSIGNVNKDILKDNETLDSYCVNLNEAAKKGKIDYVIGRAYELERTMEVLLRRRKN
FT                   NPLYVGDPGVGKTAIVEGLALKIIEGDVPDQLKKMVIYSLDMGALLAGTRYRGDFEERI
FT                   KSVIKAIEAKENAILFIDEIHTIVGAGSTSGGSLDASNLLKPALARGTLRCIGATTYKE
FT                   YNNNFEKDRALARRYQKINVEESSVGETLRILDGIKSYYESHHQVRYTNQAIKYAAELS
FT                   DRYISGKMLPDKAVDVIDEAGVYCKLHNTGNKVITGSDIEHIISRITEIPCSNLLFNDL
FT                   DRVKNLEENLKKDIFGQDFAISHLVDSIKIAKAGLRNYNKPLASYLFSGPTGVGKTELA
FT                   RQLANHMGMKLIRFDMSEYMESHAISKIIGSPPGYVGYDQGGLLTDSISRHQYSVLLLD
FT                   EIEKAHSDIYNILLQIMDYGCVTDTYGKKVNFHNVVIILTTNAGAFELSKSSIGFIRNK
FT                   SFTHGDNEKAIERIFSPEFRNRLDAIISFSSLDQEVMLRIVKKFIYQLKEQLAKKNVHI
FT                   DVADDVLMYLAQSGYNDAYGVRNIENIISKKVKKYLAEEILFGKLFNGGNVKIKLDADT
FT                   NKLVYDFCCAEA"
FT   gene            575691..580091
FT                   /locus_tag="ECH_0568"
FT   CDS_pept        575691..580091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0568"
FT                   /product="phage minor structural protein, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45085"
FT                   /db_xref="GOA:Q2GGQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ3"
FT                   /protein_id="ABD45085.1"
FT                   /translation="MLNFNKTLSKYYSIVACIAFFMLLVLLIVHLIRVFLKKESVIGHL
FT                   VTGILALSLLSIILVFGSKYLSDHLEFKNKLLVDLFTEEHKEKVEVQQIGLNEDFERSI
FT                   MRLLELKKLALEDISVDFAESTQHSQSILEKYDREIEHLEALQRRQVEIIELSNSLGDK
FT                   FQLQGWEYDTSLKHIQDNFIEHIKHERYSHYCFCCYLHEFEVGDSVDFDELSPRVSSAM
FT                   IYITSSPPITCIFKSAGTLLTAMGKLDADDNTLFVEYCQRLYNFDCKMALQIEISLSNR
FT                   LKCDTYTYNHIDYWINSTRSYYRQRDTLAIALQEGKHLLTSLADREYSDTVSSFKSRGI
FT                   ESTISQLENTLNTQLPKGEIDKIIEGSNPIMQKIVRELNFFGKDRMETLNNVQSELPET
FT                   LLGRKIIDVIEAEEELKSLIDKKYNLSLEDGPKGKIRQMMCYLQSRFDEVKDGLLAYSP
FT                   MLSQDISQIQALLDLDLKSSPLNLQFEGQPLNLEDVETQITYLSKRLFREEEDQIELLQ
FT                   CVQDAIQCTNGKMPPDLEENFLLKSLDIIIKYYSDFLQGIQTVFSNQSVAKDEVVYCEH
FT                   LLNTKSASLQKIFDILYTRYQYLEENYCNLEEASLKLSKVQTLNAQWLVAFKNVEHVHI
FT                   LFEKLLKLESQYSAFQYMVTRLQELMEAVLGVRDGSSYLHLLDISEDEKSSFLAELSQQ
FT                   KEPIELLKLLSMKKVEFSMLKSEKLNQLDGKVQAISKSLFTFIDKRDEILVSPIVVQHL
FT                   FNEGRMGVHFISKLEKLKGTLTLLSNETRQLIFGEYVNDIDYIIDWIRGAVNVLYNNDN
FT                   ISVQKGEIIKNYLEYLQQNFLIHDKLLNLFNLKKEIKNKKESLLPILDRLKIALVQNEE
FT                   LDGELVNLKKEIDDLICQVNRQMLLIIEKDGEFKEFVELVSGLLNRIDHKDDIPEFLYC
FT                   MEIFDDSLAKLERGIDCTGDKENYTKYILENLRNISRLSSELKAKQTEKLPLGGEQSEL
FT                   IEELVSIGQQVNIKDQLSVLDDLYSFLDVAKYLQEEFNSLYKEAIESVLEIVDVEEEDK
FT                   SSFVELVNNKLKSLGNSFSSSEVVSSFMHQERQDVSKLGRLESYISILKEEPNNLKQLA
FT                   DQLLKFSSFTLPFTGERLHKTLQDMTTLNTLYEVTDYLKTYISKSRYIELDQLEGELRK
FT                   FVEYMINTVKSILPPLHEYEKSTCGCKSCQRVEQEMTLYFKIANDLDDLQSLLQQERKI
FT                   ITFGAIQKFQEICKNMKSMFLEDKDLVDSISNILLHSEHCKKMLGLDSYTTHFLLYIKF
FT                   LIYSVIEVGFSIEQDMVMELNVKIYRQEVLVSELKANLRKELDENIRNLLDQPIYYPKD
FT                   LINVRLIKRRFIDNGIIFDDLMKILEDSVKEKVQCSSSALVSLMCKERIDSMECLIDTY
FT                   QSEKVSYSYKLKLYTAIQEFMDNSVDQRNIQYLKEIDDGIRQVPNVLLFCPGNILLKAT
FT                   DIHAL"
FT   gene            580329..580493
FT                   /locus_tag="ECH_0569"
FT   CDS_pept        580329..580493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44520"
FT                   /db_xref="GOA:Q2GGQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ2"
FT                   /protein_id="ABD44520.1"
FT                   /translation="MKVILYYVNFKIAHLILMIINMCTFMIHTFYYIFNVNNKYLVFKF
FT                   ILTLKGDIY"
FT   gene            580695..581099
FT                   /locus_tag="ECH_0570"
FT   CDS_pept        580695..581099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44613"
FT                   /db_xref="GOA:Q2GGQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ1"
FT                   /protein_id="ABD44613.1"
FT                   /translation="MIPKETVDIDEPSINQKLPLKKIICQQLIRISTLCTFIALFAFLV
FT                   LTLVLFMSKSKDAEYIKNIKMSAVICLICSIAPFIIVNIFQNSNNRKGQILNGSGQEND
FT                   MLPPSTSNTFRNTLTILSTGVNIIHSIAIL"
FT   gene            complement(581263..582633)
FT                   /gene="mgtE"
FT                   /locus_tag="ECH_0571"
FT   CDS_pept        complement(581263..582633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="ECH_0571"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44921"
FT                   /db_xref="GOA:Q2GGQ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGQ0"
FT                   /protein_id="ABD44921.1"
FT                   /translation="MYTQESGHALHYILDEKTSNSLTEALETQNYLVVEEIINKSDNVQ
FT                   LAYFLLTSTYQHRKEFFNSINDNLIKDILIHLVPDLRQEIIKILGIKKVASLISQLSTE
FT                   DIVVIIEDLDKESQINILNILPKSNKIHVNELLSYPEESAGRLMHKDIIIAPEYWTINQ
FT                   LLNFLKQNNKLNKEFYEIFIVDPKLNPIGYLRLDNIICSNSTQIIKNLMKTDIKIIKSH
FT                   TTQEEVAEIFRKYSLLSAPVINRDGRIIGSIIVHDILNVMHQEAEKDVLHLGMVSNNDM
FT                   SSSLSKTVIKRLPWLIINLLTSTISSMIIGIFSNTLQHFIALSVIMPIIASMSGNAGLQ
FT                   ALTVTIRALSTKQLTNRNAHRLLFKELFVGFINGLILAIVSSIALMLRGQHVDIQVLAG
FT                   TSMIITFSIATFLGAAIPMILNLFKIDPAISSSIIICATSDTLSFLIFLGMATIFLL"
FT   gene            582825..582907
FT                   /locus_tag="ECH_0572"
FT   tRNA            582825..582907
FT                   /locus_tag="ECH_0572"
FT                   /product="tRNA-Leu"
FT   gene            583023..584546
FT                   /gene="atpD"
FT                   /locus_tag="ECH_0573"
FT   CDS_pept        583023..584546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="ECH_0573"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P05038; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF00306; match to protein family HMM PF02874; match to
FT                   protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45591"
FT                   /db_xref="GOA:Q2GGP9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGP9"
FT                   /protein_id="ABD45591.1"
FT                   /translation="MSGLASKAKSRVKSSKGKNSTNIHADELNEDVGVVVRVMTAVVDV
FT                   KFASGKIPKILNALESKEIYNGKKLVLEVSQHISDSIVRCIALDGTDGLSRNDKFIDTG
FT                   APISVPVGRGTLGRVFDVLGNTIDECGPLEESSYFIKQIYSEIPKLTDQKIATEILVTG
FT                   IKVIDLLAPYLKGGKVGLFGGAGVGKTVLIMELIHNIAKAHKGVSVFAGVGERTREGND
FT                   LYHEMIESGVINLENKDQSQAVLVYGQMNEPPGARLRVALSALTMAEYFRDAENQDVLF
FT                   FVDNIFRFTQSGSEISALLGRIPSAVGYQPTLAAEMGAMQERITSTNSGSITSVQAIYV
FT                   PADDLTDPAPATSFAHLDSTTVLSRQISELGIYPAVDPLDSTSQALSADVVGKEHYDVA
FT                   KEVQRILQTYKSLQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFHVAEVFTGAPGK
FT                   FVSLEDTVLSFKGLVEGKYDHLPEAAFYMVGSIDDVIKKAELLQKEGKV"
FT   gene            584546..584932
FT                   /gene="atpC"
FT                   /locus_tag="ECH_0574"
FT   CDS_pept        584546..584932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="ECH_0574"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P37812; match to
FT                   protein family HMM PF02823; match to protein family HMM
FT                   TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44865"
FT                   /db_xref="GOA:Q2GGP8"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP8"
FT                   /protein_id="ABD44865.1"
FT                   /translation="MKYLSVEFITPDAFLEVTNVLSITSYTVDGEFVILPGHEKYIIEL
FT                   RSGIIKLKVDTGLSLFYILNPILKVDLYNCKILANQFINACDVNAVILKKYKQDIEKIL
FT                   HCISDKALLKMAQMQLNFINQIVS"
FT   gene            584934..585596
FT                   /locus_tag="ECH_0575"
FT   CDS_pept        584934..585596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0575"
FT                   /product="putative transaldolase"
FT                   /note="identified by similarity to SP:P19669; match to
FT                   protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45102"
FT                   /db_xref="GOA:Q2GGP7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP7"
FT                   /protein_id="ABD45102.1"
FT                   /translation="MKIFLDTIDIDFLKEFSVTGLIDGITTNPLLLSKSNLECYDLIVK
FT                   ICSLITGPVSIEVISTSYKDMIKEGLEISRIAGNVVVKLPLTYDGLIACKVLSCEHNVK
FT                   VNVTLCFSVSQAILAAKAGAYFISPFVGRIDDIGQPGMQLIKDIRDVYSNYNAFNTEIL
FT                   VASVRNITHVIQSAKIGADIVTIPPSIFKQMFMHPLTNKGLEDFLQNWNASGKKIFS"
FT   gene            585858..586139
FT                   /locus_tag="ECH_0576"
FT   CDS_pept        585858..586139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:O05113"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44756"
FT                   /db_xref="GOA:Q2GGP6"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP6"
FT                   /protein_id="ABD44756.1"
FT                   /translation="MSLSNLSSKDENNVVIENLKRYIERIEKLESEKEEISQYIRKVYN
FT                   EANSNGFNAKVMRQIVKLRKMNSDDREEHEMLLMTYKRALGILVEIDE"
FT   gene            complement(586201..587394)
FT                   /locus_tag="ECH_0577"
FT   CDS_pept        complement(586201..587394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0577"
FT                   /product="RmuC family protein"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44510"
FT                   /db_xref="GOA:Q2GGP5"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP5"
FT                   /protein_id="ABD44510.1"
FT                   /translation="MLKNDLEKQVKKLEYENDNLKNKNDGFITKLQNIQNKVAELEFEK
FT                   KALNHTLDLYKNEFTTIDEKYKLYFENLANRIFDEKTDKFNKISQESLSRILNPLQEHI
FT                   NLFKKQVDDSFSIHNKEQFLLKQEIQRIILANEKITLQAENLADVLKGNVKIQGNWGEM
FT                   ILEKILESSGLRKNQDYVLHGTGMDLQDSEGNKQQPDAIINLPENKHLIIDSKISLIHY
FT                   EKYFATKSEESKNVLLKQFITSIRVHVNVLSNKKYQNIEKLKTPDFVLMFIPIEGAYSL
FT                   AMQEDIMLHNYAWNKKIVIVCPSTLFATLRTIESVWRLERQNRNTMEIARQGGALYDKI
FT                   VGFISDMQKLGKQVNILNNVYNDAMKKLSEGHGNILSRTENLKHLGVKTSKTILENT"
FT   gene            587676..588233
FT                   /locus_tag="ECH_0578"
FT   CDS_pept        587676..588233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0578"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44895"
FT                   /db_xref="GOA:Q2GGP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP4"
FT                   /protein_id="ABD44895.1"
FT                   /translation="MIFHIDGVDADKSKLLNKLITHKNYIWFYRSICIGIITTDNKFVL
FT                   LKDESIPFYYEQQVVPSYIFFMKGREEGVKVWHCVLIKGCQVSQFVDKTSIIINMEKER
FT                   NPIGIIVHICDIQDYGEIIYSGIGKMSMSNFKKNLKDICKSSANPQLSTVTFPISYWSK
FT                   LVQNVVEIIPMQKINYTRINNN"
FT   gene            588503..589192
FT                   /gene="virB8-2"
FT                   /locus_tag="ECH_0579"
FT   CDS_pept        588503..589192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8-2"
FT                   /locus_tag="ECH_0579"
FT                   /product="type IV secretion system protein VirB8"
FT                   /note="identified by similarity to GB:AAS14504.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44776"
FT                   /db_xref="GOA:Q2GGP3"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP3"
FT                   /protein_id="ABD44776.1"
FT                   /translation="MDDTQTNDDRYIGSNQYFQDALNWYCGRYLLCITERAWLFVISLF
FT                   LSSILLILILDIFSYFPLKTNFSFTKYTDHYTDEFSVIKKLSTNNEDSEETLLSQYLVA
FT                   QYVKKYESYLYNDLDSQFNFIKNNSSRKIYLAFKEMIASHHYIDNSKYNAISIETTIHN
FT                   VKLLSKDFTSSNNAIVTFKKQIAINGVISHVQSYKVLVTFSLSSIKMAISGIMPLEFLV
FT                   HDYKKLD"
FT   gene            complement(589663..589764)
FT                   /locus_tag="ECH_0580"
FT   CDS_pept        complement(589663..589764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45521"
FT                   /db_xref="GOA:Q2GGP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP2"
FT                   /protein_id="ABD45521.1"
FT                   /translation="MIDLYNMKLLQELWEQRFLKQIYTSQNNTKIHI"
FT   gene            589788..590924
FT                   /locus_tag="ECH_0581"
FT   CDS_pept        589788..590924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0581"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45546"
FT                   /db_xref="GOA:Q2GGP1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP1"
FT                   /protein_id="ABD45546.1"
FT                   /translation="MGDIFINLLKLISLPVVFFSITSTISGLANLTEIKTLIRKTIFYT
FT                   ISTTVIAATVGLITYLLIDPSKKELIYNILSTNKHISNTPDYLSYLMSILPYNFIKVFL
FT                   DNNVIGCVILAFLIGGALLLLPDKNKRELLHKVFDALFDTFLEIAKLILKLMPIALWSF
FT                   ITVLLYNMKEGYNISNVLKYLLCIMIANFIQACIILPLLLKLKKIPVIKTFRGVLPALT
FT                   IAFFSKSSTATLPTTLRCTQDYLNIPKKISSFILPVCTTINMNACAAFILITVFFVSEV
FT                   NGYTFSIGEMFLWVFLATGAAIGNAGVPMGCYFMAMSYLMSMKVPLSIMGVILPVYTII
FT                   DMFETAINVWSDVCITQIVHKEYDALIKKGKKIGINDQ"
FT   gene            complement(591105..591296)
FT                   /locus_tag="ECH_0582"
FT   CDS_pept        complement(591105..591296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45060"
FT                   /db_xref="GOA:Q2GGP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGP0"
FT                   /protein_id="ABD45060.1"
FT                   /translation="MRKDKQYTASFKQHKNCFLSCYIKESSTFYFPQSRITDYRINPTL
FT                   YKEEFYEQQKQLSKLSIN"
FT   gene            complement(591543..591638)
FT                   /locus_tag="ECH_0583"
FT   CDS_pept        complement(591543..591638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44679"
FT                   /db_xref="GOA:Q2GGN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN9"
FT                   /protein_id="ABD44679.1"
FT                   /translation="MSDVIQLFINCVVCRAIVLVIIFVQKNKLFW"
FT   gene            complement(592179..593459)
FT                   /gene="serS-1"
FT                   /locus_tag="ECH_0584"
FT   CDS_pept        complement(592179..593459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS-1"
FT                   /locus_tag="ECH_0584"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45200"
FT                   /db_xref="GOA:Q2GGN8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN8"
FT                   /protein_id="ABD45200.1"
FT                   /translation="MNFMHDIDFIKQNPELFDNAMQVRNSEKVAKKIIELDVKKRHLLT
FT                   QLYSLQKERNQITQEIEKLKKNNLQCNIQIELSKNVTSKINDINNMIKEDSQLVNLLNM
FT                   LPNIPDERVPIGKDENSNVELRRHGNKTSFDFPIKTHYELGENLNLMDFKQAAKLSGSR
FT                   FVILKNQLAQLDRALSNFMLDIHTKEFGYSEISHPILVHESAMYGVGQLPKFADDSFKT
FT                   TENFRLIPTSEVALTNLVSNMNINGCDLPLRFTACSPCFRSEAGSAGRDTRGMMRQHQF
FT                   NKVELVSIVTEEQSAPELERMTQIAEEILKRLELPYRVMMLCTGDMGFSASITYDIEVW
FT                   IPSQNQYREISSCSNCKAFQARRMNTKYTTIINNVKVSKFVHTLNGSALAIGRTIIAIL
FT                   ENYQNRDGSITIPHILRKYMDNQEVIK"
FT   gene            complement(593521..594735)
FT                   /locus_tag="ECH_0585"
FT   CDS_pept        complement(593521..594735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0585"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44932"
FT                   /db_xref="GOA:Q2GGN7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN7"
FT                   /protein_id="ABD44932.1"
FT                   /translation="MKKVAVVGFQKINSSSLISYMVKHNISVILIILDEADYNFQNQED
FT                   HVLVNSVSLNGNLSCLKDVEWIINITSEKSGEDYNLIYNTYNKILPHVSNNVIISATSN
FT                   FFLDVVSKIPHNTFCHFLIVSFFYYANTVKLIECAYYNSLENKGIEILSNSFSNVITCS
FT                   NISGLILDRILSFWSMILLIGTYTFNINIEDADSIITNKYMGIPNGAFNLLDEIGLDNF
FT                   ILTVKHLINSLPSNDHLHKLYNAIPRVVLQMISDGYTGSTSKIGGFYRFYELYGGNSNQ
FT                   VIDLHTGLYRKAYIINHDFKNIQDLFDIHDKYGQFMWYVWSNTLIYISSLIPELSSISA
FT                   IDKAMKLACDWKYGPFEIVDLLNDAIENKLSDSTGDDNLPQILSFKKRMYNNKKQCLNI
FT                   NGTYT"
FT   gene            complement(594695..594799)
FT                   /locus_tag="ECH_0586"
FT   CDS_pept        complement(594695..594799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0586"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45339"
FT                   /db_xref="GOA:Q2GGN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN6"
FT                   /protein_id="ABD45339.1"
FT                   /translation="MINSCYRCLLEFITKKKGFCSDEKGSSCRFPKNQ"
FT   gene            complement(594830..595288)
FT                   /locus_tag="ECH_0587"
FT   CDS_pept        complement(594830..595288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14508.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45073"
FT                   /db_xref="GOA:Q2GGN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN5"
FT                   /protein_id="ABD45073.1"
FT                   /translation="MGDETNKDSKFTKQFAANRKGNAASFSEKYKNPNALPNKSAKFSS
FT                   ILQDKPEKEVPFSDSKNLLRKSKLNNKNFAESTKKSRLDCLFLVRGKDNGRAAWHYVLV
FT                   DKPKREMFLAKSRSGSIDVALYGQILYSGWGENPPEDIVKKIEDEFGA"
FT   gene            595400..596311
FT                   /gene="miaA"
FT                   /locus_tag="ECH_0588"
FT   CDS_pept        595400..596311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="ECH_0588"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by similarity to SP:P38436; match to
FT                   protein family HMM PF01715; match to protein family HMM
FT                   TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45295"
FT                   /db_xref="GOA:Q2GGN4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGN4"
FT                   /protein_id="ABD45295.1"
FT                   /translation="MNNILIITGPTASGKSKISMKIAQDNNGIIVNCDSKQIYREIPII
FT                   TDQPNLNDTSVEHKLYGYVSVTQQYSVGLWIEDLKDEISSIIQQKKFPVITGGSGMYIN
FT                   SLIYGLSQIPKIEDSVRNETRRLFKTLGKKEFYALLIDKDPIAKCLHKNNSHQLLRAYE
FT                   VIEQTGISIFVWKENAPREPIFKNFKLCILMPPRSEIYKKINERFINMINTSVIEEIEN
FT                   LLSLNIPAHFPAMKAHGVPEIIQYLQNKISIDQAIEIAQKNTRNYAKRQYTWFKHQFRN
FT                   ALFYESQDQLLESIKNSYVYYN"
FT   gene            complement(596874..596981)
FT                   /locus_tag="ECH_0589"
FT   CDS_pept        complement(596874..596981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44677"
FT                   /db_xref="GOA:Q2GGN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN3"
FT                   /protein_id="ABD44677.1"
FT                   /translation="MVFLFDSTLTCTLIDYKLFEKGIFDSYDFVAKYFS"
FT   gene            596951..597136
FT                   /locus_tag="ECH_0590"
FT   CDS_pept        596951..597136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45208"
FT                   /db_xref="GOA:Q2GGN2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN2"
FT                   /protein_id="ABD45208.1"
FT                   /translation="MLMYYQIKIPKYRKIKNIRFYINVYFYRRCIFPCNVRRYYAYIVM
FT                   HWIKKFIISVLSFLLN"
FT   gene            complement(597661..598515)
FT                   /gene="hemF"
FT                   /locus_tag="ECH_0591"
FT   CDS_pept        complement(597661..598515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="ECH_0591"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by similarity to SP:P36553; match to
FT                   protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44582"
FT                   /db_xref="GOA:Q2GGN1"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN1"
FT                   /protein_id="ABD44582.1"
FT                   /translation="MKAKQKRAVDWFKTLQNQLLSEFISIEKQFSSFIPQVDHKHWERP
FT                   GGGGGHSIVIYGKVFEKAGINVSEVYGDMEQNHELSHAVNPSELSNTFIGKDKKFWASG
FT                   ISVVAHMCSPFVPAVHMNTRFICISDKNWFGGGIDLTPTYENKKDQELFHSNLREMCDQ
FT                   YDKSYYQKFKQQCDEYFFLHHRKEPRGIGGIFYDNINSGNWEADFQYTQAVGKFLLDIY
FT                   PIIVKRNLHTPWTAEEREYQLVKRGRYVEFNLIYDRGTRFGLLTNGNSDAIMMSMPPIV
FT                   KWK"
FT   gene            598818..598964
FT                   /locus_tag="ECH_0592"
FT   CDS_pept        598818..598964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0592"
FT                   /product="coproporphyrinogen III oxidase, aerobic,
FT                   truncation"
FT                   /note="identified by similarity to SP:P72848"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45071"
FT                   /db_xref="GOA:Q2GGN0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGN0"
FT                   /protein_id="ABD45071.1"
FT                   /translation="MILGKDKKFWASGISIVAHMCSPFVPAVHMNTRFICISDKNWFGS
FT                   GIE"
FT   gene            complement(599027..600175)
FT                   /locus_tag="ECH_0593"
FT   CDS_pept        complement(599027..600175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13842.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45562"
FT                   /db_xref="GOA:Q2GGM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM9"
FT                   /protein_id="ABD45562.1"
FT                   /translation="MLFINQATANDFALSGKLNLQYGFNSNDFSRLSFNATSTLEYSYH
FT                   INDYFSVGPFLKLSTNLMSNSIDSSGNAKDSILDINSNTKEAYVFIKSSNIGSLQVGLT
FT                   SPVSQKMKLSSSDISVASGGVTGSWLQYVNLRTDNSNFSYGHNKEDTVLFTPGLYIAYH
FT                   GSAIPVVSYYSPQIKGIKLGLSYIPKDKIQDIANNIKSHVYKNIVSVGVKYQNQLSSGI
FT                   GYSISGVVEHAVNDLLPASNQQQQVQYNNLLSYNAGFSLKYNNITFIGSYGNLGNSGKK
FT                   EISVQSNHYKIIDSEFYDLGLKIENDLFNVGLSYFYGGKKVNLKTSPENYAKHALSACA
FT                   LGIEKILRNNMILYADIVFFDVDRTDTNKSGYIGLIGAKLSF"
FT   gene            complement(600445..601410)
FT                   /gene="argB"
FT                   /locus_tag="ECH_0594"
FT   CDS_pept        complement(600445..601410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ECH_0594"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45516"
FT                   /db_xref="GOA:Q2GGM8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGM8"
FT                   /protein_id="ABD45516.1"
FT                   /translation="MKLHNVLKNNNKEDVVSNIEQFGGNADWFNAARVLSESLPYIQQF
FT                   SGETFIIKYGGAAMKDRKLAENFAHDIVLLKQLGINPIVVHGGGSKINEFLEKINKKST
FT                   FVNGLRVTDAETLEIVEMVLCGLVNKDITQLINKAGGNAIGLCGKDANLIEAKKVCYTY
FT                   KENQSNNVEKILDMGFVGEPHEVNTDLLFFMEESDFIPVIAPVCSGENDLTYNVNADLV
FT                   AGALANALAAAKLIILTNVPGVTDVNGNLLSEISVSNAESLIEQGIANAGMIPKLQTCI
FT                   KVVKEGYGSAHIIDGRIPHVLLLELFTIHGTGTMVLNTDI"
FT   gene            complement(601382..601984)
FT                   /gene="engB"
FT                   /locus_tag="ECH_0595"
FT   CDS_pept        complement(601382..601984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="ECH_0595"
FT                   /product="GTP-binding protein EngB"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45005"
FT                   /db_xref="GOA:Q2GGM7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGM7"
FT                   /protein_id="ABD45005.1"
FT                   /translation="MKLKTIMSKCEFMIGATHIKSLPDFSIPEIAIAGRSNVGKSSLIN
FT                   AITNNKKNAKTSSKPGCTKQINFYLINKDFMVLVDLPGYGYSKADKTTINNYLCLMEYY
FT                   LLNSRNLLKVILLIDAKVGFKEIDLDFINWLELHQIHYQLVLTKIDKIKKEMLDVNVNY
FT                   IKNLNLDFIMYPIISTSSQCKQGIEELIYEIAQCIKK"
FT   gene            601993..602115
FT                   /locus_tag="ECH_0596"
FT   CDS_pept        601993..602115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45336"
FT                   /db_xref="GOA:Q2GGM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM6"
FT                   /protein_id="ABD45336.1"
FT                   /translation="MLNYKNIKIYKKLCFNTITYKNLKKKILQLILQMILSSKK"
FT   gene            602148..603227
FT                   /gene="prfA"
FT                   /locus_tag="ECH_0597"
FT   CDS_pept        602148..603227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="ECH_0597"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44871"
FT                   /db_xref="GOA:Q2GGM5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGM5"
FT                   /protein_id="ABD44871.1"
FT                   /translation="MSFDNSLEELSQKFYKLKSMLEDPSQLSVDSFVAASKEYSELLPV
FT                   ISVIDQYNILQKDIAGLEELINNPETDHELKSLAKEEFYERQKQLPKVKHKLKLSLLPK
FT                   DKDDARNAILEIRAGTGGEEAALFVTDLYRMYTKYAEQKNWKFEQINSSSTGIGGHKEI
FT                   SLCISGSNVFARLKFESGVHRVQRVPETEASGRLHTSAATVAVLPEIEEVDLKIDEKDL
FT                   RIDVYRSSGPGGQSVNTTDSAVRITHIPSGIVVIQQDEKSQHKNKSKALKVLRARLYNL
FT                   EKQKRDAEISQMRKSQIGSGDRSERIRTYNFPQSRITDHRINLTLYRLDDIMKEGNLDE
FT                   FIEALIAEDEANKLKNLHI"
FT   gene            complement(603993..604172)
FT                   /locus_tag="ECH_0598"
FT   CDS_pept        complement(603993..604172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45045"
FT                   /db_xref="GOA:Q2GGM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM4"
FT                   /protein_id="ABD45045.1"
FT                   /translation="MYLLYETLNFQTSFASYQIIFRYEIHIILIILSSKKYVKLLEVNI
FT                   MIHSTSLRHDKLPF"
FT   gene            complement(604639..606171)
FT                   /gene="pccB"
FT                   /locus_tag="ECH_0599"
FT   CDS_pept        complement(604639..606171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="ECH_0599"
FT                   /product="propionyl-CoA carboxylase, beta subunit"
FT                   /EC_number="6.4.1.3"
FT                   /note="identified by similarity to GB:AAB28900.1; match to
FT                   protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45227"
FT                   /db_xref="GOA:Q2GGM3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM3"
FT                   /protein_id="ABD45227.1"
FT                   /translation="MNFAGLQDLNNRQSKSYNGGGLSRIEKQHLKGKLTARERLTVLLD
FT                   DNSFEEYGAFVEHRCVNFSMDKSKIPGDGVVVGYGTINGRKVCIYSQDFTVFGGSLSES
FT                   NAKKICNIMDKAASLGIPIIGINDSGGARIQEGVDSLSGYGEIFQRNVNLSGVVPQISL
FT                   IMGPCAGGAVYSPALTDFIFMVRNTSYMFVTGPDVIKKVTYEEVTQEDLGGAKVHASKT
FT                   GIADLVFHNEIEALLQVRRFMNFIPSNNMESIGSQSASNFINMEDLSLNTLVPKNSTTP
FT                   YNMYELLEKVCDERLFYEIKPDFARNIIIGFGKIGGYNVGLVANQPLHLAGCLDIDASR
FT                   KGARFIRFCDAFNIPVITFIDVPGFMPGVNQEHSGIIAHGAKLLYAYAEATVPKISVIV
FT                   RKAYGGAYIVMNSKHLCGDVNYAWQDAEIAVMGAEGAVEIIFRNEKDKDKIQHIIDEYR
FT                   TTIVNPYVAASRGYIDDIIVPSRTREHLFKSLQFLEKKKVHKIMRKHDNLPL"
FT   gene            606302..606445
FT                   /locus_tag="ECH_0600"
FT   CDS_pept        606302..606445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44592"
FT                   /db_xref="GOA:Q2GGM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM2"
FT                   /protein_id="ABD44592.1"
FT                   /translation="MIDYNNLTFPNPVALTSVNVPAQYIASTILPSSSQKLKRERTVLA
FT                   LT"
FT   gene            complement(607514..608638)
FT                   /locus_tag="ECH_0601"
FT   CDS_pept        complement(607514..608638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45412"
FT                   /db_xref="GOA:Q2GGM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM1"
FT                   /protein_id="ABD45412.1"
FT                   /translation="MSLTLLKLKTGEYCLCVSDHCKFNKSLNTYYTCNDDLNRVLEHNS
FT                   TNSGDGLDELIGVKFDDFHLVENPLGVYNYVFFYGMHRNELSFLIIPFSPNLSFNDILK
FT                   GFQFSKSSVSCIGHVIYDYGHAFRRDIQGYRRFVNLKFTEAFTVTFTDHYIQRVVSNIP
FT                   TEDHSRDMYFYKFFDKHNTLYYVQNKTFNNQLSSSLNISSRQNTVTHSEEHGNSLSDNS
FT                   MQLEHNVASTSNVTQQMHCKVRNNNVDSSYVVDINNVESEYYVLPISVSEQSIQHYVIP
FT                   KDRSDHSMYHVKINDSHQRECYVTRIGDSRVQEHYSVLSRRQRNGESSIVLKSHTSKSV
FT                   AETLPRNNGNIPTLSLSSVTSESVTTQSSILSSL"
FT   gene            complement(608831..609643)
FT                   /gene="mutM"
FT                   /locus_tag="ECH_0602"
FT   CDS_pept        complement(608831..609643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="ECH_0602"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by similarity to SP:P05523; match to
FT                   protein family HMM PF01149; match to protein family HMM
FT                   PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45492"
FT                   /db_xref="GOA:Q2GGM0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGM0"
FT                   /protein_id="ABD45492.1"
FT                   /translation="MPELPEVEIVCRALSSQILGKTILDIEVNRYDLRVPVTQNLCDIA
FT                   VNSSVFQVLRKGKYIVLVLSNQYYLVIHLGMSGNLIYSESYIKQKKHNHVIFHFSNNNL
FT                   LIFNDPRRFGIVILLTYSQYIEFFKNFGVDALSDEFNTNYLYNTSNKRCTIKSLLMNNK
FT                   FVTGIGNIYSTESLFLAGIAPNRFVKDLSIIECNNIIDGVKNILLYSIENGGSSIKDYT
FT                   SPFGIRGTFQNHFLVYNRTRQQCYKCNSSILVIKQNGRSTFFCPYCQL"
FT   gene            complement(609627..609749)
FT                   /locus_tag="ECH_0603"
FT   CDS_pept        complement(609627..609749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44844"
FT                   /db_xref="GOA:Q2GGL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL9"
FT                   /protein_id="ABD44844.1"
FT                   /translation="MDKSKKIKNEDKNKALSNALKANLLRRKNKQRQVKNARTT"
FT   gene            609779..609849
FT                   /locus_tag="ECH_0604"
FT   tRNA            609779..609849
FT                   /locus_tag="ECH_0604"
FT                   /product="tRNA-Thr"
FT   gene            610385..611794
FT                   /gene="gltX-2"
FT                   /locus_tag="ECH_0605"
FT   CDS_pept        610385..611794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-2"
FT                   /locus_tag="ECH_0605"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45013"
FT                   /db_xref="GOA:Q2GGL8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGL8"
FT                   /protein_id="ABD45013.1"
FT                   /translation="MSHNVITRFAPSPTGHLHLGGARTALFNWLYAKHNNGKFLLRIED
FT                   TDKKRSSKELIDSIINAMSWLKIPYDGEIVLQSKNISRHIEIANQLILNNKAYYCYCSE
FT                   EEINKEKEEFSKKGLYYKHNCIWKNKNFTIDNLTRVIRLRSPTEGVTSFDDKVYGNITV
FT                   SNTQLDDMVLLRSDNTPTYLLSVVVDDHDMNITHIIRGTDHLTNTARQLLIYNALEWNP
FT                   PKFAHIPLIHDEDGNKLSKRHQAIGIHEYKNLGILPEAISNYLLRMGWSHEDDEIISMD
FT                   QAIKWFSIKNIGQSPARLDNKKLEFLNNHYISLTEDEVILNMIIPIIEKKIGYMLNEVK
FT                   KGYLLKGLYELKKRTKNLVNLANESLFYVEDVPISIDQEASAIIKDYKHVFSILYNNLS
FT                   RISEKEWNNSILTSTIKNISQNLDIKISNIYHCLRASIVGRMNAPSIIEIMINLQQEEC
FT                   LKRIKYAQNIE"
FT   gene            612281..612430
FT                   /locus_tag="ECH_0606"
FT   CDS_pept        612281..612430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0606"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45255"
FT                   /db_xref="GOA:Q2GGL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL7"
FT                   /protein_id="ABD45255.1"
FT                   /translation="MYKNIVSVGVKYQNQLSSGIDYSISGVVEHAVNDLLPTSSQQQQV
FT                   QYNN"
FT   gene            612626..613594
FT                   /locus_tag="ECH_0607"
FT   CDS_pept        612626..613594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44744"
FT                   /db_xref="GOA:Q2GGL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL6"
FT                   /protein_id="ABD44744.1"
FT                   /translation="MNLTLLKLKTGKYILCDIYEFHEYDLDSDFTNDHYTLDHFIGMKF
FT                   EDCYFIENTLSKYYYAFFYGMHKNNLLFLAIRINRNISNNQLLKSFQFSERSICCFGIA
FT                   THIHDLDIKKSMHQYYHFIRHENPTIQFTRLFTVVAVSHYIKCSMLQSIYDDNNQNSTY
FT                   SICVYNFFDKEGKIYYQQYEHHTAYPLYILLNFEKNIIICDNALGGLRRYKNYTCHNVK
FT                   YGGQCKGNIGYFLEKSTNTFMCVEHDDILESNQLSYSTKVATSSQQEYHPLLPSTSEVE
FT                   VPQINHDGLEDDISPRNNESAPGLFVHNTDLEPLTVKFPFR"
FT   gene            613759..613938
FT                   /locus_tag="ECH_0608"
FT   CDS_pept        613759..613938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44498"
FT                   /db_xref="GOA:Q2GGL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL5"
FT                   /protein_id="ABD44498.1"
FT                   /translation="MKIMIYSNNHNFLMYKKFRVLFAIVGIKYQLLNNIVMYDGHRCFI
FT                   GYMKSKNNINFLID"
FT   gene            614421..615326
FT                   /locus_tag="ECH_0609"
FT   CDS_pept        614421..615326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45258"
FT                   /db_xref="GOA:Q2GGL4"
FT                   /db_xref="InterPro:IPR021387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL4"
FT                   /protein_id="ABD45258.1"
FT                   /translation="MLAKLPKVSKSKSQEQNEPWQQNETPEQIKQRVQNIISSPGVDND
FT                   DAELICNMIDKNHVQDLLYLRYYVQNLKNDPRMKLKSIRCVGNTNSNTGELTLYIGDRK
FT                   KIPVIPHGTSIFRVTVNILNNALNDNPFLKELNVISNNNDSSCFDLYCLVLATNMTNFK
FT                   CSTQSKGNNDFLEFSELMLVHPQSGKDGKHLTPHFEEKYLAMLGFHVCLEPIVLKTDEQ
FT                   EASECDEGASPTKSPYASNDSIASSYSTSSSLETVGMSEEEDTDLNPLTPSPHVLGPSL
FT                   YEPMFFPDTPGTPKTSRRSK"
FT   gene            complement(616237..616374)
FT                   /locus_tag="ECH_0610"
FT   CDS_pept        complement(616237..616374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0610"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45133"
FT                   /db_xref="GOA:Q2GGL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL3"
FT                   /protein_id="ABD45133.1"
FT                   /translation="MFEELINSIDFFVQDYIILLVKNIVTLSYLLINVKEHLMYILSSY
FT                   "
FT   gene            616875..617564
FT                   /locus_tag="ECH_0611"
FT   CDS_pept        616875..617564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45389"
FT                   /db_xref="GOA:Q2GGL2"
FT                   /db_xref="InterPro:IPR021387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL2"
FT                   /protein_id="ABD45389.1"
FT                   /translation="MQSLDIKKFVNGHLCRKADALSFIYQKCYCIGHTPEDSDTLTIHL
FT                   SKTHKSKKKVVPSKNSLFVLNVEYPVAMMKQLRHMNFLTLSKDEMGKNVIDAKLYIFVK
FT                   QCNLKKFMKEVLNNNKPGSTVTPSEYGSVVYTVLCNNKLFEDFNEHNALSTISKMALTN
FT                   TREFPAFKFIPKVGIARKLLHAIGCVSQNDEPLTSTTIGTQEEESVPTLDCLSTEPIYE
FT                   PLQTHNK"
FT   gene            617759..618385
FT                   /locus_tag="ECH_0612"
FT   CDS_pept        617759..618385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45042"
FT                   /db_xref="GOA:Q2GGL1"
FT                   /db_xref="InterPro:IPR021387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL1"
FT                   /protein_id="ABD45042.1"
FT                   /translation="MNVTVLNGYCVGTTQPNNKLEVSTEADEINPIVPSQGGPSLFKLF
FT                   VQIPKDSVLGDPILTESVDFSQENITKLTVEAEVFAIVRSNDTKHFVHILDKTNEEKRK
FT                   QDKKKSKKYKALDFASIANSCNPVLVKPKAYANPEVKFDLKYALLTTGGLNYVTFSPST
FT                   PRTEERLKILSTSAPSILQQQPTSRLSESDVEGSAGCFSFLRCTR"
FT   gene            618874..619020
FT                   /locus_tag="ECH_0613"
FT   CDS_pept        618874..619020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0613"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAQ95406.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44742"
FT                   /db_xref="GOA:Q2GGL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGL0"
FT                   /protein_id="ABD44742.1"
FT                   /translation="MQSFNSKDQLENFIIKHKTKESNNYKSYAFCIVNRNTIFELRKEF
FT                   IEI"
FT   gene            619307..620002
FT                   /locus_tag="ECH_0614"
FT   CDS_pept        619307..620002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45250"
FT                   /db_xref="GOA:Q2GGK9"
FT                   /db_xref="InterPro:IPR021387"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK9"
FT                   /protein_id="ABD45250.1"
FT                   /translation="MLGILGNNLEEQTWYNEKLCADVSKISKTEPLICYRSYCIGNTED
FT                   GDTKQLQIFVNDSYKKNVHKCFPSGKSMFILKTLLPKHLIKHHSKIRQAVMKYTQDYDP
FT                   SFCHMHIYLLVNEDKLNIFYHDVHNRLLNKERLMIPIEDLTQYGTMELIYIPYINRKEK
FT                   KFDMEYALQNVAGLNAQFIYDQQEKKSSEHDETNAGAVSSFFSNLRITITKKASTDEDK
FT                   EPLVANTRM"
FT   gene            complement(620625..621170)
FT                   /gene="nuoE"
FT                   /locus_tag="ECH_0615"
FT   CDS_pept        complement(620625..621170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="ECH_0615"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF01257;
FT                   match to protein family HMM TIGR01958"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45549"
FT                   /db_xref="GOA:Q2GGK8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK8"
FT                   /protein_id="ABD45549.1"
FT                   /translation="MSNIQKNSNEHYTETFKFNKDNLKQANDTISKYPHDRKSSAVMDL
FT                   LHIAQKQCGGFIPLSAMNYIADFLGMRLIHVYEVAKFYSMYNLSPTGKYLIQVCRTTPC
FT                   WLCGSDDILKSCKELLNICVGETTSDNLFTLKEVECLGACVNAPVMQINDDYYEKLTPD
FT                   KVKDILMEIQKKEAVVSD"
FT   gene            complement(621177..622358)
FT                   /gene="nuoD"
FT                   /locus_tag="ECH_0616"
FT   CDS_pept        complement(621177..622358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="ECH_0616"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF00346;
FT                   match to protein family HMM TIGR01962"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44926"
FT                   /db_xref="GOA:Q2GGK7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGK7"
FT                   /protein_id="ABD44926.1"
FT                   /translation="MSDRVKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGL
FT                   LHRGTEKLIEYKTYLQALPYFDRLDYVSPMCQEHAYSLCVEKLLKCEIPIRAKYLRVIF
FT                   CELTRILNHLLNISSQALDIGAMTPLLWMFEEREKILGFYERASGARFHSAYIRPGGVA
FT                   ADVPDDLIDDIFKFIKTFPKFIDDVDELLTENRIWKQRNVDIGIVSKEQALDWGFSGPM
FT                   LRACGIPWDLRKSQPYEIYEDLEFEIPIGKKGDCYDRYLVRMAEIRQSIKLLEQCLNRL
FT                   PNGPIKTDDRKIAPPKRSEMKESMEALIHHFKLYSEGYSVPIGETYMAVEAPKGEFGVY
FT                   IVSDGTNKPYRCRIRAPGFAHLQAIDMMAKGHMLADLTAIIGSLDIVFGEIDR"
FT   gene            complement(622562..623665)
FT                   /gene="nuoH"
FT                   /locus_tag="ECH_0617"
FT   CDS_pept        complement(622562..623665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="ECH_0617"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF00146"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45400"
FT                   /db_xref="GOA:Q2GGK6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGK6"
FT                   /protein_id="ABD45400.1"
FT                   /translation="MSYYNIFLDFLSYIGSGAALFIKIIAVIISVMISVAYLVYMERKV
FT                   IAAIQLRQGPNVVGPFGLLQPFADAVKLIIKEHIIPFKSNKICFLIAPIITFTLALLGW
FT                   AVIPFGADVIVNDGYEVIIPNAIANINIGVLYILAISSLGVYGIIIAGWSSNSNYAFLG
FT                   AIRSASQMISYEVSIGLTIVTVLLATGSLKLGEIVVARHNMPYWIDLLLLPMACIFFIS
FT                   ALAETNRHPFDLPEAESELVSGYNVEYSSMPFALFFLGEYANMILINAMAVIFFFGGWY
FT                   PPLNIGFLYIIPGIVWFVLKVVALLFCFIWIRATIPRYRYDQLMGLGWKVFLPISLLWV
FT                   VLVSSILVYTDSLPSNNKQYVSHAMHK"
FT   gene            complement(623672..625723)
FT                   /gene="nuoG"
FT                   /locus_tag="ECH_0618"
FT   CDS_pept        complement(623672..625723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="ECH_0618"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by similarity to SP:P29915; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   PF00384; match to protein family HMM TIGR01973"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44633"
FT                   /db_xref="GOA:Q2GGK5"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK5"
FT                   /protein_id="ABD44633.1"
FT                   /translation="MVKLVIDSLEIEVEDGMTVLQACEVAGVQIPRFCYHERLAIAGNC
FT                   RMCLVEVVGGPPKPVASCAMPVAEGMVVKTNTDKIKKAREGVLEFLLINHPLDCPICDQ
FT                   GGECDLQDQTMLYGRGKSRYKEEKRAVKKKNFGPLIENTMTRCIHCTRCVRFLSDVAGS
FT                   YELGTMGRGENMEIDTYISKCITSELSGNIIDLCPVGALTSKPYAFKARSWELRHCETI
FT                   DVLDAVCSNIRVDTRGLEVMRILPRLNESINEEWISDKTRFSYDGLKLQRLDKPYVRKN
FT                   GQLLPATWEEAFNVIAKRISNVSGDKIAAIAGDLADCESMLLLKELMHGLGSSNIECRQ
FT                   DGSVVPTNSRALYLFNTGISNIENADLCLLINTNIRFEAPIINARLRKRYLRGGFKIAN
FT                   LGVYDNFNYKVEDLGNSCLVLDDILHEKIPFSELLKYAKNPMLIIGQDALVGDNGHSIF
FT                   VLATKIAAKFGMLRDDWNGFNVLHKASARVGALDIGFVPSSNTNIMSDIINGIGSSEIE
FT                   VLYLLGADEVEISRSKSSFIIYQGHHGDRGAQVADVILPGAAYTEKNATYVNTEGRVQR
FT                   TNIAVSPPGLAREDWLIIKELSKYLKMDMQYESLNCIRNKLSTLGKQFREENIGSLISN
FT                   KWASIDGSMILERDSVFINKDFNFYMANPISRASIIMANCVKAFANKD"
FT   gene            complement(625733..625951)
FT                   /locus_tag="ECH_0619"
FT   CDS_pept        complement(625733..625951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13913.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45284"
FT                   /db_xref="GOA:Q2GGK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK4"
FT                   /protein_id="ABD45284.1"
FT                   /translation="MAKKGAKVAKTASKNNPLQRKKGTAQKMYNGKSVKPVKYINREAG
FT                   KIFIAGQYDNGDLVQDTTGNPIEWASI"
FT   gene            complement(626143..628539)
FT                   /gene="gyrB"
FT                   /locus_tag="ECH_0620"
FT   CDS_pept        complement(626143..628539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ECH_0620"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P06982; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44620"
FT                   /db_xref="GOA:Q2GGK3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK3"
FT                   /protein_id="ABD44620.1"
FT                   /translation="MDDYNASSITVLKGLDAVRKRPGMYIGDTDDGSGLHHMVYEVIDN
FT                   SIDEALAGFCNKIDIVIQSDGSVSVVDNGRGIPVDMHEDEGMSAAEVIMTQLHAGGKFD
FT                   HNSYKVSGGLHGVGISVVNALSSWLELTIWRNGKEYFMRFEDGITVKSLSVVGENTTKK
FT                   GTKITFLPSKNIFSSINFSYSTLENRIRELSFLNSNINMNLKDLRGAQILNSSFGLKDN
FT                   SKVNDIEDRGTAAFVKYLDRNKTAVTKVVHIEGIVLEHGISLELSMHWNDSYYENMLCF
FT                   TNNIRQKDGGTHLAGFRSAMTRCINNYATNEGFLKKAKVNILGEDVREGLTCVLAIKLP
FT                   DPKFSSQTKDKLVSSEARTAVENIVYEKLTNIFETNPKLATSIIERIIRSAKGREAARR
FT                   ARDLIKSKNGFDFTILPGKLADCQEKSPELSELFIVEGNSAGGSAKQGRDRRSQAVLSL
FT                   KGKILNVERASLDRILSSAEIASLITAIGSNIGTENFDIEKVRYHKVIIMTDADVDGSH
FT                   IRTLLLTFFFRYMREVIEKGYLYIAQPPLYKVTKHKKEFYIKNDDMLHDYIINNAVKDL
FT                   TLNAGESYSGNSLSKVLHQCMNISKITKSYDRVIPQHVLESLIIFFRKHNFDSAGAISD
FT                   HLNKVFCEYEWSVEIPKEDEISIFRLSHGLVDKYYINSAMMNSEDIKHVIAMCDGIEDI
FT                   FYNMPILSTKDNNIKISSPTSLVDNIIEFGKKDMTLQRFKGLGEMNADQLWDTTLNPET
FT                   RTLLKIKIADCEAADSIFSVLMGDFVEPRRDFINNNALNVQNIDA"
FT   gene            628887..629786
FT                   /gene="pyrB"
FT                   /locus_tag="ECH_0621"
FT   CDS_pept        628887..629786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="ECH_0621"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by similarity to SP:P56585; match to
FT                   protein family HMM PF00185; match to protein family HMM
FT                   PF02729; match to protein family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45390"
FT                   /db_xref="GOA:Q2GGK2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGK2"
FT                   /protein_id="ABD45390.1"
FT                   /translation="MKTLLEVSNLTSDDIESIFNLTIQYFNNTNLNHNILTGKVIVNLF
FT                   FESSTRTLSSFEIAEKSLGAHSITLNINTSSINKGESIIDTISNIDAMNPDLIIIRSQY
FT                   SQFIKKISEYLPSCSIINAGDGHHEHPTQALTDYCTIRYIKKDINNLNISICGDILHSR
FT                   VARSNIRLLSRYGANISLVAPPTLSCNLTGISHIYHNLIEGIRNADVIMLLRLQKERII
FT                   NCVIPSEQEYSHLYMLNHEKLLHAKKDVIVMHPGPTNKGIEISNNVAEKNSVILLQVKM
FT                   GVAARKAILHYLLYNKSI"
FT   gene            629795..630532
FT                   /gene="truA"
FT                   /locus_tag="ECH_0622"
FT   CDS_pept        629795..630532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="ECH_0622"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="identified by similarity to SP:P07649; match to
FT                   protein family HMM PF01416; match to protein family HMM
FT                   TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44963"
FT                   /db_xref="GOA:Q2GGK1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGK1"
FT                   /protein_id="ABD44963.1"
FT                   /translation="MRYKITIEYNGSNFIGWQKQKHSSNSIQEILENAILKFSQQHTTV
FT                   YVAGRTDAGVHALGQVAHFDLTTNLDTYVVRNAINYHLIPHAIAILSVEKTDDKFHARF
FT                   SAKKRHYLYKIINRYSPLTIDYNRAWLIHNPLNIENMIQAIEYIKGNHDFSSFRARHCQ
FT                   SKNPIKTIDDLKIIHNNQSINIHISAISFLHHQVRIIVGTLVECGKNNFSPEHIKNILK
FT                   AKNRSYAGMTAPPYGLYFVKVDY"
FT   gene            complement(630737..630985)
FT                   /locus_tag="ECH_0623"
FT   CDS_pept        complement(630737..630985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0623"
FT                   /product="holo-(acyl-carrier protein) synthase, truncation"
FT                   /note="identified by similarity to GB:AAS14501.1; match to
FT                   protein family HMM PF01648"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45464"
FT                   /db_xref="GOA:Q2GGK0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGK0"
FT                   /protein_id="ABD45464.1"
FT                   /translation="MILGIGADIVYVPRISNLWKKFGTKFLKRVFSEKEIEDSKKYTNF
FT                   DAQVRHFAKRFAAKEAYVKAVGTGFGKSIKMPDIYYC"
FT   gene            complement(630982..631107)
FT                   /locus_tag="ECH_0624"
FT   CDS_pept        complement(630982..631107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0624"
FT                   /product="prolyl-tRNA synthetase, truncation"
FT                   /note="identified by similarity to SP:P75000"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45393"
FT                   /db_xref="GOA:Q2GGJ9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ9"
FT                   /protein_id="ABD45393.1"
FT                   /translation="MPWQVIIGKSTVEQDLIEVRNRLTKDKVLISTEQFLNKLKK"
FT   gene            complement(631558..631959)
FT                   /locus_tag="ECH_0625"
FT   CDS_pept        complement(631558..631959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0625"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44902"
FT                   /db_xref="GOA:Q2GGJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ8"
FT                   /protein_id="ABD44902.1"
FT                   /translation="MLTRVIYIALFLLSSCHTISIHHGYPASEVNLWNNVKVGDLSSQV
FT                   IQLIGDPCIIEENVWYYVSYSIYKKRFFSTKEYESLVLKITFDSQANKVTDIQNIKVDR
FT                   KSLVKLLKKNTPVTGIHDSLLRQFSNKLQ"
FT   gene            complement(632092..633627)
FT                   /gene="lysS"
FT                   /locus_tag="ECH_0626"
FT   CDS_pept        complement(632092..633627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="ECH_0626"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by similarity to SP:O29052; match to
FT                   protein family HMM PF01921; match to protein family HMM
FT                   TIGR00467"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44651"
FT                   /db_xref="GOA:Q2GGJ7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ7"
FT                   /protein_id="ABD44651.1"
FT                   /translation="MVGQYKFWPFQEAEKILKRFGENTEIIFETGYGPSGLPHIGTFGE
FT                   VLRTTAIMNALRKICPNITTKVIVVSDDMDGLRKVPDNIPNKDMIADHLGKPLTMIPDP
FT                   FCACESYGHHMNMLLCRFLDLFNFEYEFKSATECYKNGLYDEKLLLLLKNYDKVMDVML
FT                   PTLGSERQKTYSPFLPICPRTSRVLQVPIVDIDIALGTISYQDENGEVIQVPVTGGKCK
FT                   LQWKPDWGMRWSALNVKYEAYGKDLQPSAELSSKICEILGSEPPVLFCYELFLDKEGRK
FT                   ISKSKGNGISIEDWLSYAPSESLALYILQNPKKAKKLYFDVIPRSMDDYLCLVDDYHKN
FT                   VSCDNPVWHIHNGNVPLINISGLSFSLLLNLASACNAETSEVLWGFIENYQDNDNLQDN
FT                   KILSQLVDFSVKYYHDFVKPYKVYKTPNHDERIILDELKNMLNDFSENITSEEIQSNIF
FT                   SLMKKYCFNDLRSCFQSFYEILLGQSHGPRLGSFVKLYGVNNTIDLINQALER"
FT   gene            complement(633946..634668)
FT                   /locus_tag="ECH_0627"
FT   CDS_pept        complement(633946..634668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS14400.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45286"
FT                   /db_xref="GOA:Q2GGJ6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ6"
FT                   /protein_id="ABD45286.1"
FT                   /translation="MREIFFNGAVGKIEGKYHHNKTLGAPLALIFHPHPQYGGNMDNKI
FT                   VYNLYNIFANNGFSVLRINFRGVGKSSGNFEKGIGELSDGAAAADWLQNNNMASSPFWV
FT                   AGFSFGAWVAMQLMMRRPEVEGFIAVSPPANKYDFSFLSPCPVPGLIIQGDQDSISDEA
FT                   AVSQLAARLSNSIKSEYMQYYVIEKADHFFRDHMDKFNEIVDNYIKFRLSESVDSRKKG
FT                   VMHKKIKQRRVVMHDDPV"
FT   gene            635089..636567
FT                   /locus_tag="ECH_0628"
FT   CDS_pept        635089..636567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0628"
FT                   /product="rrf2/aminotransferase, class V family protein"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM PF02082; match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45095"
FT                   /db_xref="GOA:Q2GGJ5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ5"
FT                   /protein_id="ABD45095.1"
FT                   /translation="MSHIANSQSLSEGYLEQIIVKLKKQGLINSTKGPGGGYSLNKSPN
FT                   SITLNLILESIGENIKITRCKNHLIGCLSNNARCITHNLWDNIGNHIKKYLNSISLEDI
FT                   LNNNFKSGTTVNNNANEYIYADYNSTSTILPTVKSQLDNLSSLNIYNPSSTHKLGQNTK
FT                   SIIEKTREIAINQLNAKNHDVIFTSSGTEANNLVINSTADYKYLISSIEHLSIMNCAIN
FT                   AELIPVDSNGTVCLDTLSDILYKCKDEKVLVSIMTANNETGVIQPIKEIVEISHKFGAI
FT                   VHTDAIQACGKIHVDIEDLGVDLLTISSHKLGSIAGTGILFFNSKKIKIKPMILGGHQE
FT                   KGLRAGTENVVSIYLLSISLSNLKDSIKKMSSVERLRDKLENQILNLVPEAQIFGKNTR
FT                   RLPNTTCISMPNVNSEIQTISFDIDNIAVGSGSACSSGALEHSHVLAAMGIDDNVAKNS
FT                   IRISLSPDVTDDQVNKIVNCWYKIYKNNQLLKLN"
FT   gene            636623..637855
FT                   /gene="iscS"
FT                   /locus_tag="ECH_0629"
FT   CDS_pept        636623..637855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="ECH_0629"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="identified by similarity to SP:P39171; match to
FT                   protein family HMM PF00266; match to protein family HMM
FT                   PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45029"
FT                   /db_xref="GOA:Q2GGJ4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGJ4"
FT                   /protein_id="ABD45029.1"
FT                   /translation="MEQEKRQINLPVFLDYQSTTKTDDRVLEAMMPYFKQFSNPHSRSH
FT                   SFGWKAESAVELARERVASLINAEAKEVIFTSGATESNNLAIKGVANFYKNKGNHIITV
FT                   RTEHKCVLDSCRYLETEGFHVTYLDVQKNGILDLELLKSSITDKTILVSVMMVNNEIGV
FT                   IQPIEKIGKICHEHGIFFHTDAAQAFGKISIDVKKMNIDLLSISGHKIYAPMGIGALYI
FT                   RKRQPRVRLTPMINGGGQERGMRSGTVPTPLAVGLGEAARIAQEVMEEENIRIRELRDI
FT                   LYNEIKKHLPYVVLNGDYEQRIAGNLNLSFPYVEGESIIMAINNLAVSSGSACTSASLE
FT                   PSYVLRALNIEKDLEHSSIRFGIGRFTTREEILYAAELIVSSIKKLREMSPLWEMVQEG
FT                   VDLNNIKWDAH"
FT   gene            637893..638306
FT                   /gene="iscU"
FT                   /locus_tag="ECH_0630"
FT   CDS_pept        637893..638306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="ECH_0630"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="identified by match to protein family HMM PF01592;
FT                   match to protein family HMM TIGR01999"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45405"
FT                   /db_xref="GOA:Q2GGJ3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ3"
FT                   /protein_id="ABD45405.1"
FT                   /translation="MSYSESLLEHYKNPKNVGTLPKEDYNVGTGLVGAPSCGDVMKLQI
FT                   KVDDNGKIIDAKFKTFGCGAAIAASSLATELIKGKTIDEAHQLKNTVLAKELSLPPVKI
FT                   HCSLLAEDAVKAAIKDYNMKQATKKDKLSSSNE"
FT   gene            638332..638775
FT                   /locus_tag="ECH_0631"
FT   CDS_pept        638332..638775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0631"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44770"
FT                   /db_xref="GOA:Q2GGJ2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ2"
FT                   /protein_id="ABD44770.1"
FT                   /translation="MMNSETPTFYNSEDSEDNSCSSQIKYHINSKITNKSPIIITESAI
FT                   KKIRELIKQKEGAVIGIRIMVKQKGCFGLKYNIEYAHDIKLLDVEIKVEYQNENFTILI
FT                   DPKAMMFINGTEMDHVENKISSGFTFNNPNEKGRCGCGESFYV"
FT   gene            638768..639211
FT                   /gene="hscB"
FT                   /locus_tag="ECH_0632"
FT   CDS_pept        638768..639211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="ECH_0632"
FT                   /product="co-chaperone Hsc20"
FT                   /note="identified by similarity to SP:P36540; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF07743"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45357"
FT                   /db_xref="GOA:Q2GGJ1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ1"
FT                   /protein_id="ABD45357.1"
FT                   /translation="MYKDYFSLFKLKPQFSINMQTLEQNYIALQSNYHPDLFSLKLEKK
FT                   LALDTITEINKAYQTLKSSIKRAEYLLEIKGITTNKNDINILEEIFNIQESNSIDLQNQ
FT                   ILLSTKAMENAFSVEDFNEAAKQVVRLKYLKKIQEDRSITSCN"
FT   gene            639202..641055
FT                   /gene="hscA"
FT                   /locus_tag="ECH_0633"
FT   CDS_pept        639202..641055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="ECH_0633"
FT                   /product="chaperone protein HscA"
FT                   /note="identified by similarity to SP:P36541; match to
FT                   protein family HMM PF00012"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45046"
FT                   /db_xref="GOA:Q2GGJ0"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGJ0"
FT                   /protein_id="ABD45046.1"
FT                   /translation="MQLVNITEPETSEKVLAFGIDLGTTNSLISMIDSEGKIIIFSDED
FT                   GKFLISSTVSYINNQIQVGKKYSNKAICSVKRLMGKSIKDIKKLSLDLPFHIIDKGDNN
FT                   IYIDKQDGTYVTPVEVSAEILKKLCKIVKDSTNLEVKKVVITVPAYFDETARKATKDAA
FT                   HLANLEVLRLLNEPTAAALAYGTEKPECENNIYMIYDLGGGTFDVSILKLHHGVFQVLA
FT                   TGGNTNLGGDDIDYLLAKLIYNKYQQTENVNDTPLNKELLNDLIADAKYAKEYLSEHYT
FT                   GSFTFKIHDKNFSCELSRDELESIISDLLNQTLSIVISTINSIELNFSNIEKVILVGGS
FT                   TKMPIIKKMLNNIFHNKVFCDVDPDKIVAVGAALQAHYLSNPQITNKNVLIDALPLSLG
FT                   IETIGGIVEKIIPRNTPIPASATQEFTTYVDGQNSIQIHVCQGEREMVEHNKSLAKFDL
FT                   KGIPPLPAGTAKIIVEFKVDMDGLLTVSAQEKSTGITQSISINHTCELDQKEIENNIID
FT                   SITNFEHDMHIRSIAEQKVEGQRIITLIKNALIEDKNLISELEFNTINNAIAEAEEILL
FT                   NGKTDRIKDVINNVETQAHNFIKKRMDFYLKKSIDNCNINN"
FT   gene            641072..641422
FT                   /locus_tag="ECH_0634"
FT   CDS_pept        641072..641422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0634"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45498"
FT                   /db_xref="GOA:Q2GGI9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="PDB:2MJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI9"
FT                   /protein_id="ABD45498.1"
FT                   /translation="MPLITFISPDGSRKTYEAYDGETLLSLAHRNNVDLEGACEGSLAC
FT                   STCHVIIDPSWYDIVEQHNEISDEENDMLDLAFGLTDTSRLGCQIILTKELDGLCVILP
FT                   TETRNISFVKNS"
FT   gene            641437..642510
FT                   /locus_tag="ECH_0635"
FT   CDS_pept        641437..642510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45299"
FT                   /db_xref="GOA:Q2GGI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI8"
FT                   /protein_id="ABD45299.1"
FT                   /translation="MKYFNKKLIVISSIVIASISSLYIGVWLVIATHVKATLSKSLAYI
FT                   HAEHSNDIQITNFPFIPKIKVLNLKINSSSLNISIPSLSLKYHLLSNTLEFIGLDNATL
FT                   TFENSMKITNNDQKNTSVCNLHDNFKLLIKPSKNLLLFLLDNKNDKKAYFTSMVYEDNG
FT                   ISCNNNHIINKSIFSVETDEHKSFDNLITVLQYKINASAASNTDTNINVKIKDAIVTLS
FT                   MSNTEFKEISAIIDNIALTSRNSLISIYGKLLLPLSLDTQINDEKLIIEISNYQDIIKQ
FT                   LVKILYPKSQHKDKIFSALQDYIYAISEKKDNGNIILSVSETVNPFNIFICKVPYEEFI
FT                   SKIKAITNTMDNHANKK"
FT   gene            642494..642898
FT                   /locus_tag="ECH_0636"
FT   CDS_pept        642494..642898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0636"
FT                   /product="cytochrome c biogenesis family protein"
FT                   /note="identified by match to protein family HMM PF03918"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44714"
FT                   /db_xref="GOA:Q2GGI7"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI7"
FT                   /protein_id="ABD44714.1"
FT                   /translation="MQIKSNSVFITILAFSFFSVFSAYSFSIDEKLVNNEMELRAIDLF
FT                   KIVRCLICSGESIYESQSQLAYDMRLMIRNKIKNGYNDNQIITELRNYYGNQITILPPY
FT                   NPYTYPLWILPILIFGIGIIIIIKFIYYKI"
FT   gene            complement(643013..643738)
FT                   /gene="ubiG"
FT                   /locus_tag="ECH_0637"
FT   CDS_pept        complement(643013..643738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="ECH_0637"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="identified by match to protein family HMM TIGR01983"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44883"
FT                   /db_xref="GOA:Q2GGI6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI6"
FT                   /protein_id="ABD44883.1"
FT                   /translation="MSQTVDQNELLKFSKIADKWWDEHGPLKALHDIHPLRMRYIVDYI
FT                   SKIIPKANFKSLSVLDLGCGGGLLSESMSRLGMKVFGIDASEESINIARVHASERGLCN
FT                   LKYSCMDIESLVNTEEKYDIITIMEIIEHVDNLPVFVNAVSNALSDNGIIFLSTLNRTK
FT                   KSFLYAIVCAEYILKLVPRKTHQWGRFVKPSEIVNLFSLNGICVKNIMGMNFNMIRRSW
FT                   VLSDDISVNYILAAQKVSS"
FT   gene            complement(643735..644181)
FT                   /gene="rpiB"
FT                   /locus_tag="ECH_0638"
FT   CDS_pept        complement(643735..644181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="ECH_0638"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689; match to protein
FT                   family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45398"
FT                   /db_xref="GOA:Q2GGI5"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI5"
FT                   /protein_id="ABD45398.1"
FT                   /translation="MLTMQKIFISSDHAGIELRLVIKLYLSNLGYVVEDYGCMESSIAV
FT                   DYPDYVQNVVDCVINTLGFGILICGTGIGMSIVANRHRKIRAALCYNVEVAKLAREHNN
FT                   ANVLCLGARYINHGEAQSIVYQFITTKFSEGRHVQRIAKIDNCL"
FT   gene            644330..644569
FT                   /locus_tag="ECH_0639"
FT   CDS_pept        644330..644569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45022"
FT                   /db_xref="GOA:Q2GGI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI4"
FT                   /protein_id="ABD45022.1"
FT                   /translation="MNNGKEESENIIKCTLSYLNNTKSYTHAFKKNIIEAFESGLITED
FT                   QFTHMIYHVTKFIKKIEVYENIFLGIYHDYITCG"
FT   gene            complement(644823..645710)
FT                   /locus_tag="ECH_0640"
FT   CDS_pept        complement(644823..645710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0640"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45504"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI3"
FT                   /protein_id="ABD45504.1"
FT                   /translation="MMPLLHTVREKEGSQQIVKLYRKNSLIFLRKVVMGIRKIATKSWY
FT                   NIPKEQQVSMDIFRKPILSMTATGVMQYSQGYDIVYKEISFKNKLNVEVFYRNCLLDIK
FT                   WFSLAERRYHTRFIREKNRPVLCSYDGQIYSTNSKVAYVITLEGNLITHDHIVCDRTQG
FT                   QTYFHSTLAAGMPVICAGLLSVSNGIIHYISNESGHYKPGIGNLYNAVKLLDKVISLDC
FT                   IICVIGFAVNEETKKLRTVYQARVKGSFLVDMESVGKDGLTIPERYFSIIRKDNDNYKK
FT                   RLIQAANSHNVQAR"
FT   gene            complement(645953..646894)
FT                   /gene="mdh"
FT                   /locus_tag="ECH_0641"
FT   CDS_pept        complement(645953..646894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="ECH_0641"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by similarity to SP:Q59202; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01763"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44535"
FT                   /db_xref="GOA:Q2GGI2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGI2"
FT                   /protein_id="ABD44535.1"
FT                   /translation="MIKRKKIALIGAGSIGGMIAYLVRSRNLGDVVLLDVNGGIAKGKA
FT                   LDIAESSPVAKHNGEILGTNNYADIEGADAIIVTAGISRKPGMSRDDLINTNVHVIKEV
FT                   AENIAKYAPNAFVVVVTNPLDIMVLAMHKYSHLPSNMVVGMAGVLDAARFSYFIAKELN
FT                   VSVDSVSSIVLGGHGDFMLPLVKYSSVGGISIADLVKMNLITQDRVNEIIEKTRKGGEE
FT                   IVNLLKVGSAYYAPAESALLMVDSYLNDRRLMLSCSVYLKGEYGVHDLFVGVPVIIGKN
FT                   GVEKVIELQLTEEEKNVFNDSVMSIRKLVSNI"
FT   gene            complement(646972..647322)
FT                   /gene="folB"
FT                   /locus_tag="ECH_0642"
FT   CDS_pept        complement(646972..647322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="ECH_0642"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44765"
FT                   /db_xref="GOA:Q2GGI1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI1"
FT                   /protein_id="ABD44765.1"
FT                   /translation="MKIQIHGFTVYSYIGVRCWEKVIKQKIIIDCDLTLCCNDLIYDID
FT                   ETVDYSIFTDNLINFVNSRRFLLLETMASDLLAYIMTNEKIYHCYLKLYKPLTCGTNGN
FT                   ISVVLETTKSNS"
FT   gene            647514..648101
FT                   /locus_tag="ECH_0643"
FT   CDS_pept        647514..648101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0643"
FT                   /product="RDD family protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45129"
FT                   /db_xref="GOA:Q2GGI0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGI0"
FT                   /protein_id="ABD45129.1"
FT                   /translation="MFLYNYLPFFKKKKQDQDTNKICYSGGIRRFSSILIDLTILIFIL
FT                   QIIHNVYSYFFMHETDNTVIKIIEKYKMSVPLTAQEEQIKNKHVFKAICGQIIQMIALY
FT                   IYAAYSWTKFSATLGKFLTGLRVVDATTFQKITLSQSTKRIFGSILSSIPLCLGIVWCN
FT                   FNKRKQTWHDKIANTVVVTNKSLKNYHNNHNL"
FT   gene            complement(648209..649258)
FT                   /locus_tag="ECH_0644"
FT   CDS_pept        complement(648209..649258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0644"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44618"
FT                   /db_xref="GOA:Q2GGH9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGH9"
FT                   /protein_id="ABD44618.1"
FT                   /translation="MDKLKIVLGIETSCDETAVAIVNSNKEVLSHKILSQQEHAAYGGV
FT                   VPEIASRAHINYLYELVGSCIEESQLCFNDIDAIAVTAGPGLIGGLIVGIMMAKAISSV
FT                   TGKPIIEINHLEAHALIIRMFYEIDFPFLLLIMSGGHCQFLVAYDVRCYYKLGSSLDDS
FT                   LGEVFDKVARMLNLGYPGGPIIEEKSLLGDSGSFTLPRALTNRPGCDFSFSGLKTAVRN
FT                   IIAGQKCINHELVCNISASFQDCVGDILVNRINNAIVMSKDIDHRINKLVVTGGVAANK
FT                   LLRNRMSVCANDNGFEILYPPSKLCTDNGVMIGWAGIENLAKGYVSNLNFFPRARWPLE
FT                   NLRFDILRK"
FT   gene            complement(649265..650242)
FT                   /locus_tag="ECH_0645"
FT   CDS_pept        complement(649265..650242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0645"
FT                   /product="immunogenic protein"
FT                   /note="identified by similarity to SP:P12920; match to
FT                   protein family HMM TIGR02122"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44977"
FT                   /db_xref="GOA:Q2GGH8"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="PDB:4DDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGH8"
FT                   /protein_id="ABD44977.1"
FT                   /translation="MKKVLIVYVFIISVLFNNAIASSDDSLNREYILIGTGSMTGVYYP
FT                   IGGSICRFIASDYGKDNKIICSISSTTGSVYNLNSIRYSNMDISIVQSDLEYYAYNGLG
FT                   FYEKMLPMDNLRMLASLHKEYLTIVVKKSSNISVIDDIKGKRVNIGSPGTGVRVAMLKL
FT                   LGEKGWTKKDFSVMAELKSSEQAQALCDNKIDVMVDVIGHPNASIQEASATCDIKFIPL
FT                   DDRLIDDLHAKYPYYQKDIISGGLYNDSPDIQTVSVKASLVTTTELSNDLAYKIVKSIA
FT                   THLRELRSITGALKTLTVQDMAKSSITPMHDGAERYYKEIGAIK"
FT   gene            complement(650242..650964)
FT                   /gene="tpiA"
FT                   /locus_tag="ECH_0646"
FT   CDS_pept        complement(650242..650964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="ECH_0646"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by similarity to SP:P27876; match to
FT                   protein family HMM PF00121; match to protein family HMM
FT                   TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45340"
FT                   /db_xref="GOA:Q2GGH7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGH7"
FT                   /protein_id="ABD45340.1"
FT                   /translation="MSLLIVANWKMYGDFLTFSSFTKELSANLVNVKADVEVVLCPPFI
FT                   ACSKIVDCAPNIKLGAQNCFYESEGKYTGEVSAKMLYSCGCSYVIVGHYERRSIFYESD
FT                   YCVQLKAKSAIDAGLIPIICIGETLLDRENGMLKNALLDQCYNSFPKHGEFVIAYEPVW
FT                   AIGSNTIPSIDMITESLDIIRSYDSKSNIIYGGAVNQSNIKDVIAINQLSGVLVGSASL
FT                   KVSSFCDIIYGAVNVRQN"
FT   gene            complement(650986..651058)
FT                   /locus_tag="ECH_0647"
FT   tRNA            complement(650986..651058)
FT                   /locus_tag="ECH_0647"
FT                   /product="tRNA-Thr"
FT   gene            651140..651973
FT                   /gene="ksgA"
FT                   /locus_tag="ECH_0648"
FT   CDS_pept        651140..651973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ECH_0648"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45262"
FT                   /db_xref="GOA:Q2GGH6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGH6"
FT                   /protein_id="ABD45262.1"
FT                   /translation="MYNKHKLPSYILIIMNHISKINPKKELSQCFISSTHITDQIVNYA
FT                   GNISDYSIIEIGPGLGTMTYSILNKNPKKLISIEKDRRLSTIHEKIVEEFQGKYEFILS
FT                   DALNIDLRDIIEPPVKVIANLPYHIATTLLIKWMDYINFFTSFTLMFQKEVADRIVAQP
FT                   NNKNYGTLSILIQLLSNVYKMEDFGPEIFSPQPKVMSSVINIIALPEPRFHVNYRKLSQ
FT                   VLKTTFSERRKMIRSTLKKLTNNADEMLESLNIDNNLRPENLSIEQFCQITNCIN"
FT   gene            complement(652059..653075)
FT                   /locus_tag="ECH_0649"
FT   CDS_pept        complement(652059..653075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0649"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44655"
FT                   /db_xref="GOA:Q2GGH5"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGH5"
FT                   /protein_id="ABD44655.1"
FT                   /translation="MTDYVTDIAVIGAGPVGIFTVFQAGMLKMRCCVIDALSEIGGQCL
FT                   ALYPEKPIYDIPGYPVINGKELIDSLKKQSEPFNPQYLLGQVAEKIEDYSDYFLIRTTT
FT                   GIVVQSKVIIIAAGAGAFGPNRLPIDNILDYENKSVFYQVRKVSDFCDKNIMIAGGGDS
FT                   AADWAVELSKVAKQLYVVHRRKNFRCAPNTALQMDNLSQSGKIKIIVPYQVKKLCGENG
FT                   KLHSVIVKNITNHEEMALQVDYLFPFFGTSANLGPILNWGMEVKNYQILVNAETCLTNR
FT                   NRIYAVGDIATYPGKLKLILTGFSEAAMACHHIYHVIYPNSPLNFQYSTSKGIPENC"
FT   gene            complement(653516..654862)
FT                   /gene="pmbA"
FT                   /locus_tag="ECH_0650"
FT   CDS_pept        complement(653516..654862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="ECH_0650"
FT                   /product="pmbA protein"
FT                   /note="identified by similarity to SP:P24231; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44573"
FT                   /db_xref="GOA:Q2GGH4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGH4"
FT                   /protein_id="ABD44573.1"
FT                   /translation="MEDKLEILNVAEDAVKKIKSMGYIGDVVIYQNNRLSLSQRLHKID
FT                   EVIQSKNCKMGIRVIVNNNQFACVSSNELSNVSESIDQAVAMAKLSTGDPYISLYNDFI
FT                   NKEHLLTSNDLMILDKTNITVDQCKKIVEDMENAALSYDNQVVNSEGSSFSHGITDVVL
FT                   ATTNGFIGSYSKSNFVSSISVIAGTDDKMEVGYDFSSVCNLSRMKDPVKIGKEAALRAV
FT                   KRLNPGKLQTCKVPIVIENRVAGTLLKNFASAIRGDNIANEASFLNNYINKKIFSDDIF
FT                   IVDDPLMLSGLSSRPFDGEGVVGNKKLVVENGILKSWILDIRSANKLKLKTTGNAVRHS
FT                   NASVSPGVSNFYIQNGILSVQELISDIKSGLYITDLFGFGVNLITGDYSQGASGFFIEN
FT                   GKISYPVNEITIASKLQYMFSEMSIANDLVFFSSVNSPTIRIDGITIAG"
FT   gene            complement(654862..655434)
FT                   /gene="folE"
FT                   /locus_tag="ECH_0651"
FT   CDS_pept        complement(654862..655434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="ECH_0651"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by similarity to SP:Q54769; match to
FT                   protein family HMM PF01227"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45285"
FT                   /db_xref="GOA:Q2GGH3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGH3"
FT                   /protein_id="ABD45285.1"
FT                   /translation="MRNGKPSDSEAEEAVNLLIRWIGDDPNREGLVNTAKRVLDVYKRF
FT                   FSGYQVDIYSMQDLVLLNENYNDMVIFKNTEFTSYCEHHIVPMRGKISIGYVPDKLVFG
FT                   VGKIVKLINCFTKRLQLQEKLTVEIANALDHCLAPKGIIVAVEAVHDCIVCCEEEDKHN
FT                   LELQTTCAIGVFQDNMELRREFFSSIG"
FT   gene            complement(655448..656293)
FT                   /gene="atpG"
FT                   /locus_tag="ECH_0652"
FT   CDS_pept        complement(655448..656293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="ECH_0652"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P36542; match to
FT                   protein family HMM PF00231; match to protein family HMM
FT                   TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45589"
FT                   /db_xref="GOA:Q2GGH2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGH2"
FT                   /protein_id="ABD45589.1"
FT                   /translation="MANLKALLLRIKSVKSIQKTTKVMQMISAAKLHRVQQKLENAKKH
FT                   LLELSSIVDYVPSDGVHNCASIAKKERVLLVVMSSDRGLCGNFNNLIVKFTKSYVEKLE
FT                   SSNKEVKLIFFGKKAYDMMYSQYSDKILNVFSNTKSITDFLYFKLFVYNSGIDFDQFDN
FT                   VMILFNKFYTTILQKPDAQQLIPCNLGIPMLLKEVYQYEPTYVDVLSTISLGYVLNLMY
FT                   IAFLENSASEHCSRMVAMESANRNTKDMLNRLALEYNRSRQASITTDLIEIISGFESLN
FT                   "
FT   gene            complement(656379..669320)
FT                   /locus_tag="ECH_0653"
FT   CDS_pept        complement(656379..669320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0653"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45111"
FT                   /db_xref="GOA:Q2GGH1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGH1"
FT                   /protein_id="ABD45111.1"
FT                   /translation="MGKQDLYDAIKSGDIVRVKNFFESSSKEEISSAIFCNIEGSGILQ
FT                   YILKLHEGEKRPVNPEIFREVLKYCISDSINSQDGNGEFPLLMAAKAGEQFLSAFKDVN
FT                   VTRHTKISQRVNWKVTDGQGRGVLHYAISSNDSECCKLVLGLQDALYHARSKESNGDNI
FT                   LHCLFKNYTAEPGQKEVFTVVLDRLKVLYASIQDPDSGTPLGLRHVLSEENKLGETPVH
FT                   LLVASRFLSDLKGDIDLEEIFENCDLLARTKNGDTIINVAARCGNNEILNHVLTRFAGI
FT                   FPTSPDVRALIKRQDIAQSKRQVEGLIEQQKKLQSLEGREETVRDQLYGELRAACLKES
FT                   ELLSYLKLKVDNMQELRSQIEREEDGEKQRQLQQELRILEQEFLSDDVAAENRKLLDIE
FT                   RIKKLIEDLMEMTSYIKSLREECNLVVNEVRSSSSLETGVFMINNLSEELERLETQRAR
FT                   SQSALLDYARSYKFVDNLLQSQLAKEVEVAQKNLKKGQEEYNSYIERTLKALREVPQRQ
FT                   VPVDKLRNTLTLQKQLAEQEISLKQCRNGLDVESALRNQLSLRKDVLEKIEKLHNQEHT
FT                   SQERELLEKQKECIAALIRVTRSVLFLSERLIRVEQAQARLNNIEEQKLLSGSKRNLSG
FT                   KELRFLIVHQKALLHMKMCLEDAIRGEIQVGQELVNENSKRGVLQGILKELPVSGMLCQ
FT                   ELQLEEQIRNIILQSLDLRSSSLTMLDGALSDELVGQVKRLSEELVIQQEELCKLMSQK
FT                   LALQNEMDKIMESGEQAASSPAVGEFQKRQQGIEREYFKKEKIVKALQAEIENNISRGE
FT                   LRELKYALLENLNDNNFAMLNNYREEFCGYSINDPELVSRVSKAYKRFSSLEECDAYYV
FT                   KLRELGINIGIEKHAIESRNIELLKRILPLSTNKDVFAKEIAKVRDCDFLHRVVDALGV
FT                   SSIVSMLRHSAESVGLSDISPEICNEILQSEIDGRDLMRFAHLLSVNSRVFDNVLKESL
FT                   PEQLQTLFNMVSRARTFVKGNYSAYNSSVDTLNNKLVNFVFDLVNNNELNKLKSLLKYC
FT                   PSIIYYSKDGKSLLEAASDLNKVPLVKHIISVHKELIKSNAKLDHDPLGCIADLMVLFS
FT                   DIAKINHEDVIDILESNQEIIQELDSQYGISKLILENARNYNNLVVMQYYARINPELVS
FT                   TMCCDDLTHIYGASAAVDTTSESRSGEGEGSRDAVSSLAEGNIGQFGALSRYIPTVVSH
FT                   DAEKFKKEIVELFSEDVKRYAERSHDKTGHSIFTLVAALGNVEQWIQLEKGYKAINQDR
FT                   KIKSLFADVKNPLNGNRLSTLFSPFQAAVIKRNVSMIKHFIKEIDAKELMAAYGDDKNN
FT                   IFHTMISEDQYALAEVIINDERFSQDVLMKAFLQPNKKGITPFGMAAQRGYKKLCVSFI
FT                   HEIECNEKSSRDLMINEVFIKDVIDSQDVDLIKELFNIRYYTGKSLSKQQVNLIKHKIA
FT                   GHSLLAYACKVGNKECVTELLRYYTEQDLLGLLREIIDPKLNLDRDMIYLFLSDLGFKS
FT                   TDPKMSDKILPYVVRNANALSAFNLLKSVPGISYNQKFSVRDVIVQNNPQALQYLIREE
FT                   KRDFDSSCDGGVSDLGLALCSPNLLETCCNYLKSNPAFALDDSVLPHSAVLSNRLDLLK
FT                   ELIKRDPSLLIKQYDTKLPLYKVLARYLSNNYKCTFKSFETLYDFAQREDVNPRIRSYL
FT                   KEALLEYYNDIVCKSSNPVVSQNLLRVIVAHAKDVLDKYPALYDYVVNQFNVEDIIRSS
FT                   SSKKNNIFHSVNEENLEFLCALAKRAYKHAIDTKNKSLKNMITDMVNQVRSSDGLSFFQ
FT                   YIAFTGNYEMYELIKLLCGDVNSKTSQGTNLAHICAYSAMKDTSGNFEFENLIKCNKKL
FT                   AAASDKAGQGLLEYAANGRIQSLDVREQAFNIILSQRLDKTLEKLSQKKYDKRVLNAAF
FT                   LSGSKRLSSIFLKRIGGSKRSDIIAQQKSLLRVVEGVSDPEEKARLLSHEFEVASNQEM
FT                   LRDDRGDALGTSTLSTAELQVSGSGATQSQAAGGAGASRSSSSAAPDQVAVASTSSRSG
FT                   TTQSRAAGGAGASRSSSTAPDQAAVASTSSSSGATQSQAAGGAGASRSSSSAAPDQAAV
FT                   ASTSSRSGTTQSRAAGGVGTSRSSSSTAPDQAAVASTSSSSGATQSQAAGGVGTSRSSS
FT                   SAALSTLSIKLPFSGTAEYVAATSSLPGQPSVVVSSDDDIAPSSLSRASSGQDLLGLDD
FT                   EGGYIDSSNERFIPSLGISQSPAEDTSTIHRSMLSNQELLDDHLFPENEIIVSRSKKEI
FT                   LDNQEKIESLIQQKANLSEYIDIISRSRSSSVLQLRTLSNEKSIIERAVSSGNFDLIEA
FT                   VVTSNSMLNPNIVDNRGNTLLHKFAEFFAENTEALSESRIRYYFCELIRNDSFSVNHRN
FT                   RDGETALDLLKRLQERLIFPYSDQENNLGTFIELLTKQSEISEKAAQRFSKAQGTFLEC
FT                   DSIDDVHNLLQQNFCLRYRFSELFDNVCNDILSDNGDKHQGVIDLSYRRLRKILNDGIV
FT                   RNTLANTDGDGNNALQKLCQDIASGKIGDDHTRVLELFDTVISTLKETDPKLLQELLFD
FT                   NRNLRFENCVETVARIPGAYPIFKKLEDLLGKNKIADSCDFNAMLINCAEASNVDLHKY
FT                   LRTKYAAIGISNINMDGDTSLHKAVITGSKDMVAEVLSTGTNINKRDKDGNTPLHKLLI
FT                   FMRFSPNMVTANHIELVKFLVSRNASLSVKNRLGLSPSDLANNITTSQVLNEVLPDQKV
FT                   DILQSLIDGRNEYYDIKSRCISDFKRYVVLKAGMNYDDVGFDIAGGVLFANMGRAKLKI
FT                   TDIFSSSLCKSCGLTMVPFNFANKDKGYVHSVGKKRNYVVTEGFVKLKLSWTPNIPAGA
FT                   PKQEVSVVVNSDGSISLSAKDAQKYGMHGEKINFDACYVYVGGLELAAALKNGRWKDKE
FT                   SRAQDTKTVASLDRDRDHDRDHDRDHDHGGDISRRRSAASLDQGQDTIKPTSQVQQSTT
FT                   PKSSVTPGSGTRSHVSASSLVDVHLGNEQVDVISPMPPQSRVGMDDQMFAHGDVKGSKL
FT                   PSASQSQKLHLPIQQPAVEGLSSPQSRVGMDDQMFAHGDVKGSKLPSASQSQKLHLPIQ
FT                   QPAVEGLSSPQSRVGMDDQMFAHGDVKSSKLPSASQSQKLHLPIQQPAVEGLSSPQSRV
FT                   GMDDQMFAHGDVKGSKLLSKGKQKETFPVRGRAKSQLYTIPEDIISEDIISEDMTPDYE
FT                   RRVELFIPNVSEDIANFELFVLTLPQNIIPEDRKVKLLDDRHNLYQIRQSMGVYLFPED
FT                   KTLNEYNIKKLCSTYSTLFQSYRAILNGLAAEETLAPELVHDLYREILDKYNKDLDSMV
FT                   EDVQSFMLVDVSKQAEMLITNVSRDELSKYHKIREKLSSAGLNLTQLASQTEGSKPYSI
FT                   PGASAVSEQQVTSEQTTSGDLSSTLASQTEGSKPYPIPGASAVSEQQVTSEQTTSGDLS
FT                   STLASQTEGSKPYPIPGASAVSEQQVTSEQTTSEDLLSTFQGILHDVKKLCDGSKGLDV
FT                   KQLLINVKALCDQYNQLSKRNKERFDILNNREGITLPSTELIKNIFDIVKECHANLTNV
FT                   FEVGEILESKKESLSDKSQDLAVLKNCIKLLHDVANQQLTQENILCASIRETSEKLLVS
FT                   FASLDNPWNVDGKPTQPGGEVVPESTVFEYTCNKTQQDVKALVGQLICLDDGDSIGLSR
FT                   LQQSLNNQVISLGGLSNIVFGKYDELIKRASDCSDTGLTREICVSILQECKSLKNCMLS
FT                   IFCSVGLSSLSVTEKPNVVKVLESVQEVLLDFGLKEEEEYERFCNENRTLLGSEISLPD
FT                   QDTVDSSLMVQERGGDIVSQGQHDQGVKSDADKKLVSGVEEDRSTSRVLPSGLSNQQQH
FT                   KVVGASSASSPGTSDQAMTVDQSVVSGADEKLVAGSEEDRSTSRVLPSGLSNQQQHKVV
FT                   GASSASSPGTSDQAMTVDQSVVSGADEKLVAGSEQGKSTSKIPRGSAAFQLSSDLRGGV
FT                   ESKKGSGKGGKASPTLLPEEVHVTEDILKQALQGLRNIGLQLRIENDSKIYKDVKPSVK
FT                   GEILMPGLIPRVIKHSKSEGDLPTAGGDEISKKSLSADDVSSTGQFRGDSLYKLSRTGW
FT                   DISQCDDDTLEDLSLDDGVVCNTEGGVAASSEQACQKTGDITSSSYALKSTKLVLKAFG
FT                   FSKTSEDTSQESEEGLKDLSFDSIREEGSSGVTEADDALDPIIVKRAGERYKRNFSEKL
FT                   RFFEGLVSQEKGSEASDKQSSSRRKRKGSGDVLMDTSVTEIASGLQGVINSSSDSSLDD
FT                   VAPLPSPKSGDVRKKHGRFM"
FT   gene            complement(669521..670114)
FT                   /locus_tag="ECH_0654"
FT   CDS_pept        complement(669521..670114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0654"
FT                   /product="putative ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45273"
FT                   /db_xref="GOA:Q2GGH0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGH0"
FT                   /protein_id="ABD45273.1"
FT                   /translation="MNILITARGFDITDNIKDYIEEAIKKHTTKFFIDDSTVNIKMILS
FT                   KDGNLFNSTIGISDVKSEFIRISKTSDTAYNAIDDAVSHLCGKLQKHKGERINKYRHNK
FT                   NSVKAQMRCFGYVLDSNEIEKYDVNNISDSGLIIEEDVFVKTMTIGDAIMEMELLSLPA
FT                   FLFINAKSNRINMIYAKSDGNIMWVDPLNISPIK"
FT   gene            670231..671124
FT                   /gene="rpoH"
FT                   /locus_tag="ECH_0655"
FT   CDS_pept        670231..671124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="ECH_0655"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P48194; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45444"
FT                   /db_xref="GOA:Q2GGG9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG9"
FT                   /protein_id="ABD45444.1"
FT                   /translation="MLTNSIFSLTQDNLMSYINEVHAFPILSPEEEDRLARNWYENGIV
FT                   ADAHRLVTSHLRLVVKVALSFKNYELPLIELIMEGNIGLMQAVKKFNPTLGFRLSTYAI
FT                   WWIKAFIKDYILKSWSCIKIGTTQAQRKLFFSLRKIKKKLFKYNHNITKEDIKLIANKC
FT                   STSEQEVEQMNRYFLYRDRSLNELVFSNDNQNGVELQEIIKCDTPNQEDTYLLNEELNI
FT                   KKALISQALSTLNERYRDIFIRRRLIEEPDTLDKLSQEYNISKERVRQIEMHAFTKVKN
FT                   FIISEREKLGHCNINS"
FT   gene            complement(671442..671570)
FT                   /gene="rpmJ"
FT                   /locus_tag="ECH_0656"
FT   CDS_pept        complement(671442..671570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ECH_0656"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44822"
FT                   /db_xref="GOA:Q2GGG8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GGG8"
FT                   /protein_id="ABD44822.1"
FT                   /translation="MKVIGSLKSAKVRDKDCRVVRRKGRIYVINKKNPRFKARQGY"
FT   gene            complement(671609..671701)
FT                   /locus_tag="ECH_0657"
FT   tRNA            complement(671609..671701)
FT                   /locus_tag="ECH_0657"
FT                   /product="tRNA-Ser"
FT   gene            complement(671848..671994)
FT                   /locus_tag="ECH_0658"
FT   CDS_pept        complement(671848..671994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44976"
FT                   /db_xref="GOA:Q2GGG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG7"
FT                   /protein_id="ABD44976.1"
FT                   /translation="MLHKSLFAVVRSFCHSNINIVFDVLYIPDLVLRKQFIYVFIGRFC
FT                   ITI"
FT   gene            671986..672300
FT                   /locus_tag="ECH_0659"
FT   CDS_pept        671986..672300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13835.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45403"
FT                   /db_xref="GOA:Q2GGG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG6"
FT                   /protein_id="ABD45403.1"
FT                   /translation="MQQKKLDEFDYTIDDIITKYQIKFENKMEDITSNFLTHFQHSLEE
FT                   ELISLIKKIYSHNFQELNKYLVEQLLNSNSLQSLNKYEKDIITKIFNKISFSVLENLVF
FT                   "
FT   gene            672348..672902
FT                   /locus_tag="ECH_0660"
FT   CDS_pept        672348..672902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0660"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13837.1; match to
FT                   protein family HMM TIGR02215"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45123"
FT                   /db_xref="GOA:Q2GGG5"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG5"
FT                   /protein_id="ABD45123.1"
FT                   /translation="MLESSMLCITRKIVPVSSPITLSEVKSFLRINNNQDDTLINNLIT
FT                   MASEYAQWYIEKSLMKQTWEISCSRYIPGKIQLLFNPIIKVNHVKIIHTNGSEELIDQK
FT                   YYHVNTVLSYISFNKHIHGDRIEILYEAGYTDNALIPAQIRYGILHHVAISYKNRESEN
FT                   INNLTFIKNIYSPFRELKLVL"
FT   gene            672899..673309
FT                   /locus_tag="ECH_0661"
FT   CDS_pept        672899..673309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13838.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45425"
FT                   /db_xref="GOA:Q2GGG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG4"
FT                   /protein_id="ABD45425.1"
FT                   /translation="MTDITKEIFNSVIKLLQSNNNLTNTVTDIYDIIPNKVSLPYIYVY
FT                   ISNLKTLNTFNSNMLKIQLSCKIYCYQPNTLYEILNLITNSLVNHKSNVSYFEYEVTPE
FT                   YSYSTNQHNEIAYALLNFTILAKKIYVNRITD"
FT   gene            673287..673676
FT                   /locus_tag="ECH_0662"
FT   CDS_pept        673287..673676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13839.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44788"
FT                   /db_xref="GOA:Q2GGG3"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG3"
FT                   /protein_id="ABD44788.1"
FT                   /translation="MSIELQIKDSNNSFSSLNNIKSLRISLHNKNEYIKNISLSGWKTA
FT                   LENSGNRYVIFKVQGIIDYSSANQLLQQYSFNNDIIDLKIIINKKEVISAKCIIELYER
FT                   YYESSNFDNFNMVLISYKKVIFNNY"
FT   gene            673726..674334
FT                   /locus_tag="ECH_0663"
FT   CDS_pept        673726..674334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS13840.1"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44681"
FT                   /db_xref="GOA:Q2GGG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG2"
FT                   /protein_id="ABD44681.1"
FT                   /translation="MLQQQKLIYKIIDRCNNYQKLCRIEKEISALLKITQDKSLLNSFS
FT                   TIKQVSSKEYLKKEGKQEEIQEENAELENNISYRINISDNNENNEEIENIKNLIKLKLN
FT                   ILMSVIAHEMDPVRRAGETAASNRKDAKKFGRSTKDSSSLAIVLLKMILNQVKLILEVA
FT                   TTNSKDENQKIENQKDMDTEQKLHLPNLIQKENQQGRNR"
FT   gene            674476..675072
FT                   /locus_tag="ECH_0664"
FT   CDS_pept        674476..675072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0664"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45473"
FT                   /db_xref="GOA:Q2GGG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG1"
FT                   /protein_id="ABD45473.1"
FT                   /translation="MLFPHKLKIKAIYHHIDISDNINELLYAHKKLIKIKKYLNKTKKI
FT                   SQNINVFNIKKNLYQESKKNNSVICIKKEIKKEIKTLLMSTIAHEMDPTQRAGQTITSN
FT                   IRGAKKFGRDNKARKKTSHTHKSKSMFLKLLNFLFHLIVPMPSCILNANLVIQNSITNS
FT                   SQYITHNNNYKKFKTAYKIQKHTEQCVTNKLQLQL"
FT   gene            675185..676594
FT                   /locus_tag="ECH_0665"
FT   CDS_pept        675185..676594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH_0665"
FT                   /product="phage uncharacterized protein"
FT                   /note="identified by match to protein family HMM TIGR01630"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45063"
FT                   /db_xref="GOA:Q2GGG0"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGG0"
FT                   /protein_id="ABD45063.1"
FT                   /translation="MSYNFLDFLKLCFKTVSPNNQIINNWHLKIITDRLEATLNGKINR
FT                   LIINMPPRFIKSICVSIAWPSWVLGLKPQTRIIVASYSQILSEKLSLDNRYILQSEWYQ
FT                   KLFPHVILSKDQNTKQKFQTIQRGYRFATSIGGSITGEGGDILIIDDPMNPMQALSKTY
FT                   RQRVCHWFEQSFMTRLNDRKNSSVIIVMHRLHTDDLTGYLLSKKTHNKWHILSLPMVAE
FT                   KNNIFYSVTSPWKFKYGKKTRNILHIRKEGDPLYKKYGRKYIEELKSELGSYTFAAQYQ
FT                   QNPILLSSGIIKYKWIQRYTSYDNEDSNITQSWDTASSSNNKSDYSVCTTWSYTNNCFF
FT                   LLEIYKAKLEYQSLKQEIINLANHWKPNAILIEKKASGLQIIQELSNISTIPIIGIIPT
FT                   TNKTTRFYKIIPIFESRKIFLPYDSPWLSDFEQELLSFPNTQNDDQIDSMTQYLHWINN
FT                   NITNNVIIREI"
FT   gene            complement(676774..678054)
FT                   /gene="bioA"
FT                   /locus_tag="ECH_0666"
FT   CDS_pept        complement(676774..678054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="ECH_0666"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by similarity to SP:P12995; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABD45235"
FT                   /db_xref="GOA:Q2GGF9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGF9"
FT                   /protein_id="ABD45235.1"
FT                   /translation="MYADFCTWFDEGYQNIWMPYAQMKNSPLPLRVKSASGCYITLEDN
FT                   TKLLDGISSWWSVCHGYSHPHIVQKVQNQVAKLSHVMFSGLAHEQSYVLASRLVKISPK
FT                   QKMSRVFFSDSGSTAVEVAMKMAVQYYQNLGDTNKCSFISFVNGYHGDTMGCMSISDPE
FT                   KIHGTKFKKYHPLQFILRLPQTEEEFKDFTDIVYSIKDRVAAIILEPILQAAGGMLIHS
FT                   ASTVKKICEIARDNNMLFIADEVATGFGRLGTMFGCNQADIVPDIMVIGKALTGGFCTL
FT                   AATLTTEEVYNAFLSDNIDDAFMHGPTFMANALACAAANASLDLFENQDLIQNVSLIEN
FT                   QLISELEIFRQLSYVTDIRVKGATGIIELESGLINKNDIISKGVELNIWIRPINNVIYI
FT                   MPPFVINRNELTKLITSIYIILKNNYS"
FT   gene            complement(678638..681772)
FT                   /gene="putA"
FT                   /locus_tag="ECH_0667"
FT   CDS_pept        complement(678638..681772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="ECH_0667"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /note="identified by similarity to SP:P09546; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   PF01619; match to protein family HMM TIGR01238"
FT                   /db_xref="EnsemblGenomes-Gn:ECH_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABD44729"
FT                   /db_xref="GOA:Q2GGF8"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GGF8"
FT                   /protein_id="ABD44729.1"
FT                   /translation="MISALQTPNEIRRRMQMLYRIEENSCTRYLTEKTEISQDSKIRIY
FT                   SVAKQIIERIRVDRNLGIIDAFMQEYGLSNEEGIALMCLAESLLRIPDDCTINDLIKDK
FT                   IGNSMWSNHIGSSSSMFVNAATWGLFIGGKVLKDSNDSTRWFGTINNLLKTMGEPIIRK
FT                   AVQQAMCILGKHFIKGRDITEALNNRREGELYSFDILGEAAKTRKDAERYFTEYMAAVD
FT                   SIGKSKVNNEIGNLIDYDEISVKISALHSRYEFSQIDKVLDEIVDKLLQICKLAKEHNI
FT                   RVCVDAEEASRLEISLMILEKLRFDSSLNGWEGLGLAVQAYQKRAFSVLDFVEDISVRS
FT                   HHKMMVRLVKGAYWDYEIKNAQELGLSSYPVFTRKVYTDVSYLACANKILSKPNTFSPC
FT                   FATHNAYTLAAILEMANKDHPGFEFQRLHGMGANLYEYVTQELAANVKCRVYAPVGSYQ
FT                   DLLPYLIRRLLENGANSSFINQLNDSNVSLEQLIEDP