(data stored in ACNUC28527 zone)

EMBL: CP000240

ID   CP000240; SV 1; circular; genomic DNA; STD; PRO; 3046682 BP.
XX
AC   CP000240;
XX
PR   Project:PRJNA16252;
XX
DT   07-FEB-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Synechococcus sp. JA-2-3B'a(2-13), complete genome.
XX
KW   .
XX
OS   Synechococcus sp. JA-2-3B'a(2-13)
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Synechococcus;
OC   unclassified Synechococcus.
XX
RN   [1]
RP   1-3046682
RX   DOI; 10.1128/AEM.72.1.544-550.2006.
RX   PUBMED; 16391090.
RA   Allewalt J.P., Bateson M.M., Revsbech N.P., Slack K., Ward D.M.;
RT   "Effect of temperature and light on growth of and photosynthesis by
RT   Synechococcus isolates typical of those predominating in the octopus spring
RT   microbial mat community of Yellowstone National Park";
RL   Appl. Environ. Microbiol. 72(1):544-550(2006).
XX
RN   [2]
RP   1-3046682
RX   DOI; 10.1038/ismej.2007.46.
RX   PUBMED; 18059494.
RA   Bhaya D., Grossman A.R., Steunou A.S., Khuri N., Cohan F.M., Hamamura N.,
RA   Melendrez M.C., Bateson M.M., Ward D.M., Heidelberg J.F.;
RT   "Population level functional diversity in a microbial community revealed by
RT   comparative genomic and metagenomic analyses";
RL   ISME J 1(8):703-713(2007).
XX
RN   [3]
RP   1-3046682
RA   Heidelberg J.;
RT   ;
RL   Submitted (22-DEC-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-3046682
RA   Bateson M.M., Ward D.M.;
RT   ;
RL   Submitted (21-MAR-2006) to the INSDC.
RL   Department of Land Resources and Environmental Sciences, Montana State
RL   University - Bozeman, 334 Leon Johnson Hall P.O. Box 173120, Bozeman, MT
RL   59717-3120, USA
XX
DR   MD5; 274e9e7c23e30cbad9529fe252a5a0fa.
DR   BioSample; SAMN02604049.
DR   EnsemblGenomes-Gn; CYB_0328.
DR   EnsemblGenomes-Gn; CYB_0429.
DR   EnsemblGenomes-Gn; CYB_0440.
DR   EnsemblGenomes-Gn; CYB_0459.
DR   EnsemblGenomes-Gn; CYB_0509.
DR   EnsemblGenomes-Gn; CYB_0606.
DR   EnsemblGenomes-Gn; CYB_0657.
DR   EnsemblGenomes-Gn; CYB_0700.
DR   EnsemblGenomes-Gn; CYB_0802.
DR   EnsemblGenomes-Gn; CYB_0880.
DR   EnsemblGenomes-Gn; CYB_1059.
DR   EnsemblGenomes-Gn; CYB_1148.
DR   EnsemblGenomes-Gn; CYB_1155.
DR   EnsemblGenomes-Gn; CYB_1273.
DR   EnsemblGenomes-Gn; CYB_1377.
DR   EnsemblGenomes-Gn; CYB_1378.
DR   EnsemblGenomes-Gn; CYB_1379.
DR   EnsemblGenomes-Gn; CYB_1380.
DR   EnsemblGenomes-Gn; CYB_1381.
DR   EnsemblGenomes-Gn; CYB_1413.
DR   EnsemblGenomes-Gn; CYB_1524.
DR   EnsemblGenomes-Gn; CYB_1532.
DR   EnsemblGenomes-Gn; CYB_1602.
DR   EnsemblGenomes-Gn; CYB_1615.
DR   EnsemblGenomes-Gn; CYB_1642.
DR   EnsemblGenomes-Gn; CYB_1643.
DR   EnsemblGenomes-Gn; CYB_1717.
DR   EnsemblGenomes-Gn; CYB_1809.
DR   EnsemblGenomes-Gn; CYB_1825.
DR   EnsemblGenomes-Gn; CYB_1953.
DR   EnsemblGenomes-Gn; CYB_1954.
DR   EnsemblGenomes-Gn; CYB_1955.
DR   EnsemblGenomes-Gn; CYB_1956.
DR   EnsemblGenomes-Gn; CYB_1957.
DR   EnsemblGenomes-Gn; CYB_1981.
DR   EnsemblGenomes-Gn; CYB_2027.
DR   EnsemblGenomes-Gn; CYB_2097.
DR   EnsemblGenomes-Gn; CYB_2172.
DR   EnsemblGenomes-Gn; CYB_2218.
DR   EnsemblGenomes-Gn; CYB_2235.
DR   EnsemblGenomes-Gn; CYB_2242.
DR   EnsemblGenomes-Gn; CYB_2288.
DR   EnsemblGenomes-Gn; CYB_2323.
DR   EnsemblGenomes-Gn; CYB_2379.
DR   EnsemblGenomes-Gn; CYB_2414.
DR   EnsemblGenomes-Gn; CYB_2473.
DR   EnsemblGenomes-Gn; CYB_2583.
DR   EnsemblGenomes-Gn; CYB_2651.
DR   EnsemblGenomes-Gn; CYB_2693.
DR   EnsemblGenomes-Gn; CYB_2796.
DR   EnsemblGenomes-Gn; CYB_2888.
DR   EnsemblGenomes-Gn; EBG00001094400.
DR   EnsemblGenomes-Gn; EBG00001094401.
DR   EnsemblGenomes-Gn; EBG00001094402.
DR   EnsemblGenomes-Gn; EBG00001094403.
DR   EnsemblGenomes-Gn; EBG00001094404.
DR   EnsemblGenomes-Gn; EBG00001094405.
DR   EnsemblGenomes-Gn; EBG00001094406.
DR   EnsemblGenomes-Gn; EBG00001094407.
DR   EnsemblGenomes-Gn; EBG00001094408.
DR   EnsemblGenomes-Gn; EBG00001094409.
DR   EnsemblGenomes-Gn; EBG00001094410.
DR   EnsemblGenomes-Gn; EBG00001094411.
DR   EnsemblGenomes-Gn; EBG00001094412.
DR   EnsemblGenomes-Gn; EBG00001094413.
DR   EnsemblGenomes-Gn; EBG00001094414.
DR   EnsemblGenomes-Gn; EBG00001094415.
DR   EnsemblGenomes-Gn; EBG00001094416.
DR   EnsemblGenomes-Gn; EBG00001094417.
DR   EnsemblGenomes-Gn; EBG00001094418.
DR   EnsemblGenomes-Gn; EBG00001094419.
DR   EnsemblGenomes-Gn; EBG00001094420.
DR   EnsemblGenomes-Gn; EBG00001094421.
DR   EnsemblGenomes-Gn; EBG00001094422.
DR   EnsemblGenomes-Gn; EBG00001094423.
DR   EnsemblGenomes-Gn; EBG00001094424.
DR   EnsemblGenomes-Gn; EBG00001094425.
DR   EnsemblGenomes-Gn; EBG00001094426.
DR   EnsemblGenomes-Gn; EBG00001094427.
DR   EnsemblGenomes-Gn; EBG00001094428.
DR   EnsemblGenomes-Gn; EBG00001094429.
DR   EnsemblGenomes-Gn; EBG00001094430.
DR   EnsemblGenomes-Gn; EBG00001094431.
DR   EnsemblGenomes-Gn; EBG00001094432.
DR   EnsemblGenomes-Gn; EBG00001094433.
DR   EnsemblGenomes-Gn; EBG00001094434.
DR   EnsemblGenomes-Gn; EBG00001094435.
DR   EnsemblGenomes-Gn; EBG00001094436.
DR   EnsemblGenomes-Gn; EBG00001094437.
DR   EnsemblGenomes-Gn; EBG00001094438.
DR   EnsemblGenomes-Gn; EBG00001094439.
DR   EnsemblGenomes-Gn; EBG00001094440.
DR   EnsemblGenomes-Gn; EBG00001094441.
DR   EnsemblGenomes-Gn; EBG00001094442.
DR   EnsemblGenomes-Gn; EBG00001094443.
DR   EnsemblGenomes-Gn; EBG00001094444.
DR   EnsemblGenomes-Gn; EBG00001094445.
DR   EnsemblGenomes-Gn; EBG00001094446.
DR   EnsemblGenomes-Gn; EBG00001094447.
DR   EnsemblGenomes-Gn; EBG00001094448.
DR   EnsemblGenomes-Gn; EBG00001094449.
DR   EnsemblGenomes-Gn; EBG00001094450.
DR   EnsemblGenomes-Gn; EBG00001094451.
DR   EnsemblGenomes-Gn; EBG00001094452.
DR   EnsemblGenomes-Gn; EBG00001094453.
DR   EnsemblGenomes-Gn; EBG00001094454.
DR   EnsemblGenomes-Gn; EBG00001094455.
DR   EnsemblGenomes-Gn; EBG00001094456.
DR   EnsemblGenomes-Gn; EBG00001094457.
DR   EnsemblGenomes-Gn; EBG00001094458.
DR   EnsemblGenomes-Gn; EBG00001094459.
DR   EnsemblGenomes-Gn; EBG00001094460.
DR   EnsemblGenomes-Gn; EBG00001094461.
DR   EnsemblGenomes-Gn; EBG00001094462.
DR   EnsemblGenomes-Gn; EBG00001094463.
DR   EnsemblGenomes-Gn; EBG00001094464.
DR   EnsemblGenomes-Gn; EBG00001094465.
DR   EnsemblGenomes-Gn; EBG00001094466.
DR   EnsemblGenomes-Gn; EBG00001094467.
DR   EnsemblGenomes-Gn; EBG00001094468.
DR   EnsemblGenomes-Gn; EBG00001094469.
DR   EnsemblGenomes-Gn; EBG00001094470.
DR   EnsemblGenomes-Gn; EBG00001094471.
DR   EnsemblGenomes-Gn; EBG00001094472.
DR   EnsemblGenomes-Gn; EBG00001094473.
DR   EnsemblGenomes-Gn; EBG00001094474.
DR   EnsemblGenomes-Gn; EBG00001094475.
DR   EnsemblGenomes-Gn; EBG00001094476.
DR   EnsemblGenomes-Gn; EBG00001094477.
DR   EnsemblGenomes-Gn; EBG00001094478.
DR   EnsemblGenomes-Gn; EBG00001094479.
DR   EnsemblGenomes-Gn; EBG00001094480.
DR   EnsemblGenomes-Gn; EBG00001094481.
DR   EnsemblGenomes-Gn; EBG00001094482.
DR   EnsemblGenomes-Gn; EBG00001094483.
DR   EnsemblGenomes-Gn; EBG00001094484.
DR   EnsemblGenomes-Gn; EBG00001094485.
DR   EnsemblGenomes-Gn; EBG00001094486.
DR   EnsemblGenomes-Gn; EBG00001094487.
DR   EnsemblGenomes-Gn; EBG00001094488.
DR   EnsemblGenomes-Gn; EBG00001094489.
DR   EnsemblGenomes-Gn; EBG00001094490.
DR   EnsemblGenomes-Gn; EBG00001094491.
DR   EnsemblGenomes-Gn; EBG00001094492.
DR   EnsemblGenomes-Gn; EBG00001094493.
DR   EnsemblGenomes-Gn; EBG00001094494.
DR   EnsemblGenomes-Gn; EBG00001094495.
DR   EnsemblGenomes-Gn; EBG00001094496.
DR   EnsemblGenomes-Gn; EBG00001094497.
DR   EnsemblGenomes-Gn; EBG00001094498.
DR   EnsemblGenomes-Gn; EBG00001094499.
DR   EnsemblGenomes-Gn; EBG00001094500.
DR   EnsemblGenomes-Gn; EBG00001094501.
DR   EnsemblGenomes-Gn; EBG00001094502.
DR   EnsemblGenomes-Gn; EBG00001094503.
DR   EnsemblGenomes-Gn; EBG00001094504.
DR   EnsemblGenomes-Gn; EBG00001094505.
DR   EnsemblGenomes-Gn; EBG00001094506.
DR   EnsemblGenomes-Gn; EBG00001094507.
DR   EnsemblGenomes-Gn; EBG00001094508.
DR   EnsemblGenomes-Gn; EBG00001094509.
DR   EnsemblGenomes-Gn; EBG00001094510.
DR   EnsemblGenomes-Gn; EBG00001094511.
DR   EnsemblGenomes-Gn; EBG00001094512.
DR   EnsemblGenomes-Gn; EBG00001094513.
DR   EnsemblGenomes-Gn; EBG00001094514.
DR   EnsemblGenomes-Gn; EBG00001094515.
DR   EnsemblGenomes-Gn; EBG00001094516.
DR   EnsemblGenomes-Gn; EBG00001094517.
DR   EnsemblGenomes-Gn; EBG00001094518.
DR   EnsemblGenomes-Gn; EBG00001094519.
DR   EnsemblGenomes-Gn; EBG00001094520.
DR   EnsemblGenomes-Gn; EBG00001094521.
DR   EnsemblGenomes-Gn; EBG00001094522.
DR   EnsemblGenomes-Gn; EBG00001094523.
DR   EnsemblGenomes-Gn; EBG00001094524.
DR   EnsemblGenomes-Gn; EBG00001094525.
DR   EnsemblGenomes-Gn; EBG00001094526.
DR   EnsemblGenomes-Gn; EBG00001094527.
DR   EnsemblGenomes-Gn; EBG00001094528.
DR   EnsemblGenomes-Gn; EBG00001094529.
DR   EnsemblGenomes-Gn; EBG00001094530.
DR   EnsemblGenomes-Gn; EBG00001094531.
DR   EnsemblGenomes-Gn; EBG00001094532.
DR   EnsemblGenomes-Gn; EBG00001094533.
DR   EnsemblGenomes-Gn; EBG00001094534.
DR   EnsemblGenomes-Gn; EBG00001094535.
DR   EnsemblGenomes-Gn; EBG00001094536.
DR   EnsemblGenomes-Gn; EBG00001094537.
DR   EnsemblGenomes-Gn; EBG00001094538.
DR   EnsemblGenomes-Gn; EBG00001094539.
DR   EnsemblGenomes-Gn; EBG00001094540.
DR   EnsemblGenomes-Gn; EBG00001094541.
DR   EnsemblGenomes-Gn; EBG00001094542.
DR   EnsemblGenomes-Gn; EBG00001094543.
DR   EnsemblGenomes-Gn; EBG00001094544.
DR   EnsemblGenomes-Gn; EBG00001094545.
DR   EnsemblGenomes-Gn; EBG00001094546.
DR   EnsemblGenomes-Gn; EBG00001094547.
DR   EnsemblGenomes-Gn; EBG00001094548.
DR   EnsemblGenomes-Gn; EBG00001094549.
DR   EnsemblGenomes-Gn; EBG00001094550.
DR   EnsemblGenomes-Gn; EBG00001094551.
DR   EnsemblGenomes-Gn; EBG00001094552.
DR   EnsemblGenomes-Gn; EBG00001094553.
DR   EnsemblGenomes-Gn; EBG00001094554.
DR   EnsemblGenomes-Gn; EBG00001094555.
DR   EnsemblGenomes-Gn; EBG00001094556.
DR   EnsemblGenomes-Gn; EBG00001094557.
DR   EnsemblGenomes-Gn; EBG00001094558.
DR   EnsemblGenomes-Gn; EBG00001094559.
DR   EnsemblGenomes-Gn; EBG00001094560.
DR   EnsemblGenomes-Gn; EBG00001094561.
DR   EnsemblGenomes-Gn; EBG00001094562.
DR   EnsemblGenomes-Gn; EBG00001094563.
DR   EnsemblGenomes-Gn; EBG00001094564.
DR   EnsemblGenomes-Gn; EBG00001094565.
DR   EnsemblGenomes-Gn; EBG00001094566.
DR   EnsemblGenomes-Gn; EBG00001094567.
DR   EnsemblGenomes-Gn; EBG00001094568.
DR   EnsemblGenomes-Gn; EBG00001094569.
DR   EnsemblGenomes-Gn; EBG00001094570.
DR   EnsemblGenomes-Gn; EBG00001094571.
DR   EnsemblGenomes-Gn; EBG00001094572.
DR   EnsemblGenomes-Gn; EBG00001094573.
DR   EnsemblGenomes-Gn; EBG00001094574.
DR   EnsemblGenomes-Gn; EBG00001094575.
DR   EnsemblGenomes-Gn; EBG00001094576.
DR   EnsemblGenomes-Gn; EBG00001094577.
DR   EnsemblGenomes-Gn; EBG00001094578.
DR   EnsemblGenomes-Gn; EBG00001094579.
DR   EnsemblGenomes-Gn; EBG00001094580.
DR   EnsemblGenomes-Gn; EBG00001094581.
DR   EnsemblGenomes-Gn; EBG00001094582.
DR   EnsemblGenomes-Gn; EBG00001094583.
DR   EnsemblGenomes-Gn; EBG00001094584.
DR   EnsemblGenomes-Gn; EBG00001094585.
DR   EnsemblGenomes-Gn; EBG00001094586.
DR   EnsemblGenomes-Gn; EBG00001094587.
DR   EnsemblGenomes-Tr; CYB_0328-1.
DR   EnsemblGenomes-Tr; CYB_0429-1.
DR   EnsemblGenomes-Tr; CYB_0440-1.
DR   EnsemblGenomes-Tr; CYB_0459-1.
DR   EnsemblGenomes-Tr; CYB_0509-1.
DR   EnsemblGenomes-Tr; CYB_0606-1.
DR   EnsemblGenomes-Tr; CYB_0657-1.
DR   EnsemblGenomes-Tr; CYB_0700-1.
DR   EnsemblGenomes-Tr; CYB_0802-1.
DR   EnsemblGenomes-Tr; CYB_0880-1.
DR   EnsemblGenomes-Tr; CYB_1059-1.
DR   EnsemblGenomes-Tr; CYB_1148-1.
DR   EnsemblGenomes-Tr; CYB_1155-1.
DR   EnsemblGenomes-Tr; CYB_1273-1.
DR   EnsemblGenomes-Tr; CYB_1377-1.
DR   EnsemblGenomes-Tr; CYB_1378-1.
DR   EnsemblGenomes-Tr; CYB_1379-1.
DR   EnsemblGenomes-Tr; CYB_1380-1.
DR   EnsemblGenomes-Tr; CYB_1381-1.
DR   EnsemblGenomes-Tr; CYB_1413-1.
DR   EnsemblGenomes-Tr; CYB_1524-1.
DR   EnsemblGenomes-Tr; CYB_1532-1.
DR   EnsemblGenomes-Tr; CYB_1602-1.
DR   EnsemblGenomes-Tr; CYB_1615-1.
DR   EnsemblGenomes-Tr; CYB_1642-1.
DR   EnsemblGenomes-Tr; CYB_1643-1.
DR   EnsemblGenomes-Tr; CYB_1717-1.
DR   EnsemblGenomes-Tr; CYB_1809-1.
DR   EnsemblGenomes-Tr; CYB_1825-1.
DR   EnsemblGenomes-Tr; CYB_1953-1.
DR   EnsemblGenomes-Tr; CYB_1954-1.
DR   EnsemblGenomes-Tr; CYB_1955-1.
DR   EnsemblGenomes-Tr; CYB_1956-1.
DR   EnsemblGenomes-Tr; CYB_1957-1.
DR   EnsemblGenomes-Tr; CYB_1981-1.
DR   EnsemblGenomes-Tr; CYB_2027-1.
DR   EnsemblGenomes-Tr; CYB_2097-1.
DR   EnsemblGenomes-Tr; CYB_2172-1.
DR   EnsemblGenomes-Tr; CYB_2218-1.
DR   EnsemblGenomes-Tr; CYB_2235-1.
DR   EnsemblGenomes-Tr; CYB_2242-1.
DR   EnsemblGenomes-Tr; CYB_2288-1.
DR   EnsemblGenomes-Tr; CYB_2323-1.
DR   EnsemblGenomes-Tr; CYB_2379-1.
DR   EnsemblGenomes-Tr; CYB_2414-1.
DR   EnsemblGenomes-Tr; CYB_2473-1.
DR   EnsemblGenomes-Tr; CYB_2583-1.
DR   EnsemblGenomes-Tr; CYB_2651-1.
DR   EnsemblGenomes-Tr; CYB_2693-1.
DR   EnsemblGenomes-Tr; CYB_2796-1.
DR   EnsemblGenomes-Tr; CYB_2888-1.
DR   EnsemblGenomes-Tr; EBT00001549123.
DR   EnsemblGenomes-Tr; EBT00001549124.
DR   EnsemblGenomes-Tr; EBT00001549125.
DR   EnsemblGenomes-Tr; EBT00001549126.
DR   EnsemblGenomes-Tr; EBT00001549127.
DR   EnsemblGenomes-Tr; EBT00001549128.
DR   EnsemblGenomes-Tr; EBT00001549129.
DR   EnsemblGenomes-Tr; EBT00001549130.
DR   EnsemblGenomes-Tr; EBT00001549131.
DR   EnsemblGenomes-Tr; EBT00001549132.
DR   EnsemblGenomes-Tr; EBT00001549133.
DR   EnsemblGenomes-Tr; EBT00001549134.
DR   EnsemblGenomes-Tr; EBT00001549135.
DR   EnsemblGenomes-Tr; EBT00001549136.
DR   EnsemblGenomes-Tr; EBT00001549137.
DR   EnsemblGenomes-Tr; EBT00001549138.
DR   EnsemblGenomes-Tr; EBT00001549139.
DR   EnsemblGenomes-Tr; EBT00001549140.
DR   EnsemblGenomes-Tr; EBT00001549141.
DR   EnsemblGenomes-Tr; EBT00001549142.
DR   EnsemblGenomes-Tr; EBT00001549143.
DR   EnsemblGenomes-Tr; EBT00001549144.
DR   EnsemblGenomes-Tr; EBT00001549145.
DR   EnsemblGenomes-Tr; EBT00001549146.
DR   EnsemblGenomes-Tr; EBT00001549147.
DR   EnsemblGenomes-Tr; EBT00001549148.
DR   EnsemblGenomes-Tr; EBT00001549149.
DR   EnsemblGenomes-Tr; EBT00001549150.
DR   EnsemblGenomes-Tr; EBT00001549151.
DR   EnsemblGenomes-Tr; EBT00001549152.
DR   EnsemblGenomes-Tr; EBT00001549153.
DR   EnsemblGenomes-Tr; EBT00001549154.
DR   EnsemblGenomes-Tr; EBT00001549155.
DR   EnsemblGenomes-Tr; EBT00001549156.
DR   EnsemblGenomes-Tr; EBT00001549157.
DR   EnsemblGenomes-Tr; EBT00001549158.
DR   EnsemblGenomes-Tr; EBT00001549159.
DR   EnsemblGenomes-Tr; EBT00001549160.
DR   EnsemblGenomes-Tr; EBT00001549161.
DR   EnsemblGenomes-Tr; EBT00001549162.
DR   EnsemblGenomes-Tr; EBT00001549163.
DR   EnsemblGenomes-Tr; EBT00001549164.
DR   EnsemblGenomes-Tr; EBT00001549165.
DR   EnsemblGenomes-Tr; EBT00001549166.
DR   EnsemblGenomes-Tr; EBT00001549167.
DR   EnsemblGenomes-Tr; EBT00001549168.
DR   EnsemblGenomes-Tr; EBT00001549169.
DR   EnsemblGenomes-Tr; EBT00001549170.
DR   EnsemblGenomes-Tr; EBT00001549171.
DR   EnsemblGenomes-Tr; EBT00001549172.
DR   EnsemblGenomes-Tr; EBT00001549173.
DR   EnsemblGenomes-Tr; EBT00001549174.
DR   EnsemblGenomes-Tr; EBT00001549175.
DR   EnsemblGenomes-Tr; EBT00001549176.
DR   EnsemblGenomes-Tr; EBT00001549177.
DR   EnsemblGenomes-Tr; EBT00001549178.
DR   EnsemblGenomes-Tr; EBT00001549179.
DR   EnsemblGenomes-Tr; EBT00001549180.
DR   EnsemblGenomes-Tr; EBT00001549181.
DR   EnsemblGenomes-Tr; EBT00001549182.
DR   EnsemblGenomes-Tr; EBT00001549183.
DR   EnsemblGenomes-Tr; EBT00001549184.
DR   EnsemblGenomes-Tr; EBT00001549185.
DR   EnsemblGenomes-Tr; EBT00001549186.
DR   EnsemblGenomes-Tr; EBT00001549187.
DR   EnsemblGenomes-Tr; EBT00001549188.
DR   EnsemblGenomes-Tr; EBT00001549189.
DR   EnsemblGenomes-Tr; EBT00001549190.
DR   EnsemblGenomes-Tr; EBT00001549191.
DR   EnsemblGenomes-Tr; EBT00001549192.
DR   EnsemblGenomes-Tr; EBT00001549193.
DR   EnsemblGenomes-Tr; EBT00001549194.
DR   EnsemblGenomes-Tr; EBT00001549195.
DR   EnsemblGenomes-Tr; EBT00001549196.
DR   EnsemblGenomes-Tr; EBT00001549197.
DR   EnsemblGenomes-Tr; EBT00001549198.
DR   EnsemblGenomes-Tr; EBT00001549199.
DR   EnsemblGenomes-Tr; EBT00001549200.
DR   EnsemblGenomes-Tr; EBT00001549201.
DR   EnsemblGenomes-Tr; EBT00001549202.
DR   EnsemblGenomes-Tr; EBT00001549203.
DR   EnsemblGenomes-Tr; EBT00001549204.
DR   EnsemblGenomes-Tr; EBT00001549205.
DR   EnsemblGenomes-Tr; EBT00001549206.
DR   EnsemblGenomes-Tr; EBT00001549207.
DR   EnsemblGenomes-Tr; EBT00001549208.
DR   EnsemblGenomes-Tr; EBT00001549209.
DR   EnsemblGenomes-Tr; EBT00001549210.
DR   EnsemblGenomes-Tr; EBT00001549211.
DR   EnsemblGenomes-Tr; EBT00001549212.
DR   EnsemblGenomes-Tr; EBT00001549213.
DR   EnsemblGenomes-Tr; EBT00001549214.
DR   EnsemblGenomes-Tr; EBT00001549215.
DR   EnsemblGenomes-Tr; EBT00001549216.
DR   EnsemblGenomes-Tr; EBT00001549217.
DR   EnsemblGenomes-Tr; EBT00001549218.
DR   EnsemblGenomes-Tr; EBT00001549219.
DR   EnsemblGenomes-Tr; EBT00001549220.
DR   EnsemblGenomes-Tr; EBT00001549221.
DR   EnsemblGenomes-Tr; EBT00001549222.
DR   EnsemblGenomes-Tr; EBT00001549223.
DR   EnsemblGenomes-Tr; EBT00001549224.
DR   EnsemblGenomes-Tr; EBT00001549225.
DR   EnsemblGenomes-Tr; EBT00001549226.
DR   EnsemblGenomes-Tr; EBT00001549227.
DR   EnsemblGenomes-Tr; EBT00001549228.
DR   EnsemblGenomes-Tr; EBT00001549229.
DR   EnsemblGenomes-Tr; EBT00001549230.
DR   EnsemblGenomes-Tr; EBT00001549231.
DR   EnsemblGenomes-Tr; EBT00001549232.
DR   EnsemblGenomes-Tr; EBT00001549233.
DR   EnsemblGenomes-Tr; EBT00001549234.
DR   EnsemblGenomes-Tr; EBT00001549235.
DR   EnsemblGenomes-Tr; EBT00001549236.
DR   EnsemblGenomes-Tr; EBT00001549237.
DR   EnsemblGenomes-Tr; EBT00001549238.
DR   EnsemblGenomes-Tr; EBT00001549239.
DR   EnsemblGenomes-Tr; EBT00001549240.
DR   EnsemblGenomes-Tr; EBT00001549241.
DR   EnsemblGenomes-Tr; EBT00001549242.
DR   EnsemblGenomes-Tr; EBT00001549243.
DR   EnsemblGenomes-Tr; EBT00001549244.
DR   EnsemblGenomes-Tr; EBT00001549245.
DR   EnsemblGenomes-Tr; EBT00001549246.
DR   EnsemblGenomes-Tr; EBT00001549247.
DR   EnsemblGenomes-Tr; EBT00001549248.
DR   EnsemblGenomes-Tr; EBT00001549249.
DR   EnsemblGenomes-Tr; EBT00001549250.
DR   EnsemblGenomes-Tr; EBT00001549251.
DR   EnsemblGenomes-Tr; EBT00001549252.
DR   EnsemblGenomes-Tr; EBT00001549253.
DR   EnsemblGenomes-Tr; EBT00001549254.
DR   EnsemblGenomes-Tr; EBT00001549255.
DR   EnsemblGenomes-Tr; EBT00001549256.
DR   EnsemblGenomes-Tr; EBT00001549257.
DR   EnsemblGenomes-Tr; EBT00001549258.
DR   EnsemblGenomes-Tr; EBT00001549259.
DR   EnsemblGenomes-Tr; EBT00001549260.
DR   EnsemblGenomes-Tr; EBT00001549261.
DR   EnsemblGenomes-Tr; EBT00001549262.
DR   EnsemblGenomes-Tr; EBT00001549263.
DR   EnsemblGenomes-Tr; EBT00001549264.
DR   EnsemblGenomes-Tr; EBT00001549265.
DR   EnsemblGenomes-Tr; EBT00001549266.
DR   EnsemblGenomes-Tr; EBT00001549267.
DR   EnsemblGenomes-Tr; EBT00001549268.
DR   EnsemblGenomes-Tr; EBT00001549269.
DR   EnsemblGenomes-Tr; EBT00001549270.
DR   EnsemblGenomes-Tr; EBT00001549271.
DR   EnsemblGenomes-Tr; EBT00001549272.
DR   EnsemblGenomes-Tr; EBT00001549273.
DR   EnsemblGenomes-Tr; EBT00001549274.
DR   EnsemblGenomes-Tr; EBT00001549275.
DR   EnsemblGenomes-Tr; EBT00001549276.
DR   EnsemblGenomes-Tr; EBT00001549277.
DR   EnsemblGenomes-Tr; EBT00001549278.
DR   EnsemblGenomes-Tr; EBT00001549279.
DR   EnsemblGenomes-Tr; EBT00001549280.
DR   EnsemblGenomes-Tr; EBT00001549281.
DR   EnsemblGenomes-Tr; EBT00001549282.
DR   EnsemblGenomes-Tr; EBT00001549283.
DR   EnsemblGenomes-Tr; EBT00001549284.
DR   EnsemblGenomes-Tr; EBT00001549285.
DR   EnsemblGenomes-Tr; EBT00001549286.
DR   EnsemblGenomes-Tr; EBT00001549287.
DR   EnsemblGenomes-Tr; EBT00001549288.
DR   EnsemblGenomes-Tr; EBT00001549289.
DR   EnsemblGenomes-Tr; EBT00001549290.
DR   EnsemblGenomes-Tr; EBT00001549291.
DR   EnsemblGenomes-Tr; EBT00001549292.
DR   EnsemblGenomes-Tr; EBT00001549293.
DR   EnsemblGenomes-Tr; EBT00001549294.
DR   EnsemblGenomes-Tr; EBT00001549295.
DR   EnsemblGenomes-Tr; EBT00001549296.
DR   EnsemblGenomes-Tr; EBT00001549297.
DR   EnsemblGenomes-Tr; EBT00001549298.
DR   EnsemblGenomes-Tr; EBT00001549299.
DR   EnsemblGenomes-Tr; EBT00001549300.
DR   EnsemblGenomes-Tr; EBT00001549301.
DR   EnsemblGenomes-Tr; EBT00001549302.
DR   EnsemblGenomes-Tr; EBT00001549303.
DR   EnsemblGenomes-Tr; EBT00001549304.
DR   EnsemblGenomes-Tr; EBT00001549305.
DR   EnsemblGenomes-Tr; EBT00001549306.
DR   EnsemblGenomes-Tr; EBT00001549307.
DR   EnsemblGenomes-Tr; EBT00001549308.
DR   EnsemblGenomes-Tr; EBT00001549309.
DR   EnsemblGenomes-Tr; EBT00001549310.
DR   EuropePMC; PMC1413695; 16467157.
DR   EuropePMC; PMC1764927; 17028085.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2799449; 20003240.
DR   EuropePMC; PMC3147441; 21666019.
DR   EuropePMC; PMC3393498; 22563047.
DR   EuropePMC; PMC3719534; 23687278.
DR   EuropePMC; PMC4712262; 26834710.
DR   EuropePMC; PMC4911352; 27379049.
DR   EuropePMC; PMC5364356; 27983722.
DR   EuropePMC; PMC6235289; 30427861.
DR   GOA; P0C1D1.
DR   InterPro; IPR017499; Thf1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01370; CRISPR-DR57.
DR   RFAM; RF01371; CRISPR-DR58.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000240.
DR   SILVA-SSU; CP000240.
DR   UniProtKB/Swiss-Prot; P0C1D1; THF1_SYNJB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3046682
FT                   /organism="Synechococcus sp. JA-2-3B'a(2-13)"
FT                   /strain="JA-2-3B'a(2-13)"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Wyoming"
FT                   /collection_date="Jul-2002"
FT                   /note="genotype: B'NACy10o"
FT                   /db_xref="taxon:321332"
FT   gene            64..1467
FT                   /gene="dnaA"
FT                   /locus_tag="CYB_0001"
FT   CDS_pept        64..1467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CYB_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01003"
FT                   /db_xref="GOA:Q2JHS1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JHS1"
FT                   /protein_id="ABD01003.1"
FT                   /translation="MDISLDQLWDEALCHLQVQLSRPTFEAWIKTARAESLVDNRLTIC
FT                   TPSEWARGWLQKHYASTITEVVQRVAGIPLQVEFSVSPHASVEAEPPSRAISPTSGRAG
FT                   SLPASTTLGLEVGGSLPMRAPDLNPKYSFSRFVVGPNNRMAHAAALAVADKPGRAYNPL
FT                   FLCGGVGLGKTHLMQAIGHYQLEANPQAKVFYVSTERFTNDLIDAIRRDSMQSFREHYR
FT                   DVDILLVDDVQFIEGKEYTQEEFFHTFNTLHESGKQIVLAADRSPHLIPRLQERLCSRF
FT                   SMGLIAEIQSPDIETRMAILKKKAEYEGMNLPADVIEYIATTYTSNIRELEGALIRAVA
FT                   YVSISGLPMSVETIQPILNPPSEPKEITADMITDVVCEEFGIDRDSLLGSSRKRDISQA
FT                   RQIAMFLMRHYTNLSLPKIGDYFGGKDHTTVLYSCEKVSQLQRQSLQFERQLQKLVERL
FT                   RVVANSRSS"
FT   gene            1493..2317
FT                   /locus_tag="CYB_0002"
FT   CDS_pept        1493..2317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHS0"
FT                   /protein_id="ABD01004.1"
FT                   /translation="MRCCCRAVEHLQPCPSAWRIPRKAATVGTRCMGLQAVRQSGKGLP
FT                   LGMLLLWAGLVPGWPVWANSTQASIQDPAPATLSAALDLGLDSQLLEGSPVLRRWLQNP
FT                   PHLLEEIRNTPVLPTRLQAGFESSSHWRISLQDLRLGDRLTLSGDYRQSSEHPEVRQYG
FT                   SEMRYFLAPMGSRFNLAPQLGYRALEQKNRSLSGVSYGAFAVLALAPGGVDLTGSYSWV
FT                   APQEPEEGQATLAELTAAYAISPSFRLSARYSLRNSTLDREFSFGVGLEWIP"
FT   gene            complement(2443..3264)
FT                   /locus_tag="CYB_0003"
FT   CDS_pept        complement(2443..3264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0003"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAS82375.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01005"
FT                   /db_xref="GOA:Q2JHR9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR9"
FT                   /protein_id="ABD01005.1"
FT                   /translation="MLSSLSALPVHLYRCLSCGREGLTQAPGREQGSVADRVYCPSCGQ
FT                   IYPITASGAVDFIGSSSDLHLTPAQAIAHLPGFAWGYDRLWRPWALSLLTGESFGSERE
FT                   SQLLAELVGEGDPILDLGTAGGYWSRLILARDPQRTVVGLDNAAGVLAEAAQQAQPHWQ
FT                   HYSLMRARAEQLPLASGTFGAVISGATLNEVPLDPCLREIARVLKPGGAFVSMHSQQVQ
FT                   GWGQMVQQWLEATGLHFFSETQLREHLQQVGLQLERYLSLGWVAFVRAVRL"
FT   gene            complement(3372..5294)
FT                   /locus_tag="CYB_0004"
FT   CDS_pept        complement(3372..5294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0004"
FT                   /product="metalloprotease, ATP-dependent, FtsH family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01006"
FT                   /db_xref="GOA:Q2JHR8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR8"
FT                   /protein_id="ABD01006.1"
FT                   /translation="MNKPLSPQRWLIALLLGFCLWQGSGLVLQPAPAHAALASALTYDR
FT                   FLRYVEEGRVTDVRLTDNNLVAEVTAVDPQTQHSTRYRVNLLPNTVPQLVDRLTEQGIE
FT                   VAVVPTRNGSAFWALLGNLVIPLLLLGGLFFFLRRAGGGAGGPGQAMNFGKSRARFQME
FT                   AKTGVKFDDVAGIEEAKEELQEVVTFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAK
FT                   AIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFIDEIDAVGRQRGA
FT                   GIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRPDVLDAALLRPGRFDRQITVDR
FT                   PSFKGRYEILRVHARNKKLAEEVSLEAIARRTPGFAGADLANLLNEAAILAARRQRMAI
FT                   TNQDIEDAIDRITIGLTKPPLLDGKSKRLIAYHECGHALLMTLLPHADPLNKVTIIPRS
FT                   GGAGGFAQQLPNEEQIDSGMYSRAWLLDRVVVGFGGRAAEEIVFGYSEVTTGASNDLQQ
FT                   NTNLVRQMVTRFGMSELGPLMLDPPNNEVFLGGGWMNRVEYSEDVAAKIDRQVRQILES
FT                   CYQKAKQILLEHRPLLDRLADTLVERETLDGDEFRAIVSEYVPIPEKVGLPSPFPEAGR
FT                   SPKLV"
FT   gene            complement(5431..6306)
FT                   /locus_tag="CYB_0005"
FT   CDS_pept        complement(5431..6306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0005"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01007"
FT                   /db_xref="GOA:Q2JQA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA5"
FT                   /protein_id="ABD01007.1"
FT                   /translation="MPSLANQVVLITGASAGIGEAVALEAAKRGARLVLAARREGLLRN
FT                   VKDLVESRGAEALVVPTDMADTAQVEALAQKALDHFGRVDILVNNAGYGQMGPVEEVDV
FT                   AAMRRQFEVNVFGLHALTRALLPQMRERGSGRILNLSSVAGQMSMPFSGVYNATKFAVE
FT                   ALSDALRVEVAPFGIKVILIEPGPVATEFGRVAEETFAAVVNPNGPYKAILDKTAELAS
FT                   SFNKMAWPVEKVVEPILRAMTDPHPSDRYTAFTGGKVALGLMRLMPAALADSMWRRVYG
FT                   LDGLGSPGSA"
FT   gene            6297..6425
FT                   /locus_tag="CYB_0006"
FT   CDS_pept        6297..6425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0006"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA4"
FT                   /protein_id="ABD01008.1"
FT                   /translation="MKAWFLLSKLSTILEERPGSLERGSSVFRTSGFGIRYHGYIG"
FT   gene            6533..7120
FT                   /locus_tag="CYB_0007"
FT   CDS_pept        6533..7120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA3"
FT                   /protein_id="ABD01009.1"
FT                   /translation="MKYFCRRVGRGRSLSPEERWVVTEVRLAQLLRAAEANLRANSELR
FT                   QQQQEQQKQLEAERRHSEALRDSTADLRTSVMELREGQALWQSHVEELRSCLRELLKEQ
FT                   SELVQIVAQQQHILKDCQEVIRAMLEQMRDDHRDFRSAISILLEELHQTVRCLVIRSGG
FT                   TLPKPVRHPEVPETDPGSPPTDSASPGEGSSS"
FT   gene            complement(7143..9602)
FT                   /locus_tag="CYB_0008"
FT   CDS_pept        complement(7143..9602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0008"
FT                   /product="type II DNA topoisomerase, A subunit"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01010"
FT                   /db_xref="GOA:Q2JQA2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA2"
FT                   /protein_id="ABD01010.1"
FT                   /translation="MIVTDLQGEMQRSYLEYAMSVIVGRALPDVRDGLKPVHRRILYAM
FT                   HELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRMVQDFSSRYPLVAGHGNFGS
FT                   VDDDPPAAMRYTECRLAELSHTALLEQVSEEIVDFMPNFDGSQAEPTVLPARLPILLLN
FT                   GSSGIAVGMATNIPPHNLGEVVDGLLALIDHPDLSPEELLRWIPGPDFPTGGQILDTQG
FT                   IRAAYLTGRGSITLRGVARFEEIQPGKGRHRRPALVISEFPYQVNKAAWIEKVAELANQ
FT                   DRISGIADLRDESDRSGIRVVVELKREANPQAVLQQLYKLTPLQSNFGAILLALVNGEP
FT                   RQLSLKEILQHFLQFREATLNRMFRAELQQVQRKAEEVAGMLLALADLEGVIELLRQAP
FT                   DGTTAKAQLQTRLGCTPQQAETILAMPLRRLTGLERERLHQEHAQLQTRIEELQGLLSD
FT                   RRKLLNYLKKELRHLKKTFGDPRRTQILSASELEAEVAQIPSGEETEETHFLLQFTRKG
FT                   YVRRLPLPSRRSRSNPAQRELGEDVLVGLECVTLEQEILVLTAGGKAFTLPIAGIPLST
FT                   GSSRGVPLVTLLPNPEPIVATFTLDPDPGKASLVVLSRQGRIKRLALAELMGLTQRGST
FT                   VLKLKEGDELGWAALWDPDHQGYSVVLATSGGRVLRLDVQQIPLMGRAAMGSPALRLGR
FT                   TERIVGMALVPSQGILVLASRLGYLKRLSLEEIPILERGQVGAPAFHFSDRGDVLVGLV
FT                   GLPPELERPSHLQLDVITESEQVYSFSPAEIPLQSRSGGGSLLVKGERVRELRLFWPQW
FT                   LPEGDVG"
FT   gene            9866..10816
FT                   /pseudo
FT                   /locus_tag="CYB_0010"
FT                   /note="transporter, arsenical resistance-3 (ACR3) family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family HMM PF01758"
FT   gene            complement(10813..12723)
FT                   /locus_tag="CYB_0009"
FT   CDS_pept        complement(10813..12723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0009"
FT                   /product="putative drug resistance ATPase-1 (Drug RA1) ABC
FT                   transporter family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01011"
FT                   /db_xref="GOA:Q2JQA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA1"
FT                   /protein_id="ABD01011.1"
FT                   /translation="MALFTLNSVRKDFGIKELLRNASFSLEEGDKVGIIGTNGSGKSTL
FT                   LKMIAGLEPIDGGDLWVSSGARIIYLPQQPEMDPEHTVLEQVFAAAGEKMRLIRAYEEL
FT                   SHRLAHQGGDPSLLSQLASISERIEVESAWDLETQAKTILSRLGIADFQARVGDLSGGY
FT                   RKRIAIASALLAEPDALLMDEPTNHLDAESVEWLQDYLNRFAGAVLLITHDRYFLDRVT
FT                   QRILEIDRGDLYAYSGNYSYYLEKKAAAEAVEKGSQRKYANLLRRELEWLKRGAKARST
FT                   KQKARKQRIEDLQNQEFKQALGQVDIATAGRRIGKKVIELEGIHKSYGDQLLIQDFTYT
FT                   FAPDDRVGIIGPNGAGKSTLMNIIIGKLAPDAGRVEIGPTIHIGYFDQHSDDLSLNPDQ
FT                   RVIEYLKEVAELVKTADGETITASQMLERFLFPPNQQYAPLHKLSGGERRRLFLLRVLM
FT                   QAPNVLILDEPTNDLDVQTLAVLEDYLEEFNGCVIVVSHDRYFLDRTVNRIFAFEGSGR
FT                   IRQYPGNYSVYLEHKQRQESEIKSARPESVPLIPQPEKELDRIPQSRKLSFKEKREYEQ
FT                   LESQIPQMEAEKAEIEQILYRNPPSGYSEVQKLAQKLADLTAAIDSGTARWLELAERHL
FT                   N"
FT   gene            complement(12864..13868)
FT                   /locus_tag="CYB_0011"
FT   CDS_pept        complement(12864..13868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0011"
FT                   /product="putative phosphonate ABC transporter,
FT                   phosphonate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01098"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01012"
FT                   /db_xref="GOA:Q2JQA0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQA0"
FT                   /protein_id="ABD01012.1"
FT                   /translation="MMKTFLAGRRSLLVGLVATVAGASVALSGLVHAQAKDCPRPPEMD
FT                   VRFCDRDGDLIADVPEDPNEWINPDTLIFAYTPVEDPSVYKNVWAEFLDHLAELTGKKV
FT                   EYFPVQSNAAQLEAMRAGRLHVTGFNTGSVPLAVNAVGFRPFAMMASLDGSFGYEMEII
FT                   VPADSDIQSIEDLRGRQLAFTSETSNSGFKAPSALLKGEFGMEPGVDYQTVFSGNHENS
FT                   ILGVFNGDYEAAAIANSVMTRMAKRGTIDPSKIRTIYKSQTFPTTAYGVVYNLHPEVAE
FT                   KVKEAFFTFKWEGTKLAEEFGKSGGEQFITITYKEYWEVIRTIDKASGVEYKL"
FT   gene            complement(14052..14774)
FT                   /locus_tag="CYB_0012"
FT   CDS_pept        complement(14052..14774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0012"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01013"
FT                   /db_xref="GOA:Q2JQ99"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ99"
FT                   /protein_id="ABD01013.1"
FT                   /translation="MFSLLLLLTLIGVIFFTRRLQQLLHNIPQRYWLSLGGGISLAYVF
FT                   TAFLAEVTELQQHLMPLEVPVLGYLIEHIHLLMLLGIVTVYGLEGLAQSSKQEALLHPR
FT                   IFSVHIGFFTLYSVILGYLLRHTVQEWLSCLLLTIALAIHLSIVCKDLFEHHPHLFQHQ
FT                   GRWLLIGSLFVGWLMGQRAILPEIALAASIAFVAGVLIFQVLKHELPETEGHFGAFLAG
FT                   VVGFGSLLVAISAIRAWE"
FT   gene            15045..16448
FT                   /locus_tag="CYB_0014"
FT   CDS_pept        15045..16448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0014"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01014"
FT                   /db_xref="GOA:Q2JQ98"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ98"
FT                   /protein_id="ABD01014.1"
FT                   /translation="MPTPPIHFGTDGWRAVIADAFTFQNLALAAQASAQVLARTYPGEG
FT                   ILVGYDNRFLSERFAAHVAEVVARLGIPVYLSTCVAPTPAFSWGAKERGCHGALVITAS
FT                   HNPPHYSGLKVKGGFGGSVPPEVTAAIEQDMRHLQPLGSHKAPIHAWDPWPGYLAQLSR
FT                   FVDLEKLKGSPAKIWVDVMFGSGAGGLKRLLGEKVIELQAHRDPLFGGFPPEPLPQNLQ
FT                   ASAQIIAADPAPLKMGLVFDGDADRIAALDGQGHFLSPQILIPILIDHLAGRRGLRGEI
FT                   VKTISGSELFVKVAQHYGLPVTEMPVGFKYIAERMMSTEVLLGGEESGGIGYLGHIPER
FT                   DALLSALYLIEAVTETGQDLSTIYRALQEREGFTSVYLRRDLHLADQNQQTELFKRLQM
FT                   DPPAEILGQKVIKHFDKDGHKFTLADGSWVMIRGSGTEPLLRLYSEAKTPEEVNRLLDW
FT                   AAGLNSTTA"
FT   gene            complement(16445..16555)
FT                   /locus_tag="CYB_0013"
FT   CDS_pept        complement(16445..16555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01015"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ97"
FT                   /protein_id="ABD01015.1"
FT                   /translation="MGGEANPVGCRSLAASQSLHSRVKGIQLCAKDYLGY"
FT   gene            complement(17327..17938)
FT                   /locus_tag="CYB_0015"
FT   CDS_pept        complement(17327..17938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0015"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ96"
FT                   /protein_id="ABD01016.1"
FT                   /translation="MRRRFGSALGRGGLSLWATCASVALITGCSSETTSGVPPLLASSG
FT                   ATPPPVAVAPTIAPITPPPIQLDLPDPPSLLPDGEFNLSSVESAFVTITLRGLLAPGVI
FT                   RSVEVQFFNISRGTDITSIFLPTAIEQFRNTLIGRGNSYDDRINGITLTNGFTFPADLA
FT                   AYNTNVAAGERVLVIVVIRDSFGQALRLEADAQATQAGAE"
FT   gene            18219..19631
FT                   /locus_tag="CYB_0016"
FT   CDS_pept        18219..19631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ95"
FT                   /protein_id="ABD01017.1"
FT                   /translation="MWICPDLRCVRKCHMNFKGRSLAVLCGVLLLGGCGEVNESPTLPG
FT                   PVQVDPAAFVSAQEYRFTPGSVLETTSLRLDYVNPRFDNGIPVRTNPLQGSGEARIANV
FT                   EARILPVNEIPATELTIDSTLRSSTLAIQIGRTTPLVNITAFGPNDGRLSTQFNIAGLV
FT                   AISTLPNDQRIRVNTTFRAIRDDRTVLTLTVRRILVSRNGNQVVLEGDSSLIVPTVGVL
FT                   FENGGPGPGGEILAPGSFVNPPPPQGPVVAILQTGSFSASFVVRQRGVAGDGTPEDALA
FT                   LFARLNFRPNQAEIVYRPAQVGTQSVLFAPDPTRPNILPNQLVRIRRLLNGRVQAEFDP
FT                   ANVSTVLNFVQVSPPPNAPTAFDYFFSLRTEREEGGGTPVVLQGIVPATGDFLFRTLAG
FT                   AQLSGPFNRLDIGGGTQRGNLNLVFDSTTSAERISGQWFLEQQFPTNTLTPDPTGTILI
FT                   IRGFFEGTEVRL"
FT   gene            complement(19691..21247)
FT                   /locus_tag="CYB_0017"
FT   CDS_pept        complement(19691..21247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0017"
FT                   /product="phytoene desaturase family protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01018"
FT                   /db_xref="GOA:Q2JQ94"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ94"
FT                   /protein_id="ABD01018.1"
FT                   /translation="MSYDAVVIGAGHNGLVSACYLAKAGQKVMVLERYHTVGGAAITEE
FT                   IHPGFRVSVASYSCSLLRPEIIRDLRLPDYGFEVYAKQPSYFMPFPDGQHLFLYADNRA
FT                   KSKAEIAKFSRKDAEAYDRWEEFWDRVNEVVEPTLMQPPISLGQLADRFAAAGYEDDFR
FT                   RIMLLSTTDLLDEFFESEQVKAAMAPQSLIGTSAGPMTPGTPYIWLVHAVGRAIGSRGV
FT                   WGYVRGGMGSITQAMAKAALDLGVEIRTSAPVAEILMESGQATGVVLESGETVRARAVL
FT                   SNAHPQITFLRLCSSLPPDLRDRLERHYRTSGPVYKLNLALEELPRYTAAPAEVPPEVV
FT                   SSATVDIAPSVAYLERAWDDCKYGIPSRDPFIEIYSQSPTDPTMAPPGKHILSCFCQFV
FT                   PYQPKGRDWNDGLREEFADRVIDKIAQFAPNIKNAVIARQMLSPVDLEARFGLVGGSIF
FT                   HGEMTPDQSYNLRPISGLADYRSPIPGLYLCGSGAHPGGGVTGIPGHNCAQVVLSDLPK
FT                   L"
FT   gene            complement(21294..22574)
FT                   /locus_tag="CYB_0018"
FT   CDS_pept        complement(21294..22574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0018"
FT                   /product="ISSoc2, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01019"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ93"
FT                   /protein_id="ABD01019.1"
FT                   /translation="MTITFLPNRNWLRISSPSCTASAIGSTDSENIGLQSRKIRIYPEP
FT                   ALAKVWKRWQAACRYCYNQAIAYQRQHGTTKTPEKLRNIILQSDLPQWVKEAPCHIKQN
FT                   AVMEAWQAFRQSKEARFRSVRDKTHTLQFNNSNFSQGRWYPKLTKGLSFTASEAVPQKC
FT                   AYGTKLMRVKDRWYAIFPEPVNEQCSLARGVIALDPGVRSFLTGFDGAGFVDIAKGDFG
FT                   RIVRLCYHLDDLQSRLSKAPRPKRRRMRQAAFRLRERIRNLVDECHRKVAAFLTDNYRL
FT                   IFLPTFESAKMVAKAGRKFGSKTAGAMLTWAHYRFKQFLKFQAKKKNVVVVEVSEAYTS
FT                   KTCTKCGHIHTKLGGAKVFRCPKCNHRLPRDWQGALGVMLRALRDTAFLFGLRPADAVA
FT                   LASRSDNGNGQNAIASPLSSNAQQCSA"
FT   gene            complement(22429..23022)
FT                   /locus_tag="CYB_0019"
FT   CDS_pept        complement(22429..23022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0019"
FT                   /product="ISSoc2, resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01020"
FT                   /db_xref="GOA:Q2JQ92"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ92"
FT                   /protein_id="ABD01020.1"
FT                   /translation="MARYVKPREAADYFGVCLHTLRRWEQKGWINAVRTPSGRARRYDL
FT                   DSYIKAPRKAKRVVLYARVSSRGQKSDLERQIARLVNLYPGAEVVGEVGGGLNFKRPKF
FT                   LALLERVRAGDVGTIVVAHRDRLCRFGFEFVEWYCRQYGCEILVLDDDHFSPQQELVED
FT                   ILAILHCFSNRLYGLRKYRAAIEKDTDLSGASAG"
FT   gene            complement(23139..23720)
FT                   /locus_tag="CYB_0020"
FT   CDS_pept        complement(23139..23720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AG1841; match to
FT                   protein family HMM PF05685"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01021"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ91"
FT                   /protein_id="ABD01021.1"
FT                   /translation="MTLAARLDPYIRRYTFEEFHRLIESGQIEEPNQLELIDGLLVQKM
FT                   TKGERHAAYCSRLYRLLVGLVQEQAIVRTQDPVQLPPNHEPEPDFAIVRFQQDEYRSRH
FT                   PQPEDIYLIIEVADSSLTYDREVKLGLYAKAGIPNYWILNLQENCLETYSLPTGSGVYQ
FT                   KREAYTPEEKVGIPGIRAGELSLDQVFSIG"
FT   gene            complement(23828..26062)
FT                   /gene="psaB"
FT                   /locus_tag="CYB_0021"
FT   CDS_pept        complement(23828..26062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaB"
FT                   /locus_tag="CYB_0021"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="identified by match to protein family HMM PF00223;
FT                   match to protein family HMM TIGR01336"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01022"
FT                   /db_xref="GOA:Q2JQ90"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ90"
FT                   /protein_id="ABD01022.1"
FT                   /translation="MTTATRFPQFSQDLASDPTTRRLWYGIATAHDFETHDGMTEERLY
FT                   QKLFATHFGHLAIIFLWASGNVFHIAWQGNYEQWVANPTGVTPIAHAIWDPHFGKAAVE
FT                   AFTQPGGGGPVNAAYSGLYYWFNTIGLRTNGDLYAGAIGLLLLAAVFLFAGWLHLQPRF
FT                   RPSLSWFKNAEARLNHHLAGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLTTLPHPA
FT                   GLKPFFTLNWGVYAQNPDTANHVWGTAEGAGTAILTFLGGFNPNTQSLWLTDMAHHHLA
FT                   IAVIFIVAGHMYRTNWGIGHSIREILGAHNPPKGTPFGGLLGEGHKGLYDTVNNSLHFQ
FT                   LALALACLGVVTSLVAQHMYALNPYVFMSMDHTTEAALYTHHQYIAGFLMVGAFAHGAI
FT                   FLVRDYDPEANKNNVLARVLDHKEAIISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEK
FT                   QILIEPVFAQFIQASHGKMIYGMDVLLSNPDSLASTAWPNYGNVWLPGWLQAINDPNGS
FT                   LFLPIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGG
FT                   TCDISAWDAFYLAMFWMLNTIGWVTFYWHWKQLGVWSGNTAQFNENSTYLMGWLRDYLW
FT                   ANSAQLINGYNPYGMNNLAVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHER
FT                   TPLAKLIRWKDKPVAMSIVQGRLVGLAHFTVGYVLTYAAFVIASTASQSG"
FT   gene            complement(26084..28351)
FT                   /gene="psaA"
FT                   /locus_tag="CYB_0022"
FT   CDS_pept        complement(26084..28351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaA"
FT                   /locus_tag="CYB_0022"
FT                   /product="photosystem I core protein PsaA"
FT                   /note="identified by match to protein family HMM PF00223;
FT                   match to protein family HMM TIGR01335"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01023"
FT                   /db_xref="GOA:Q2JQ89"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006243"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ89"
FT                   /protein_id="ABD01023.1"
FT                   /translation="MTTTPKEREPKVKVSVDVDPVPTSFEKWAKPGHFDRSLSRGPKTT
FT                   TWIWNLHALAHDFDSHTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYYHGAQFSNYSAWL
FT                   ADPINIKPSAQVVWPIFGQEILNGDVGGGFEGIRITSGLFHLWRAAGITNEFQLLCTAI
FT                   GGLVMAGLCLFAGWFHYHKRAPKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVAIP
FT                   INKMLDAGVPADQVPLPHEFILKPALMKEMFPSVDWGIFSGVVPFFTLDWGKYAEFLTF
FT                   KGGLDPQNGALWLTDQAHHHLAIAVLFIVAGHMYRTNWGIGHSIKEILEAHKGPFTGEG
FT                   HKGLYEVLTTSWHAQLAINLAMVGSLSIIVAQHMYAMNPYPYMGIDYATQISLFTHHMW
FT                   IGGFFVVGGAAHGAIYMVRDYDPAVNRNNVLDRVLRHRDAIISHLNWVCLFLGFHAFGF
FT                   YVHNDTMQALGRPQDMFSDTGIQLQPIFAQWIQSLHTSAIASTAPYVGASVSPIFGGDV
FT                   VAVGGKVSMMPMVLGTADFMVHHIHAMTIHITVLILLKGVLFARSSRLIPDKGKLGFRF
FT                   PCDGPGRGGTCQVSGWDHVFLGLFWMYNCISIVIFHFSWKMQSDIWGTVNADGTIEHIT
FT                   GGNFAASAININGWLRDFLWAQSVQVINSYGSALSAYGLLFLGAHFVWAFSLMFLFSGR
FT                   GYWQELIESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARFGA
FT                   LG"
FT   gene            28679..30397
FT                   /gene="ureC"
FT                   /locus_tag="CYB_0023"
FT   CDS_pept        28679..30397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="CYB_0023"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by similarity to SP:P73061; match to
FT                   protein family HMM PF00449; match to protein family HMM
FT                   PF01979; match to protein family HMM TIGR01792"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01024"
FT                   /db_xref="GOA:Q2JQ88"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ88"
FT                   /protein_id="ABD01024.1"
FT                   /translation="MTLEIPRRQYVSNYGPTVGDRVRLADTELIIEVEEDFTTYGEEIK
FT                   FGGGKTIRDGMGQSPTATRANGALDLVITNALILDWWGIVKADVGIRDGYIVGIGKAGN
FT                   PNIQAGVTPGMVVGPSTEVIAGENLILTAGGIDAHVHFICPQLCEFAIASGVTTLLGGG
FT                   TGPATGSNATTCTPGAWNLGKMLQAAEGFPVNLGFFGKGNAAFPAALREQVEAGACGLK
FT                   IHEDWGSTPAVIDSCLQVADEYDIQTLIHTDTLNESAFVEDTIAAINGRTIHTFHTEGA
FT                   GGGHAPDIIRIASEPNVLPSSTNPTRPFTRNTIEEHLDMLMVCHHLSKNVPEDIAFAES
FT                   RIRPQTIAAEDILHDMGVFSIISSDSQAMGRVGEVIIRTWQTAHKMKVQRGPLPQDSSR
FT                   NDNFRAKRYVAKYTICPAIAQGLSHVIGSVEVGKLADLCLWKPAFFGVKPEIVLKGGLI
FT                   AYAQMGDPNASIPTPQPVYPRPMFGSFGRALTETSLLFVSQAALDLGIPEKLGIQRRAV
FT                   AVKNCREIGKADLKLNTATPHIEVNPETYEVRADGELLTCEPAEVLPMAQRYFLF"
FT   gene            30461..31567
FT                   /locus_tag="CYB_0024"
FT   CDS_pept        30461..31567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0024"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P31134; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01025"
FT                   /db_xref="GOA:Q2JQ87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ87"
FT                   /protein_id="ABD01025.1"
FT                   /translation="MGHLVLRHLSKRFHKGGIPVLRDLSLSVEAGEIFALLGPSGCGKS
FT                   TTLNLIAGLLEPDPLPYPGEIWLDGIPLNPLPPERRGVTLLSQHSRLFPHLSVGENVAF
FT                   GLKMRGIPRTEREAAALRMLERVQLAGFAQRRPSQLSGGQAQRVALARALVIRPKVLLL
FT                   DEPLSALDANLRQEMQALILELQAETGVTTVLVTHDQAEATAMAQRIGLMFEGQLHQVG
FT                   SPVEFYQQPRSERIARFFGGVNFFDAQAEGHQLRLNDGILLKSDAPLQGQVRLTVRPEQ
FT                   VQVLPQPPGLADNVFLAQVMAERFAGTQRRLTLQAPWGSLQAWVAPHQVFAPGQTVWIH
FT                   LPPEALWPVGVGGDPSPPALFPKEEGRA"
FT   gene            31635..32228
FT                   /locus_tag="CYB_0025"
FT   CDS_pept        31635..32228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0025"
FT                   /product="ISSoc2, resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01026"
FT                   /db_xref="GOA:Q2JQ86"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ86"
FT                   /protein_id="ABD01026.1"
FT                   /translation="MARYVKPREAADYFGVCLHTLRRWEQKGWIKAIRTPSGRARRYDL
FT                   DSYIKTPRKVKRVVLYARVSSRGQKPDLERQIARLVNLYPGAEVVGEVGGGLDFKRPKF
FT                   LALLERVRAGDVGTIVVAHRDRLCRFGFEFVEWYCRQYGCEILVLDDDHLSPQQELVED
FT                   ILTILHCFSSRLYGLRKYRAAIEKDTDLSGASAG"
FT   gene            32083..33315
FT                   /locus_tag="CYB_0026"
FT   CDS_pept        32083..33315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0026"
FT                   /product="ISSoc2, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01027"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ85"
FT                   /protein_id="ABD01027.1"
FT                   /translation="MTTTFLPNRNWLRISSPSCTASAVGSTDSENTGLQSRKIRIYPEP
FT                   ALAKVWKRWQAACRYCYNQAIAYQRQHGVPRTARKLRDIILRSDLPQWVKDAPCHIKQN
FT                   AVVEAWLAFRRSKDARFRSVRDRSHTLQFNAGNFRNGTWYPKLTRGLAFRASEEMPREW
FT                   ARGTELMRVKDRWYAIFPEPVNEQCSLAKGVVALDPGVRSFLTGFDGAGFVNIAKGDFG
FT                   RIARLCYHLDDLQSRLSKAPRLKRRRMRQAAFRLRERIRNLVDECHRKVAAFLTDNYRL
FT                   IFLPTFESAKMVAKAGRKFGSKTARAMLTWAHYRFQQFLKFQAKKKNVVVVEVSEAYTS
FT                   KTCTKCGHIHTKLGGAKVFRCPKCSHRLPRDWQGALGVMLRALRDTAFLFGNGQNAIAS
FT                   PLSSNAQQCSA"
FT   gene            33375..34634
FT                   /locus_tag="CYB_0027"
FT   CDS_pept        33375..34634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SM00070"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01028"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR027020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ84"
FT                   /protein_id="ABD01028.1"
FT                   /translation="MQPKSVFWKRRQVLAGLGSLGAWALSQGSPFAQNTSQNMVDLGSL
FT                   SWADILERARGSSVNWAMWSGSEAINGFVDGWVRSQLQERYGIRLNRIPLTDTVEAVNK
FT                   VIGEVQAGLRSGGSIDLIWINGNNFRTLKQGNLLYGPFAEKLPSLTFYDPADIATDFGL
FT                   PTEGYSAPYTGNYFLMAYDAERVPNPPQSHAELLAWAEANPGRFTYVAPPDFHGSRFLL
FT                   SAFYGVTGGYAQYSGPDFDADLWARQSPALVEYLRKLDPFLWRQGQTYPPTFARLAELF
FT                   ANGEVWLIPTFIDQVILRKGNGQFPPSTTPYGIPGTSLIDPSFTAIPINAANPWGAMVL
FT                   AEVLASPEGQLEKFKPEVWGDLPLIDVSRLSADYQTAFAQLEAAAGIPIQEAIAGAVPI
FT                   VNSEYTVQLEALWQQQVLPG"
FT   gene            complement(34638..37646)
FT                   /locus_tag="CYB_0028"
FT   CDS_pept        complement(34638..37646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0028"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01029"
FT                   /db_xref="GOA:Q2JQ83"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ83"
FT                   /protein_id="ABD01029.1"
FT                   /translation="MLFFSGSSEVRSRWPFRSIPLRVALLLPLVLSVAGGVGGVAYLSW
FT                   QGGRHLALRLTEQLRREVTDRTEEHLARYLQIPLQINALNQGAVRGGLLPDLTTPSPAD
FT                   LEVLEAHFARQLQPFPELSYIGFVSAQGGFVTARRHADGSIWTYHTPSLLPGSVQGCQR
FT                   DPETGDPTGLRRQLGFVDLRRLFWFPQLLQSEGIRDTWVVTRFFAELPAQDPERLILTS
FT                   LSLTDSGGRVYGSLLASLSIQQLQAFLERVQGSSAVGVSFLLDEEGQVVASTAGPAPHP
FT                   LLVAVQEQVGSWGTASSQDSLRLKVGGIPYWVEVESVQSEGRLGFYFVHGIPEATLLAE
FT                   VRRSAQQAALLGGGLLLSMLGTGILLGEALLRPLRRLTQVAEQFIHSGFQPWPPLDPGP
FT                   IQEVQTLTKAWQQAAAAQQALLDRLWQQQQEYRAVVEQQTELICRFRPDTCITYVNPAY
FT                   LRFFGRRAEEVVGQPWRDRLPEEEQAKVLQAFAALTPEHPFYCSEREYPGENGQSRWIS
FT                   WVDRGIFDSQGRLVEILSVGREITEQKRAEQQLQALNRELEAQVELRTAKLQQALHFEG
FT                   VLRAISSRMVVSLNEGEILEEVVRALAEALGLTCCQVLLLLEDGSTWIPGYCYSPSLSS
FT                   DVAQDGGADPLHGPDYASDPEFLRLLQSHSSSQQKWKIHCCCRKEGRWVRLLVCTLWDK
FT                   EKRLGALLLERLPEQEFSEDEIQLAYQVANLCALAIRQARLYQAAQAQVKELERLNLLK
FT                   DDFLSTVSHELRTPMTNVRMALQMLQMTRDNPEKQRHYFTIALKECNRQIELINDLLDM
FT                   RRLGAGTYLLQPENIFLPRYLQDLLAGAQPLAQAKHQHLQLHLEAGIPSLWADPTCLGR
FT                   ILRELLHNAIKYTAPEGSIHLRAVSEGEGILFVCSNSSEIPTAELPRIFEKFYRIPQSD
FT                   RWKHGGTGLGLALVKQLVEHMGGNISVNSSDGWTHFQVWLPQGEDPAPPLPGPPPMSED
FT                   LPFWKEAGGEGHT"
FT   gene            complement(37665..38306)
FT                   /locus_tag="CYB_0029"
FT   CDS_pept        complement(37665..38306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0029"
FT                   /product="quaternary amine ABC transporter (QAT) family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01030"
FT                   /db_xref="GOA:Q2JQ82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ82"
FT                   /protein_id="ABD01030.1"
FT                   /translation="MSLLARSLAYAQNHSDMLFQAFVQHLQLVAVPLGMGLLLGLPLGF
FT                   FSSRSQMLSLVVINAFSSLRVIPSLAILFLAIPYFGLSFRSAVVALTLLALPPILISTD
FT                   VAFRSLEPALREAALSMGMTPGQVLRHVEIPLALPVILAGVKTATIEVIASATLAAFIG
FT                   AGGLGTFITLGFALYDNAILLVGAVPVALLAIAAEIGLGTLQRALEPPQA"
FT   gene            complement(38532..39323)
FT                   /locus_tag="CYB_0030"
FT   CDS_pept        complement(38532..39323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0030"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01031"
FT                   /db_xref="GOA:Q2JQ81"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ81"
FT                   /protein_id="ABD01031.1"
FT                   /translation="MAMQRDLQELIISPAQVQSLSQVPVAWLYRPRPVRRFKDRLRQFS
FT                   AFWDLLRLLVTLDLFLRFLTFWTGGSLLTLVGRIWIPGLQATWGTWLVEWGILAAIAAL
FT                   GQAYWIFRSRRMPLLLNLLGEVDRYNRIIQAIHVNDQLVEAGNPEVKLAQRAEVIEALK
FT                   LTRADLIRALKTERILRQNEDLIEQQSEFFGDNLAALTALQVSEQASEQGRILEAALQI
FT                   ALQVRSQIRRLQEREANHPPNRDPDKIEKDQQDRDGNSDGQ"
FT   gene            39538..40023
FT                   /locus_tag="CYB_0031"
FT   CDS_pept        39538..40023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AH2183"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01032"
FT                   /db_xref="GOA:Q2JQ80"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ80"
FT                   /protein_id="ABD01032.1"
FT                   /translation="MTSQLRQLKAHLAEPENFAPYGQVICPTPDHKPFDSQDAQLFLNQ
FT                   GQPRFYIMRLPRRGLKFTQITHHIRCTQCLGSLNGKEWFIGVAPPADELHVDQIQAFRV
FT                   PGDRFIKLEMGTWHAGPYFDHEEFIDFYNLELADTNITDHETINLLQTYNLEFQITP"
FT   gene            complement(40497..40718)
FT                   /locus_tag="CYB_0032"
FT   CDS_pept        complement(40497..40718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ79"
FT                   /protein_id="ABD01033.1"
FT                   /translation="MLGGLTVLLLLSPQAGNKPRQANRAKAAKSWWVTLGCNVAMTTNL
FT                   PNAAGFDPVLSPGQVGYSTKIHGDKGIT"
FT   gene            40889..41899
FT                   /locus_tag="CYB_0033"
FT   CDS_pept        40889..41899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0033"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01034"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ78"
FT                   /protein_id="ABD01034.1"
FT                   /translation="MPIASFLCRLDRQTRSFTGPIYAEQPQVATCNPGRLTPAAAQKMM
FT                   DRLNFLRLLHQLPPVKLNPQFLEAAQQAALMQVANGTLSHQPPPSWRCFTPAGEAGSRF
FT                   SNLAVGPILELNGPDPGRVLARQVDIYFAEPGRENFVDVGHRRWNLYPQYAQGAYGIVF
FT                   DPRAGRVTQANANWIFGFDESVPDPEFIAFPEKDGYLYRLEGFSGQPLSAYRWSFSVPS
FT                   RGGKADLSQAQVRITDALSGEPVPVGDLRVGDPAFGLETLTYSVGSIQPNRNYTFEISG
FT                   IRLNGGPPRSYRYTTALYDCDPQTSQRPAPLTEGLGIPPRLLWQREPFNSFNPLN"
FT   gene            42092..43639
FT                   /gene="nirA"
FT                   /locus_tag="CYB_0034"
FT   CDS_pept        42092..43639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirA"
FT                   /locus_tag="CYB_0034"
FT                   /product="ferredoxin-nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01035"
FT                   /db_xref="GOA:Q2JQ77"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ77"
FT                   /protein_id="ABD01035.1"
FT                   /translation="MANQFERLKSEKDGLAVKAELEAFARMGWENIPEDDRDHRLKWLG
FT                   IFFRKRTPGQFMLRLRLPNGILTSGQMRMLGAIIHPYGEQGVADITTRQNLQLRGIPIE
FT                   EMPQILGYLKEVGLTSIQSGMDNVRNITGSPLAGIDPDELIDVRGLTRKVQDMITNNGE
FT                   GNPSFSNLPRKFNIAICGCRDNSVHAEINDLAFVPAFKNGRLGFNVLVGGFFSARRCAE
FT                   AIGLDVWVDPRDVVPLCEAVLLVYRDHGLRANRQKARLMWLIDEWGLEKFRAAVERQTG
FT                   HPLLRAAEKDEVVWHKRDLLGVHAQKQPGLNFVGLHVPVGRLNALEMMELARLAEVYGS
FT                   GELRLTVEQNVLIPNVPDSRVAPLLKEPLLKKFSPNPGPLQRGLVSCTGNQFCNFALIE
FT                   TKNRAVALMEELEAELEIPQTVRIHWTGCPNSCGQPQVADIGLMGTTARKDGRVVEAVD
FT                   IYMGGEVGKDAKLGECVRKGIPCEDLKPVLVELLREHFGARPRQHPSAAQASVLVTR"
FT   gene            43701..45023
FT                   /gene="nrtA"
FT                   /locus_tag="CYB_0035"
FT   CDS_pept        43701..45023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtA"
FT                   /locus_tag="CYB_0035"
FT                   /product="nitrate ABC transporter, periplasmic
FT                   nitrate-binding protein NrtA"
FT                   /note="identified by similarity to SP:P38043; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01036"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ76"
FT                   /protein_id="ABD01036.1"
FT                   /translation="MSKLFSTSSPVSRRQFLAGVAALTAGAATAGIPRAQSQSLGKGYW
FT                   VAQADTPETTSAKLGFIALTDAAPLIIAKEKGFFDKYGMKDVEVVKQASWGTTRDNLVL
FT                   GSAAGGIDGAHILTPMPYLITTGKVTDGKPVPMYILARLNLDGQGISISNQYRDLQIGL
FT                   DSSPLKAKFAEVRAAGGDPKCAMTFPGGTHDVWMRYWLAAGGIDPTSDVSIIVVPPPQM
FT                   VANMKSRTMEAFCVGEPWNAQLVNQKEGYSALTTGELWNGHPEKAFALRADWVDAHPKA
FT                   TLALLKAVLEAQIWCDQMENKEEMCRIIGDRRWLGVPVTDILGRSRGTFDYGTGKVVEN
FT                   SPHLMKFWQNYASYPFKSHDLWFLTENIRWGYLPADTDTKALVERVNREELWREAAKAI
FT                   GQEAAIPPSPSRGVETFFDGVQFDPENPAAYLEKLAIKKLA"
FT   gene            45169..46128
FT                   /gene="ntrB-1"
FT                   /locus_tag="CYB_0036"
FT   CDS_pept        45169..46128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB-1"
FT                   /locus_tag="CYB_0036"
FT                   /product="nitrate ABC transporter, permease protein NrtB"
FT                   /note="identified by similarity to SP:P38044; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01183"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01037"
FT                   /db_xref="GOA:Q2JQ75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ75"
FT                   /protein_id="ABD01037.1"
FT                   /translation="MRIFHSALQLGYHLFRILLPLLVGLGHWLLKTGQGSVLQSSTGIG
FT                   SPASSAPSSAWRQRVQIHKALRRILLPATAILLVLILWQIIYSRPGANLPTPLQVWQDT
FT                   WDPLIKDPFFDYGGNAKGLFWQIWASLRRVFIGFALAGLVGVVGGMIIGVNRWLYEALD
FT                   PIFQVLRTVPPLAWLPISLAAFRDANPSAIFVIFITALWPILINTVVGVQQIPQDYRNV
FT                   ARIVRMSGWKYFFKIVFPATVPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAW
FT                   NSSRISEIILALIYVGMVGLLLDRITAWIGSLVVAEDR"
FT   gene            46201..48192
FT                   /gene="ntrC-1"
FT                   /locus_tag="CYB_0037"
FT   CDS_pept        46201..48192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC-1"
FT                   /locus_tag="CYB_0037"
FT                   /product="nitrate ABC transporter, ATP-binding protein
FT                   NtrC"
FT                   /note="identified by similarity to SP:P73450; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01184"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01038"
FT                   /db_xref="GOA:Q2JHR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR7"
FT                   /protein_id="ABD01038.1"
FT                   /translation="MKTQPYIEVDHVDKEFLLDNGEVYPVLKDIHLEIQKGEFVSLIGH
FT                   SGCGKSTLLNIIAGLEKPSRGGILLEGRQVTDPGPDRMVVFQNYSLLPWLTVRENVALA
FT                   VDEVLGSLPKAERSRIVEEHIRQVGLQGAADKRPAHLSGGMKQRVAIARALAIRPRVLL
FT                   LDEPFGALDALTRGNLQEQLMEIAQAEQLTCVMVTHDVDEALLLSDRVVMMTNGPEARI
FT                   GQILRIPFPRPRHRLEVVRHPDYYSLRGEMIYFLNQQKRARQKTPVRVAIAKHGLEKVN
FT                   LEIGFVPLNDCAPLVVAQEKGLFQKHGLEQVTLVREPGWKTIWEGIRSGRLDAAMVVAG
FT                   IPLASTLGVGGVPVPLVTALTLSRGGNAITFGRRLLERGVQSLADFRQYLNHTPDTVHT
FT                   LGVVHPASMQNFLLRHWLAGGGVDPDRDVTLTVIPPPQMVAHLKAGNIDGYCVGEPWNS
FT                   RAVREQLGFIVTTTLEILPSHIEKVLTVRQDWAQNYPRTHVALVKALLEACHYCDQPQH
FT                   RSEILEWLAQPQYVGVALEDLQPGWTGILQRGIADESQALTGFHQFANGRNTCPERLEH
FT                   LWILTQMARWGLCAFPRNWVSVLDQVLDSETYALAARELGLPDRAHDRGALLFGDGSRF
FT                   DGEDPVAYLESVAIRQDLKLQEYQLSEV"
FT   gene            48231..49073
FT                   /gene="ntrD"
FT                   /locus_tag="CYB_0038"
FT   CDS_pept        48231..49073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrD"
FT                   /locus_tag="CYB_0038"
FT                   /product="nitrate ABC transporter, ATP-binding protein
FT                   NtrD"
FT                   /note="identified by similarity to SP:P38046; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01184"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01039"
FT                   /db_xref="GOA:Q2JHR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR6"
FT                   /protein_id="ABD01039.1"
FT                   /translation="MTSSRLSSSPLSSASPVAGLPLLCLQNVGKTYFTSAGPFVALENI
FT                   NLEVAAGEFVCIIGHSGCGKSTLINMVAGFSTPTSGSIALKGQPITSPGPDRMMVFQHY
FT                   SLLPWLTAFENIYLVVDQVYPNKSRREKREIVEEHLELVGLAEAAHKRPKQLSGGMKQR
FT                   VAIARALAVRPQVLLLDEPFGALDAITKEDLQDELLAIWRDHRCTVLMITHDIDEALYL
FT                   SDRVVMMTNGPAAHIGEILTIPFERPRIRSRIMEMPEFYELRNRALDFLYRRFAHGGD"
FT   gene            49091..49687
FT                   /locus_tag="CYB_0039"
FT   CDS_pept        49091..49687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD70760.1; match to
FT                   protein family HMM PF05685"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01040"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR5"
FT                   /protein_id="ABD01040.1"
FT                   /translation="MEREVDGRCSGSGSSNRSPNGGAGLALPKTLADCLANPVAPTKWV
FT                   DGYIVEKVGQTLGHAKIQTRLLFRWLGYVECLPLGGMVLVKAPCQTTGKVRRPDVAYLS
FT                   PDLIQQFGEDIATLPQSYPLTGEILSPTDSGEDIFLKAQEYLSSGALEVWLVFPKSKFI
FT                   FIQTQDRHLWLTEQETAKSQVVLPGFEIQVADLLG"
FT   gene            49774..51909
FT                   /gene="narB"
FT                   /locus_tag="CYB_0040"
FT   CDS_pept        49774..51909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narB"
FT                   /locus_tag="CYB_0040"
FT                   /product="nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01041"
FT                   /db_xref="GOA:Q2JHR4"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR4"
FT                   /protein_id="ABD01041.1"
FT                   /translation="MEPEKAVIKTLCPYCGVGCGLEAVSTASGGWKIRGDREHPSSLGM
FT                   VCVKGATVLEAVGRDRLLYPLFRESLGQPFRRISWDQAFEEMVSRLRCLKDNPHSMAMY
FT                   GSGQLLTEDYYVAQKLIKGCLGTNNFDTNSRLCMSSAVSAYTQSLGSDGPPCCYEDLDL
FT                   CNLAFLVGTNTAECHPILFNRLKKRHKPGSPLKMVVVDPRRTQTAEAADLHLKIRPGTD
FT                   IDLFNGIAHLLLKWGSIAADFIEGCTQGFAEYAALLADYEPQIVAQRCGIATEDLIEAA
FT                   KLWQGSQRVLSLWSMGLNQSSEGTAKITSLINLHLLTGQIGRPGTGPFSLTGQPNAMGG
FT                   REAGGLSHLLPGYRLVSQPQHRAEVEQAWGLPGGSISPHPGLRATEMIAALETGSLQFF
FT                   WIVATNPLVSFPDLERVKKALKKSPFTVYQEAYYPTETAEYAHLLLPACQWSEKTGVMT
FT                   NSERRVTLCQAFRDPPGEARPDWEIFAEVGRRLGFEAQFSFQTAAEVYAEFAALTANRL
FT                   CDHSGLSHALLAERGPQQWPYPKERTSAPKSTRLYTDWRFPTPDGRARFIPHHSRGLAE
FT                   PPDPQFPYVLTTGRLYGHWHTQTRTGRIEKIKQMHPQPFIEIHPRDAEKLGIQDGDWVQ
FT                   VRSARGRAYFPAKITANIAPGTVFVPMHWGSLWAEQAECNALTHDISCPDSGQPELKAC
FT                   AVALEKADPPLKQSPQL"
FT   gene            51934..52434
FT                   /locus_tag="CYB_0042"
FT   CDS_pept        51934..52434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD78799.1; match to
FT                   protein family HMM TIGR02664"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01042"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ74"
FT                   /protein_id="ABD01042.1"
FT                   /translation="MTLFQFEQDFADSLRCIPMTLRLKLDLCGIKLKLHQWAKFSLEER
FT                   RKCVDWPSESPQDLEELRNHLRHLVRSICHEEAQEIPIDPQPEWQNPNQIPMAVQQKAQ
FT                   DLGIRLALDFWRNLHDIQRFALLKLSRSHHENKNFLPALREFGLKMARDGDCSYCKLPG
FT                   SDR"
FT   gene            complement(52431..53648)
FT                   /locus_tag="CYB_0041"
FT   CDS_pept        complement(52431..53648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0041"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01043"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ73"
FT                   /protein_id="ABD01043.1"
FT                   /translation="MSQVLTISCKLKVAQSQAAKLDATMEAFGQALNWVNQNTPEKIVN
FT                   AVKLQSLCYYEIRARFGLSSNLAQQVCRRVAGSRKVAKQKKRPVKEFKSGFVTYDARIF
FT                   SFRQKDWTVSLTTVEGRERFELAIGNYQRGMLAGSNPKSATLVQRKDGSYYIQICVEKK
FT                   PPKQQDTDKVIGVDLGRTDIAHTSEGDNWNGQQLNRVRDHYSKLRAALQRKASKGTRSS
FT                   RRRCRELLQRLSGKERRFQSRQRCVAKTWVNHRISKAIVSRAKATNSAIALEDLTGIRE
FT                   RVNQQPRSKTERRRANSWAFYQLRQFLEYKALRAGVALILVPPAYTSQTCHRCLHIHPD
FT                   PAQSYRSGKSFKCGHCGWEGDADLNGANVIALLGAVVNQPRGPGLFCSLVEQNRLRATE
FT                   SPLRIA"
FT   gene            complement(54109..55404)
FT                   /gene="purD"
FT                   /locus_tag="CYB_0043"
FT   CDS_pept        complement(54109..55404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="CYB_0043"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02842; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01044"
FT                   /db_xref="GOA:Q2JQ72"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ72"
FT                   /protein_id="ABD01044.1"
FT                   /translation="MQALVIGSGGREHALAWKLLQSPQVTRIYCAPGNGGMQQLPRCQS
FT                   VALAATDIEGLVRFATVQGIRLTVVGPELPLVQGIVDAFQAAGLPIFGPSRAAAQLEGS
FT                   KLWAKQLMQEAGIPTARATGFAELSAAVAYLDSQSFPVVIKKDGLAAGKGVTVAQNREE
FT                   AVQALEAALAKPGDQVLIEEFIPGQEVSVLALTDGQICVPLPPAQDYKRLGEGDTGPNT
FT                   GGMGAHAPADHLVTPELLARIQAQILDPTLEALQRRGIRYQGVIYAGLMITPSGDPYVL
FT                   EYNCRFGDPEAQVLLPLLENPLDEVLLACIEGRLAQIQLKWKPGYAACVVMAAPGYPDA
FT                   YERGIPVSGLDAAATTGALVFHAGTRQAGKQLLSDGGRVLCLTGQGATLSEALRQAYAA
FT                   VEQVQFPKAYYRSDIGSHALGPAVRRGVIPTP"
FT   gene            complement(55507..56598)
FT                   /locus_tag="CYB_0044"
FT   CDS_pept        complement(55507..56598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0044"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01045"
FT                   /db_xref="GOA:Q2JQ71"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ71"
FT                   /protein_id="ABD01045.1"
FT                   /translation="MRASPWLRDPPAEQAGEIAAGMERLAVIVPAYNEAENVVGCLSSI
FT                   LDSTSAPLQVWLVDDESTDATWELAQALAAERQDPRLHLLKGDPRPKGQRWVGKNWACA
FT                   QAVARVEADYLLFLDCDVRLGSGAIEAALGHLLASGSGLVSVGPQLVCGCLAEWLVQPI
FT                   MMTILAVGYNFAAVNDPDNPKAFAFGPFLLFRRSAYEQVGGHAGVADVVIEDVALGQRI
FT                   KAQGLGLQICLGGPRVRSRMYANGAALWEGWTKNWFLGLERNWALAVLAMGTVLGICSL
FT                   PWLGLILAGATGSLEVLLASFAGILAQLAIRLLLRHWAHLPLCYWWLTAVGGWATAAII
FT                   LASAIRTTTGRNWTWRGRSLAVH"
FT   gene            complement(56766..58055)
FT                   /locus_tag="CYB_0045"
FT   CDS_pept        complement(56766..58055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0045"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01046"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ70"
FT                   /protein_id="ABD01046.1"
FT                   /translation="MPLRFCKSRTYHDPLHGAISLNGGDAVEALLIRLIDTPAFQRLRR
FT                   IRQLDTAFFTFHGAEGSRFTHSVGVLQVTRRLFDKLAHRHPELRPYRAVTLASALLHDI
FT                   GHAPFSHAGEEIFGCRHEVWTARILREDPQVRTLLAEFDSQLPAQMQQVLQKQFPLPLV
FT                   GQLISSQLDCDRFDYLMRDSLLTGAQYGHLDLDRILTVLDYDPETGSLSIPARKGLGAI
FT                   EHYLVVRYFMYTQVYQHPKSLCARFILDRLFKRAQVLLQRGEIELDPILSAWCWASLAA
FT                   QKGDPFELPLPLYLAADDIIFSYPMRLWAMSGKDPILADLSRRYLERDLFKARNITQLS
FT                   EEQRQTLVAAVQAKMLRDGLDPESYLGIRSAHVQGYSFYDQGIQLKTERGYEEIAHLSP
FT                   LVRALVETQRQVWLIFPRPYGDIVEGVLSA"
FT   gene            58144..59217
FT                   /locus_tag="CYB_0046"
FT   CDS_pept        58144..59217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0046"
FT                   /product="GDSL-like lipase/acylhydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01047"
FT                   /db_xref="GOA:Q2JQ69"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ69"
FT                   /protein_id="ABD01047.1"
FT                   /translation="MPLSAKDASTRTPENSTPRQQDSWVFLLSLLILILSLGLTACSAS
FT                   SGSPVVPSPPTLTRYVALGASDAVGYNASISCDGPANAAGTRPQRSEPLDCPNGTGYVP
FT                   RLARLLPGPVELINLGRSGAVLSPAMQALRQGIPANLLQDQVPRLPPDATLITIWVGGN
FT                   DTNAIALAAAQRALRGEDPLPFVDQQIRQFAADYQTLLQAVRARAPQARLAVANLPNFA
FT                   LIPLGQQQPSSVRQLLSLISVGLTQRAINPLSQQGIPVVDLLCDPRSYRRESFFPGPLA
FT                   DGFHPNDRGYADLADAFLSAFRQPIPPQTRCPPFSEVGSLQWDAAAESALRSFLTDEYK
FT                   PAQWEGSLRSARDPKGA"
FT   gene            complement(59247..61082)
FT                   /locus_tag="CYB_0047"
FT   CDS_pept        complement(59247..61082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0047"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01048"
FT                   /db_xref="GOA:Q2JQ68"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ68"
FT                   /protein_id="ABD01048.1"
FT                   /translation="MPTPRSSVASRSVIPQSTSSVQMIPLGGEREIGKNTWAFRYEDDI
FT                   ILLDAGLAFPDESMHGVNIVLPDMTYIKQNRDKVRGMVVTHGHEDHIGGIPYHLREFDI
FT                   PVIYGPRLALALLEEKLREVGLLNRTELRPVGPREIVPLSKHFFAEFIRNTHSFADSFT
FT                   VALHTPVGVIIQTGDFKIDHTPVDGEYFDLQRLAEHGEKGVLCLISDSTNAEVPGFTPS
FT                   EASVVPGLTKAIAGAKGRVIITTFASSVHRLNLVLQIAEQQGRVVSLLGRSMLNVVAHA
FT                   RRLGYIRCKDETLQPMHVINSLPDDRVIILTTGSQGEPLAALTRIANGEHPQLQIKPGD
FT                   TVVWSANPIPGNTIAVSRVIDKLMELGANVIYGKDKGLHVSGHGCQEDQKLMIALTRPK
FT                   FFVPTHGEYRMLVKHAETAMSMGIPRENIVIIDNGDVVEVNRERIAITGRVPSGLQMIA
FT                   ASHDGVVMDEMLQERQQIAKDGMVTVVISLDGSGQLLCTPQVQTFGLAGEGNQLKGSDL
FT                   KPLLENTLRQAWPQFARSLERGSLDIDWAGLKGEVERVVRRFLREQLPGRPTVAVFVQS
FT                   PEEESVSSLGVETQPEPVAGALGRRRRSSAAVAAS"
FT   gene            complement(61302..62222)
FT                   /gene="dapA"
FT                   /locus_tag="CYB_0048"
FT   CDS_pept        complement(61302..62222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="CYB_0048"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by similarity to SP:Q04796; match to
FT                   protein family HMM PF00701; match to protein family HMM
FT                   TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01049"
FT                   /db_xref="GOA:Q2JQ67"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ67"
FT                   /protein_id="ABD01049.1"
FT                   /translation="MNFGRVLTAMVTPFTDEGELNYDEAARLADYLATHGSDGLVVCGT
FT                   TGESPTLTWQEEYELFRVVRDAVAGRAKVIAGTGSNSTREAIEATKKAAQLGLDGSLQV
FT                   VPYYNKPTQAGLYEHFKAIAQASDLPILLYNIPSRTGASLQPETVAQLAELETVVAIKE
FT                   ASGMMDVASEIRRLTPSRFAIYSGDDSLTLPLLSLGGSGVVSVASHLVGLQLQELIQSY
FT                   IRGQHDQALAHHLRLFPLFKVLFIETNPVPIKAALEMQGWRVGRARLPLAPLQPSSLQV
FT                   LRQVLEEMGLLAESKGSEQMATKVS"
FT   gene            62498..63124
FT                   /locus_tag="CYB_0049"
FT   CDS_pept        62498..63124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0049"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01050"
FT                   /db_xref="GOA:Q2JQ66"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ66"
FT                   /protein_id="ABD01050.1"
FT                   /translation="MDALTALKERISADKLDPSRRLSEAEIRELVAYATEAPSSFNIQH
FT                   WRFVAVTDPEDKERLKSLAYNQQKVADASVVFIILGDLRGYEKLPEIVQRSVAAGILPP
FT                   EKAEGWVNMAQATYLHNPTLARDEAIRSGAMAAMALMIAAQAKGLVSGPMIGFDPEGVK
FT                   REFGIADRYVPVMLLAVGYAAAGNLPRKPRLGVDEVLAFGRGREF"
FT   gene            complement(63176..64207)
FT                   /gene="trpD"
FT                   /locus_tag="CYB_0050"
FT   CDS_pept        complement(63176..64207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="CYB_0050"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by similarity to SP:P22096; match to
FT                   protein family HMM PF00591; match to protein family HMM
FT                   PF02885; match to protein family HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01051"
FT                   /db_xref="GOA:Q2JQ65"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ65"
FT                   /protein_id="ABD01051.1"
FT                   /translation="MTETADLWPQLLGQLLDRQSLSEAQAEQLMNGWLQNQVPDVVSGA
FT                   ILAALQAKGVSAGELAGMARVLQRASLGSPLDLSLLVDTCGTGGDGAGTFNISTAVAFV
FT                   VSAAGIPVVKHGNRSASGKVGSADVLEALGVNLGAEPERVRAAVAEVGITFLFAPQWHP
FT                   AMRAVIPYRRALKVRTIFNLLGPLVNPLYPNRQVIGVYAQELVPVMAEALRLLGREGAI
FT                   VLHSREGLDEAGLDQPTDLGILSGGLVRTEVLNPADYELTLAPTQALKGGDVAENAAIL
FT                   TQVLQGSGTPAQQDVVALNAALALQVAGVAPDWRAGIAQAREILARGAAWDRLQQLVHF
FT                   LKA"
FT   gene            64391..65770
FT                   /gene="gid"
FT                   /locus_tag="CYB_0051"
FT   CDS_pept        64391..65770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gid"
FT                   /locus_tag="CYB_0051"
FT                   /product="gid protein"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM TIGR00137"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01052"
FT                   /db_xref="GOA:Q2JQ64"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ64"
FT                   /protein_id="ABD01052.1"
FT                   /translation="MNPPTNPRACSPLARAGSFAPIHVVGGGLAGTEAAWQIAQAGLPV
FT                   ILSEMRPVRQSPAHHTDQLGELVCSNSFGAAASDRAAGLLKEELRQLGSLVIATADCHA
FT                   VPAGGALAVDRARFSQALTEAIQNHPRITLRREEVTEIPEGIAVLCTGPLTSDPLAKAL
FT                   QAFTGLEYLSFFDASSPIVTGDSLNRAVVFQASRYDKGEAAYLNCPMTEAEYERFWRAL
FT                   VEAEQAPLKDFEREERKFFEGCLPIEEMARRGKDTLCFGPLKPVGLVDPRTGSRPYAVV
FT                   QLRQEDKAGQLWNLVGFQTNLKWGEQQRVFRLIPGLEQAEFVRFGVMHRNTFLNSPQLL
FT                   WPTLQFRRRPTLFAAGQLVGTEGYACAVAGGWLAGQNAARLALGLPLITLPPETMMGSL
FT                   FQFISSADPRHFQPMPANFGLLPDLEGRKLRNKQERYGRYRDRALAALKTTGLVRQVQT
FT                   A"
FT   gene            complement(65862..66269)
FT                   /locus_tag="CYB_0052"
FT   CDS_pept        complement(65862..66269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0052"
FT                   /product="ISSoc13, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01053"
FT                   /db_xref="GOA:Q2JNN1"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN1"
FT                   /protein_id="ABD01053.1"
FT                   /translation="MGRSRGGYSTKIHVSVDGLGNPLELRITGGEKSDITQGEELIEGW
FT                   QRKDTKVIGDKGYDADKLIEKIGEAQAVIPPKRNRKTQRHYDKHLYQERHLIECFFHKL
FT                   KQYRHLCSRFDKLARNFLSFLYLVSALFWLK"
FT   gene            complement(66227..66604)
FT                   /locus_tag="CYB_0053"
FT   CDS_pept        complement(66227..66604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0053"
FT                   /product="ISSoc13, transposase orfA"
FT                   /note="identified by similarity to GB:CAD86359.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01054"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS2"
FT                   /protein_id="ABD01054.1"
FT                   /translation="MKLVFLDENKWQKILAFLQTEERVNIGKEANCKQFIEAVLWIARS
FT                   GAPWRYLPEGYGKWYTIYQRFHRWSRFGVWERMFKYFIDDPDLEHLIIDSTMVRAHSCA
FT                   AGKKGSKLWGEAEGDTAPRFM"
FT   gene            complement(66823..67761)
FT                   /locus_tag="CYB_0054"
FT   CDS_pept        complement(66823..67761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0054"
FT                   /product="phosphotransferase family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01055"
FT                   /db_xref="GOA:Q2JQ61"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ61"
FT                   /protein_id="ABD01055.1"
FT                   /translation="MGLIHQTWKLNTSEGSFIVQRLHPRFDPAVTEDGQAIGQWLRQHG
FT                   FPVPQFRRARDGSLHLSWAEGLWRVMDCLPGSCHPTPPNWGYLEEAGAAVGRLHRLLAQ
FT                   MDYRFRFQIPHFHDTAHLWQQLRQYEPAPEVQAEWQFLIETVPNLLLPSGIPTQIIHAD
FT                   LKFNNFLFDEQGRFVGLVDLDTFMYHNLYVELGDALRSWGKRGNTLQPEAILAGLRGYA
FT                   QTGNLHALQPELLLQGIQLITLELGMRFLQDWFEDAYWNWDPQRYPSRKAHNLARCQQQ
FT                   ICLYQDLTQRAPQLLESMRALLSCEQRKEGR"
FT   gene            68199..68468
FT                   /locus_tag="CYB_0055"
FT   CDS_pept        68199..68468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8Z0I8; match to
FT                   protein family HMM PF04025"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01056"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ60"
FT                   /protein_id="ABD01056.1"
FT                   /translation="MDTRLINIGFGNIVAAGRVVAIVSPESAPIKRIISDARERGQLID
FT                   ATYGRRTRAVIITDSGHVILSAIQPETVANRFLTAKPGLSEETE"
FT   gene            68551..69216
FT                   /locus_tag="CYB_0056"
FT   CDS_pept        68551..69216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0056"
FT                   /product="guanylate kinase, putative"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01057"
FT                   /db_xref="GOA:Q2JQ59"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ59"
FT                   /protein_id="ABD01057.1"
FT                   /translation="MRRSLSMPTSPTPVSSECTQQQGSLPAPTPRGRLVVLTGPSGVGK
FT                   GTLVNQLRQRHPELYLSVSVTTRPPRPSEQEGVNYYFRSREEFLNLIEANELLEWAQYA
FT                   GNFYGTPREIVFQKLNQGQDVLLEIELAGARQVRQQYPDAIRIFLCPPSLEELERRIRE
FT                   RGQDSEASIERRLEQARKELDAQDEFDYVIVNDNLEQALQELEALLYPPSPSSKEQQP"
FT   gene            69559..70017
FT                   /locus_tag="CYB_0057"
FT   CDS_pept        69559..70017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0057"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01058"
FT                   /db_xref="GOA:Q2JQ58"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ58"
FT                   /protein_id="ABD01058.1"
FT                   /translation="MLHTLSGQLGDRSPALIGIHCILELYDCPAKLLDDASLVQQALRE
FT                   AARRSNSTFLGELCHRFEPQGITALALLGESHISIHTWPEAGYAAVDVFTCGRHTRPEA
FT                   ACEYLIDVFQARRYSLRKVPRRTAQPTLLEEAPDSAEVLTCEATRRRR"
FT   gene            70137..71075
FT                   /gene="speE"
FT                   /locus_tag="CYB_0058"
FT   CDS_pept        70137..71075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="CYB_0058"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by similarity to SP:P09158; match to
FT                   protein family HMM PF01564"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01059"
FT                   /db_xref="GOA:Q2JQ57"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ57"
FT                   /protein_id="ABD01059.1"
FT                   /translation="MSSPRSFFWVQEYFTPWDYTARAVTRILAYRKTPFQEMLIAETGA
FT                   FGKGLMLDGHWQSTTVDEFLYHEALVHPAMVQVVQAGGIPRRVLVLGGAEGATLREVLR
FT                   WRSVEQVVMVDIDGEVVAACREHLPEMHQGSFEDPRVEVVIADALDFLQETGPIWDVIL
FT                   SDLSDPIESGPAYRLFTQEFFRQIRSKLQPDGAFTIQAGPTGPVELHQHTRIVRTLKTV
FT                   FAAVQPYAIYAPTYGGPLGFALAAQDPISPRPEPEQIDQILSQQLDPERGALQFIDGIT
FT                   LLGLYQVPAHLRRAIAAETVVYTLDNPPRIE"
FT   gene            71168..72319
FT                   /locus_tag="CYB_0060"
FT   CDS_pept        71168..72319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0060"
FT                   /product="putative UDP-sulfoquinovose synthase"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01060"
FT                   /db_xref="GOA:Q2JQ56"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ56"
FT                   /protein_id="ABD01060.1"
FT                   /translation="MKVLVIGGDGYCGWATALHLSNRGYEVAILDSYVRRLWDLQLGVS
FT                   TLTPIAQLEQRVDRWKGLTGKDIPIFVCDVTNYEALISCMRRFPPEAIVHFGEQRSAPY
FT                   SMISREHAVMTQVNNVVGTLNILYAIKEEFPDCHLVKLGTMGEYGTPNIDIEEGYITIE
FT                   HNGRKDTLPYPKQPGSMYHLSKVHDSHNIHFACRVWGLRATDLNQGVVYGVLTEETGMD
FT                   EVLINRLDYDGVFGTALNRFCIQAAVGHPLTVYGKGGQTRGFLDIRDTVRCVELAIAHP
FT                   AEPGQFRVMNQFTEQFSVEQLALLVQKAGATMGLKVEINHLENPRVELEEHYYNAKNTK
FT                   LLDLGLQPHYLSDSLLDSLLNFALKYKDRVDVRQILPKVKWKG"
FT   gene            complement(72316..73227)
FT                   /locus_tag="CYB_0059"
FT   CDS_pept        complement(72316..73227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0059"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01061"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ55"
FT                   /protein_id="ABD01061.1"
FT                   /translation="MLPVYYSDIFLSHDTGPFHPERPARLQSIVKALRGAPFANQLEWR
FT                   DPPLAELAELERVHSRQHIQQVAELATAGGGHIDADTALSERSFEAARLAVGAWVAGSA
FT                   SVLTTAQPALVLCRPPGHHAEPERAMGFCLFSNAAIAALWALDQPGVKRVAIFDWDVHH
FT                   GNGTQAVVERYPQLAYASIHQFPLYPGTGSARETGIHGNLCNVPLPAGSDWLAYKKALD
FT                   EKILPFLQAFQPDLLLVSAGFDCAKGDPLAGMQLEPEAFGRMARLCLEQVTRKTLFGLE
FT                   GGYNLDNLARGWLSLAQACLES"
FT   gene            complement(73285..73605)
FT                   /locus_tag="CYB_0061"
FT   CDS_pept        complement(73285..73605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ54"
FT                   /protein_id="ABD01062.1"
FT                   /translation="MEKMLVNIVEYLALGELETILSTEHPHQQVFYDAREREAMMQQIL
FT                   NRVPAIYMWLAADECPSRDQLNSSELELLRSVVRDVVNQKLQQASFGLDPYAGSMSEVF
FT                   YG"
FT   gene            complement(74202..74573)
FT                   /locus_tag="CYB_0062"
FT   CDS_pept        complement(74202..74573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0062"
FT                   /product="iojap-like protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01063"
FT                   /db_xref="GOA:Q2JQ53"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ53"
FT                   /protein_id="ABD01063.1"
FT                   /translation="MPAPAGDPIYCMALSAARAAEEKKGGDIVLLDVSQVSTLADYFLL
FT                   VSGYSLTQVRAIARAIEEKVWDEWKQTPRRIEGQESASWILIDYADLIVHVIMQQERDY
FT                   YDLESFWIQAQRVDLPIAG"
FT   gene            complement(74616..75209)
FT                   /locus_tag="CYB_0063"
FT   CDS_pept        complement(74616..75209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0063"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01064"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ52"
FT                   /protein_id="ABD01064.1"
FT                   /translation="MGTQLGREEVLAWLQERVSPPRLRHILGVEGMARQLAAHYGLDEQ
FT                   KAAWAGLMHDLAKAFPPEQLLQRVAQERELDEIERAEPHILHAEVGSLVAREQFQVQDP
FT                   EILAAIANHTLGQPGMDPLSCVVFVADALEPNRGSNPELERLRQMAFVDLSKTVVGVCD
FT                   LSLKFLLDRNQVVHPRTLMTRNHFLLHPLEKAVS"
FT   gene            complement(75214..77025)
FT                   /gene="lepA"
FT                   /locus_tag="CYB_0064"
FT   CDS_pept        complement(75214..77025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="CYB_0064"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01065"
FT                   /db_xref="GOA:Q2JQ51"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ51"
FT                   /protein_id="ABD01065.1"
FT                   /translation="MTGVPVSRIRNFSIIAHIDHGKSTLADRLLQETGTVSAREMRPQL
FT                   LDSMELERERGITIKLQAARMNYRAQDGQDYVLNLIDTPGHVDFTYEVSRSLAACEGAL
FT                   LVVDASQGVEAQTLANVYLALENNLEIIPVINKIDLPGAEPERVIAEIEQVIGLDCSGA
FT                   ILASAKVGIGIQEILEAVVQRVPPPRDTVAEPLRALIFDSYYDAYRGVIVYVRIMDGEV
FT                   KTGDKICFMASGREYEITELGVMRPNQEPVDALHAGEVGYMAAAIKSVEHARVGDTITL
FT                   VNRKAPEPLPGYKEAKPMVFCGLFPSSSDQYAELKEALEKLKLNDAALYFEPEISSAMG
FT                   FGFRCGFLGLLHMEVVQERLEREYNLDLVITAPTVVYQVTLNNGSVIRVDNPSKLPPPN
FT                   ERTSIEEPIVRVEVILPEEFVGTVMELCETKRGTFKDMKYLAQGRTTLVYELPLAEVVT
FT                   DFFDQLKSRTRGYASMDYQMIGYRADDLVRLDILINGDVVDSLSTIVHRDKAFYVGRSL
FT                   VAKLRELIPRHQFEVPIQAAIGSKVIARETIPALRKNVLAKCYGGDVTRKRKLLEKQKE
FT                   GKKRMKAVGTVDVPQEAFMAVLKLQND"
FT   gene            complement(77357..77884)
FT                   /locus_tag="CYB_0065"
FT   CDS_pept        complement(77357..77884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC08349.1; match to
FT                   protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01066"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ50"
FT                   /protein_id="ABD01066.1"
FT                   /translation="MFYHHPVTRVSIFIDGNNMFYAQQKNGWFFDPRRVLDYFVRSQPN
FT                   VELVNAFWYTGIKDPHDQRAFRDALISMGFTVRTKILKEYRDEDSGRYSQKANLDIEIV
FT                   IDMFNTVGQYDRIILFSGDGDFERAVELLRSKNTLITVVSTEGMIARELRNATDRYIDL
FT                   NDIRPYIEKLDK"
FT   gene            complement(78035..79021)
FT                   /gene="glyQ"
FT                   /locus_tag="CYB_0066"
FT   CDS_pept        complement(78035..79021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="CYB_0066"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01067"
FT                   /db_xref="GOA:Q2JQ49"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ49"
FT                   /protein_id="ABD01067.1"
FT                   /translation="MSAHTFQDLIFRLQQFWGEQGCLILQPYDLEKGAGTMSPHTFLRA
FT                   LGPDPWRVAYVEPCRRPTDGRYGQNPNRLQHYFQYQVLIKPSPDDIQDVYLDSLQALGV
FT                   NPAEHDVRFVEDDWESPTLGAWGVGWEVWLDGMEVTQFTYFQQVGGQDCRPVSVEITYG
FT                   LERLAMYLQGVDSVFDLCWNEHPSLGRITYGQIYFQNEVEQSYYNFEYSDPEMLLELFR
FT                   LYEAEAKRLIETTQQKLQKQVLPDRLAVSLLLPAYDYVLKCSHTFNLLDARGVIAVAER
FT                   TLYIGRIRNLARQLAELYVSQADRPGSSYALRQPEPALVYRGASPQS"
FT   gene            complement(79074..79838)
FT                   /locus_tag="CYB_0067"
FT   CDS_pept        complement(79074..79838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0067"
FT                   /product="peptidase, T1 family"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01068"
FT                   /db_xref="GOA:Q2JQ48"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ48"
FT                   /protein_id="ABD01068.1"
FT                   /translation="MTYCLGIITRFGLVMAADSRTNAGVDYVSTYQKLFDFSVPEERVI
FT                   LICTSGNLSITQGVLTEVQRDLRQQESSNLHTFPHLYDVARYLGSKIRYIQEQDRPWLE
FT                   KDGIDAQCSLLLGGQIRGEEPALFLIYSQGNCIQATPETPFLQVGETKYGKPILDRTLS
FT                   YETSLADAAKCALLSIDSTMKSNISVGPPIDLVMVQADQFKVTHRLRLRTGDPYLAKMR
FT                   KLWESALKQAFDQMPPIEWDYSDPADREELLD"
FT   gene            complement(79887..81374)
FT                   /locus_tag="CYB_0068"
FT   CDS_pept        complement(79887..81374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0068"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01069"
FT                   /db_xref="GOA:Q2JQ47"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ47"
FT                   /protein_id="ABD01069.1"
FT                   /translation="MGKPADPESKVESFKGCFLPLLSATAMARRNTLQDDLNYQQAKRS
FT                   LRQWVAQLDLRPQEVAGLEGELESLQALLDKLETEVIHIAAFGLVGRGKSSLLNALLGE
FT                   PVFETGPTHGITRTQQAATWNISWETRPQSSFSGTSLKGSRLPPSSVQSVQVAHWQGSR
FT                   LELIDTPGLDEVDGEERARLAREVAQRADLILFVVCGDLTRVEFEALATLREAGKPMLL
FT                   VFNKIDQYPEADRQAIYDKIRNERVRQLLSPNEIVMVAASPRVPRLVQRPDGSFAAQME
FT                   VGSPQVDELRLKILEVLHREGRSLLALNALLFADRVNQQVIERKLQTRAQQAQDLIASA
FT                   ARTKALAVALNPITLLDTLGGLAIDVTLILRLARLYGWPMSTAGATQLLQKIILSMLSL
FT                   GAGEWVALLGLGSLKTLLGGFSLGAYGSVALTQAVLAGFSCYAIGESARRYLAQGASWG
FT                   PEGPKAAIAQILADLDEASITARLREEIRHKIGFAFP"
FT   gene            81528..81812
FT                   /locus_tag="CYB_0069"
FT   CDS_pept        81528..81812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:S77173; match to
FT                   protein family HMM PF04248"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01070"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ46"
FT                   /protein_id="ABD01070.1"
FT                   /translation="MPRAIWNGVVVAETERYETVEGNIYFPPESLRREYFQPSSTHTTC
FT                   PWKGEASYYTLVVNGQENKDAAWYYPDPKPAAANIRGYVAFWKGVKVEP"
FT   gene            81871..82455
FT                   /locus_tag="CYB_0070"
FT   CDS_pept        81871..82455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0070"
FT                   /product="WD40-like beta propeller repeat protein"
FT                   /note="identified by match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01071"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ45"
FT                   /protein_id="ABD01071.1"
FT                   /translation="MLTNGRILFGAARWARKLGLAGLSLVLLGCSPAGFRTPRPSLTNS
FT                   GLNSIFPDGEPAFNGDGRYLVFSSARSGSQDIFLYDTVERRLVDLPGLNSSDVAATSPD
FT                   ISADGRYIVYVSNALGKSEIFLYDRETRRIENISSRVPGDVRNPTISGDGRFIAFESNG
FT                   QGQWHIEIFDRGPAASTRPTSLSSPTSGDNP"
FT   gene            82505..83689
FT                   /locus_tag="CYB_0071"
FT   CDS_pept        82505..83689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0071"
FT                   /product="aminotransferase, classes I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01072"
FT                   /db_xref="GOA:Q2JQ44"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ44"
FT                   /protein_id="ABD01072.1"
FT                   /translation="MSIPLAQRLQPLGGNVFDQMDQAKREARRSGLDVIDLSLGSSDLP
FT                   PPSDSLAAIQSALSDPSTYGYTLFHDTADFRSACAKWYRGKFGLEIDPETEVLPLIGSQ
FT                   QGTALLPLALLNPGDVALVADPAYPSHVGGIHLAGGIPYYLPLRAENRFLPQWDRIPEA
FT                   ICRQARLLVLNYPHNPTTATVTPEFWQETLQFCQQYDIVLAHDFPYVDWRFDGQVAPSA
FT                   LQADPDKTRTIEFFSLSKSYHMGGFRVAYAIGSRELIRALRWVKSTIDFHQYQGILRGA
FT                   AAALTVPDSFLQRWRQVYRERRDIAVAALHRMGWPVPLPEATMYLWAPLPEFYRGSSAQ
FT                   FCLDLVRATGVALSPGSGFGPSGEGYVRFALVVEGSRLEEAVGRIEAFLSRCIS"
FT   gene            83850..84548
FT                   /locus_tag="CYB_0072"
FT   CDS_pept        83850..84548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0072"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01073"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ43"
FT                   /protein_id="ABD01073.1"
FT                   /translation="MGVALLSRAGRPFFYRSFQDLDSRQQQALTEGLFQVLQTMPPGLD
FT                   YFDFQFAEQRVFVYPLGPEWALLVAVNDELVMPVYTLAVNRLRAELQQDTPKGLATFRL
FT                   FTSQAEAGRNATQPSSAPAAGPRMEMDVFVQSLNRLCQITTGYLGKAVIVNYWKAARQE
FT                   VVERQGSKAEWLNQFEIERSGQIHYRGSLKELDESQQRVLRDWVLAFFRRCEEVIHDFR
FT                   NLIKSTELGL"
FT   gene            84796..86109
FT                   /gene="hisD"
FT                   /locus_tag="CYB_0073"
FT   CDS_pept        84796..86109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="CYB_0073"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by similarity to SP:O34651; match to
FT                   protein family HMM PF00815; match to protein family HMM
FT                   TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01074"
FT                   /db_xref="GOA:Q2JQ42"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ42"
FT                   /protein_id="ABD01074.1"
FT                   /translation="MLRIVTQLAEAEAELRRISERTQADQNLHREATVREILQAVRRQG
FT                   DRALLTYTAEFDQVELSVAELKVSGAELEAAYQAVSPQLLSALRLAKQRIEAFHRQRVP
FT                   SSWVSFPGPEIVLGKQYRPVDRAGLYIPGGRAAYPSTVLMNAIPAQVAGVPEIVMVTPP
FT                   GSDGLGGKGISPAILVAAQEVGIHTIYRVGGAQAIGALAYGTETIPKVDVITGPGNIYV
FT                   TLAKKLVYGTVGIDSLAGPSEVLIIADESANPLYVAADLLAQAEHDPLAAAILLTTDLQ
FT                   LAQQVQQAVATQMEAHPNRLMVEKSVVNYGLIAVVPDLTAAVALSNLFAPEHLELQVAD
FT                   PWALLDPIRHAGAIFLGHHTPEAVGDYLAGPNHTLPTAGAARYASALGVETFLKHSSLI
FT                   QYSSAALREVASAIQALTQAEGLPAHGQSVQVRLAEER"
FT   gene            86288..87061
FT                   /locus_tag="CYB_0074"
FT   CDS_pept        86288..87061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0074"
FT                   /product="ISSoc11, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01385"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01075"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ41"
FT                   /protein_id="ABD01075.1"
FT                   /translation="MRTAYQYRLRPTSSQVALMDQWLDLLRKQYNYRLAERFAWWQHNR
FT                   CDSNACPLICHLPELKDNPDFYSQKRDLVKMKALFPQYRAVHSQVLQNCIERVHKAFDR
FT                   WLKGDGSGKRAGKPRFKGVGRYRSFSFPQMKQDCICGQFIHLPKIGAVRIIQHRPLPEG
FT                   FVIKTAAISRKADGWYVTLSLQDSSVPVFTPDPPTLENTMGIDVGLDSFLVTDAGESVP
FT                   VPQYYRKAELRLKRLQRALSREKKGSNRLWLVTSG"
FT   gene            87267..87530
FT                   /locus_tag="CYB_0075"
FT   CDS_pept        87267..87530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0075"
FT                   /product="ISSoc11, transposase orfB"
FT                   /note="identified by match to protein family HMM PF07282"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01076"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ40"
FT                   /protein_id="ABD01076.1"
FT                   /translation="MLAVKAERAGLRAIAVNPNGSSQNCSRCGQRVPKAVQDRWHSCSH
FT                   CGLELERDHHAAINIKHRAVGHPVLFASAGRSPQAQETSFSR"
FT   gene            87777..90329
FT                   /locus_tag="CYB_0076"
FT   CDS_pept        87777..90329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89235.1; match to
FT                   protein family HMM PF02638"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01077"
FT                   /db_xref="GOA:Q2JQ39"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ39"
FT                   /protein_id="ABD01077.1"
FT                   /translation="MLLAVRFPSPLAGRSPQAGWSGMVRDRFWGFILRSFKPLAVCLGF
FT                   LWVGLLVWTGSPVAHGQSAVPAAEHFLTVVRLPGQNWANIERQLQQSGLSYQVIDGIEP
FT                   AGLRGRSTVFLPNVNRLTVAQAHALAEWMQQEGGQLIVSGPLEIPAEARDPLRSLIGAY
FT                   WSGDIPLASTVRLTEFAEAWARSVQAADRASGAEHFVVAGGALLPTGPESRLVAVWEEV
FT                   DMGDNAYAVIASRQSVYLGWRWGEFPEETAQLDREWLQAALRRAQGRFAALRQAAATPS
FT                   PLPAVRSTINTLELLAMRQELGSLLGRVEGSLLLARATQGGVEAAEYKPILEQARSVLQ
FT                   QLPAWVEAGQYEQARQAFEQARADLWAHYPVDRLTALSEVRAIWLDRSTIVEAGSEAGL
FT                   AQIFDRLAQAGLNTVFFETMNAGFAIHPSRVAPQQNPLTRGRDPLRAAVRLAHERGLEL
FT                   HAWIWTLAVGNTRHNLLPEINLPQDYIGPVLTAHPDWANLDNRGRLFPRGQPETWLDPA
FT                   NPQVRSYLLALTRELVQDYQVDGIHLDYIRYPFQNAASRQVFGFGRAARQGFQQLSGVD
FT                   PLELDPLRDRSLWQLWTRYRTQQVNEVVEAIARTARSLNPRVILSAAVYALPKQERLQR
FT                   LQQNWEEWIQAGELDLLIPLTYAGNTRRLAQLVQPNLEIVSRFSTLFVPSLNLLNLPPV
FT                   EFLDQLQVVRDLPTGGFALFSVRQLTPELEAILRSSAIASTRIPYRDPFGAVRDRFQAL
FT                   RQEWMFLLEQKRLGLWEHSQWMEQIERVQGSLAALAADPTPEALEQARQQLGNLKTNLA
FT                   TWMRLESLRNPYRVQVWGNRLAALEMMLRYGEQTLMRA"
FT   gene            complement(90396..90809)
FT                   /locus_tag="CYB_0077"
FT   CDS_pept        complement(90396..90809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0077"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01078"
FT                   /db_xref="GOA:Q2JQ38"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ38"
FT                   /protein_id="ABD01078.1"
FT                   /translation="MTIDNNLLWVLVGTAGLSLLSLVYVLVDEGNKRRRYEQQKEKEAA
FT                   QPPAVVPAEEAGIPAAPPPSAPEPVAAQPASAPHTADGFPEASRSDDEEPETSPEAVRA
FT                   SRTESLPSPEDSALPKEPDTGPDPAEEMPKDTP"
FT   gene            90876..91556
FT                   /locus_tag="CYB_0078"
FT   CDS_pept        90876..91556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0078"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01079"
FT                   /db_xref="GOA:Q2JQ37"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ37"
FT                   /protein_id="ABD01079.1"
FT                   /translation="MKPLCQIFLPNLKDWKGWVHSFVVLCVMRYLKFYKPYGVLTQFTD
FT                   REGRPTLQSFIPVPRVYPVGRLDRDSEGLLLLTDDGRLNARLIDPKFGHERIYWVQVEG
FT                   IPTPQALQQLQQGLIIQGRKTRPAQVKVLAEEPTLPPRDPPIRFRRSIPTTWLELTLRE
FT                   GRNRQVRRMTAAVGIPTLRLVRVGLGPLSLAGLAPGQWQDLSEVELAQLRQYCFSQTIR
FT                   VISS"
FT   gene            complement(91835..93184)
FT                   /gene="purA"
FT                   /locus_tag="CYB_0079"
FT   CDS_pept        complement(91835..93184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="CYB_0079"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01080"
FT                   /db_xref="GOA:Q2JQ36"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ36"
FT                   /protein_id="ABD01080.1"
FT                   /translation="MANVVVVGAQWGDEGKGKITDLLSEKAHVVVRYQGGVNAGHTLVV
FT                   GGQTFKLHLIPSGILYPDKRCIIASGTVIDPEVLLAEIDQLHQLGISTDNLFIAETAHV
FT                   TLPYHRVIDIAEEERRGIYRLGTTGRGIGPTYADKAERMGIRVVDLMYPDQLRERLSWA
FT                   IPYKNVLLEKIYNLPPLDPEPIIEQYLAYAERLRPYVTDAALLLTQAIEDRENILFEGA
FT                   QGTLLDLDYGTYPYVTSSHPIAGGACIGAGIGPTSIDRVIGVAKAYTTRVGEGPFPTEL
FT                   KDEIGAYLGATGAEFGTTTGRQRRCGWFDGVIGRYAVRINGLDCLAITKLDVLDGLDEI
FT                   KVCVAYEYQGREIRHFPSDARVFAQCKPIYETLPGWKCSTKDCRSIQDLPPEAHDYLKF
FT                   LAQLMQVPIAIVSLGASRDQTIIVEDPIHGPKRALLYPNGGKRAHALMPD"
FT   gene            complement(93396..94895)
FT                   /locus_tag="CYB_0080"
FT   CDS_pept        complement(93396..94895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0080"
FT                   /product="peptidase family S41, nonpeptidase-like protein"
FT                   /note="identified by match to protein family HMM PF03572"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01081"
FT                   /db_xref="GOA:Q2JQ35"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ35"
FT                   /protein_id="ABD01081.1"
FT                   /translation="MKGFARVLGAWGILTLIAGISPGSAVGQSALPPVPIMPSDPQGSF
FT                   PDPGIPAAPSPPREPVGLDLRHLVGLFINESLGAGNQAAAVSYNDLYTRLLARSYGDPR
FT                   PPIEVEYEFIQEILREYGDPADRFWDPQAFKDLLNRPRPPVQARGIGPRQVYLAVPDLT
FT                   PATAQQIRQTLYTQDYSQGIVLDLRGSVGYNPQVVADVARLFLPRSVQPLLITEDRFGQ
FT                   PTLWNSENLPIAAGIPLAVLVDGNTRQGATLLAAQLGSSGSTLILGQPTQGSERQTRFF
FT                   ALPSGAAVELAVATWKTGDGRSLERGLVPLQTVEGDDNAWLNAGLQALALPPRRPTLPP
FT                   RPTVLVQEGRVGRFELGMDTRNVDTHLLGNVDQIPAASGANVFQPNSDLKIFYLQDYIL
FT                   FTYRHPGIVDSFFANRIYTTHPEAMTGEGIRIGSTYSEVIAVYGGPGENGYNEVVPYPK
FT                   GSREYLRDDRYYVNYDALGLAFAFEVGSNQVTAIGLFKPGS"
FT   gene            95176..96330
FT                   /locus_tag="CYB_0081"
FT   CDS_pept        95176..96330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0081"
FT                   /product="ISSoc8, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01082"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ34"
FT                   /protein_id="ABD01082.1"
FT                   /translation="MSQTISVRCKLIVPQELRQEIDRTLQGFANACNQILDTAKQKNCW
FT                   NTAKLHHLVYRPVRAATGLKANHVCQALRRVISNAKAVKQVHKFRPTSLTLDARTFKYR
FT                   ESDQAVGVTLMSGRVWLKLKIGGYQIALLRGQTPTSATLSKTKQGDYYINIAVELDTPL
FT                   TGKTPKVIGVDLGRRDIATASNGRSWSGEHIQAVRDRFSRVRAKVQSKRTRSSRRLLRR
FT                   LSGRERRYQTWLNHNISKTLVRDAQAIGAALAFEDLTGIRDCLNQKSRSKAERRRTNNW
FT                   AFYQLRMFVAYKAAIAGVPVVLVPPAYTSQTCHKCLHIHPERGKSYRNGKSFKCGHCGW
FT                   EGDADHNAAQVISLLGATVNSPEIPKLSCPLGPLGIGIKPAPCA"
FT   gene            complement(96348..98018)
FT                   /gene="tig"
FT                   /locus_tag="CYB_0082"
FT   CDS_pept        complement(96348..98018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="CYB_0082"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P80698; match to
FT                   protein family HMM PF00254; match to protein family HMM
FT                   PF05697; match to protein family HMM PF05698; match to
FT                   protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01083"
FT                   /db_xref="GOA:Q2JQ33"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ33"
FT                   /protein_id="ABD01083.1"
FT                   /translation="MQVTQEKRPGSRVGLKIVVEADRVKRSYEKTLRQLEQNIQIPGFR
FT                   KGKAPRNLVVRQVGRERILASAVDDLINEAIQQAFKEAQLTPISRFELDDEVGQLLAQF
FT                   NPEADFSFSGYVEVYPEARVGQYKGLTVTATRVDVKPEQIDQLIDRWRDQRATLLPVED
FT                   RPAQLGDVVVIDFAARDAEGNPLDEMTTQDFQLELKEDNFIPGFVAGIVGMQLDETKEI
FT                   AATFPDDYFRKELAGKTVTFIVCLREIKAKELPELDDAFVQEISSFQTVAELREHLQKR
FT                   LEQDALRQSEENLETAILNAILETTEVDLPETLIEQETTQLLAQSLQALRQEGIKPGEL
FT                   RKFLSELPPETLNQLKERHRPEAIDRLRRTLALSAIVRQEQIAVGSTELDVEVEEVMAA
FT                   YAQQGQKLDRERVRQAVYESLLTNKVMAWLKSQTTVNWVDSEGNPTQAPTSLAGSEEKV
FT                   EVPEAEFEADEPEAEVSGIPEAVESSSETATGAETDGEAAAAEAEPATEKAVEASPAET
FT                   VSASAAEATLPVEEKAAETATEIPAAEKPKPSKKDKKGK"
FT   gene            complement(98090..98473)
FT                   /locus_tag="CYB_0083"
FT   CDS_pept        complement(98090..98473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01084"
FT                   /db_xref="GOA:Q2JQ32"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ32"
FT                   /protein_id="ABD01084.1"
FT                   /translation="MRLFNYLILFSALLAIALFAMQNATPVTVTFAPGVSVESPLVMEL
FT                   LASAGIGAALAWLYSLWMRVQFSIEAREKNRQLQEKEVTITELKEMVVELEAKVKQLPP
FT                   SKRAEPQEDIQDVKEVATEGSPA"
FT   gene            complement(98558..99610)
FT                   /locus_tag="CYB_0084"
FT   CDS_pept        complement(98558..99610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0084"
FT                   /product="cytochrome c assembly protein"
FT                   /note="identified by match to protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01085"
FT                   /db_xref="GOA:Q2JQ31"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ31"
FT                   /protein_id="ABD01085.1"
FT                   /translation="MALLAITALAGMDLAQWQALLNNVAFAISLGAMLFYWGGAAFPQM
FT                   QLLAELGLAGMIGANLTMAALLTARWIDAGYFPLSNLYESLFFLAWGITALHLLALHWS
FT                   RSRWVGVMTAPVVTGIVAFAALVLPEDMQVAQPLVPALQSNWLMMHVTVMLLAYAALLV
FT                   GSLLSISFLIVTRGQEVHLKGNSLGLQFRPPQPQTHPEWAEATLPSPASELAYAGLRSP
FT                   RPAPSSAELPPQPAPEGIPWQRLSLAEILDNTSYRLIGLGFPLLTIGIIAGAVWANEAW
FT                   GTYWSWDPKETWALITWLVFAAYLHARITKGWQGRRPALLASLGFGVVWVCYLGVNFLG
FT                   KGLHSYGWFF"
FT   gene            99710..101248
FT                   /locus_tag="CYB_0085"
FT   CDS_pept        99710..101248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ30"
FT                   /protein_id="ABD01086.1"
FT                   /translation="MWGWLVCGSAGYKEHWDVRLMQEHAGNARLRRWGLLRWWICLLTA
FT                   LVLASCGGSPPKPPQEQLPQLERVPVPPEIAKLDAHLQYCRPQVQILSPKPGEVLPERQ
FT                   VTVRFAVQGYPLFKDPQLGLGPHLHVVLDNRPYIAHYDADAPLVFKDLEPGSHTLRVFA
FT                   GKPWHESFKNSEAYAQVSFHVLAPTPEYVPQPQLPLLTYNRPTGSYGAEPILVDFWLAN
FT                   APVRESLLSDLPRDWRIRYTLNGQSGLLDRWESFYLKGFRPGRNVMVLELVDSKGDPIR
FT                   NVFNSAAREITYTPGGQDTLSKLVRGELKAEEALAIVQPQPTPTPTPTPEPTPTPEPTP
FT                   TPTPTPTPTPTPTPTPTPTPAPTPTPTPSPTPTPTPTPTPTPSPTPTPTPTPTPTPSPT
FT                   PTPTPTPTPTPEATPTLAPRRQPRFQLGRPRPTPEGIPAVPTPPPVVATPEPELTPEPS
FT                   PEPSPQAVPTSTPQPVATPLPRVTPIPFQERRVRQQGLRLFPPGLHSPALPGEQ"
FT   gene            complement(101494..102624)
FT                   /locus_tag="CYB_0086"
FT   CDS_pept        complement(101494..102624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0086"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01087"
FT                   /db_xref="GOA:Q2JQ29"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ29"
FT                   /protein_id="ABD01087.1"
FT                   /translation="MTFAQWLGLGALLGLLVLLWQIRQILLLVFAAIVLAVALDTLAQI
FT                   PQRYGFRRGPSIVITSLTVLVAAILVGLIVVPPLAEQLRWLFTDGVPAGIVQAQRLFES
FT                   LILSLPTDIELPTLRELANSLVPQATELVRQVRDFFSESFTAFFGTLLNLLFVIILTIL
FT                   LLADPQAYSRAFVSVFPAFYRPRIRYILKRCELALRGWLMGILFTSTLVMLLSGIGLWI
FT                   LGVPLILANAVLAGLFNFIPNIGPTLSVVAPMLVALTDAPWKSLAVLGLYILIQQLESS
FT                   VFTPIVMSRQVSLLPALTLVAQVTSAFFFGVLGLFLAVPLAAILQVWIQEVLIRDVLDP
FT                   WQGSRLRPLLRLESGENGIQSSTQDPIPPPQSVRDG"
FT   gene            102812..104029
FT                   /locus_tag="CYB_0087"
FT   CDS_pept        102812..104029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0087"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01088"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ28"
FT                   /protein_id="ABD01088.1"
FT                   /translation="MSQVLTISCKLKVSPSQAAKLDATMDAFVQALNWVNQNTPEKVVN
FT                   AVKLQSLCYYEIRARFGLSSNLARTTSRLRDQQVCRRVAGSRKVAKQKKRPVKEFKSGF
FT                   VTYDARIFSFRQKDWTVSLTTVEGRERFELAIGNYQRGMLAGSNPKSATLVKRKDGSYY
FT                   IQICVEKKPPKQQDTDKVIGVDLGRIDIAHTSEGKNWNGQQLNKVRDHYSRLRAVLQRK
FT                   ASKGTRSSRRRCRQLLQRLSGKERRFQTWVNHRISKAIVSRAKTTNSAIALEDLTGIRE
FT                   RVNQQPRSKAERRRTNNWAFYQLRMFVVYKAAIAGVSVVLVPPAYTSQTCHRCLHIHPD
FT                   PTQSYRSGKQFKCGHCGWEGDADWNGANMIAKLGAAVNRPRGPWLACQLQGYRKPALYC
FT                   EVVRVG"
FT   gene            104064..105293
FT                   /gene="xseA"
FT                   /locus_tag="CYB_0088"
FT   CDS_pept        104064..105293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="CYB_0088"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01089"
FT                   /db_xref="GOA:Q2JQ27"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ27"
FT                   /protein_id="ABD01089.1"
FT                   /translation="MEFLLTDEAPLLSVGGVSRYLKSLLAGDPYLARLWVSGEVSSCQR
FT                   NRNGHLFLTLTDPETGDVLKGVVWQSQTSRLSFWPEVGQQVLALGQLGIYSGGSHYRLV
FT                   IWQLLPAGEGLLALRFQQLKARLSAEGLFDNQRPLPVHPQCIAVVSSPHAAGWGDIRRT
FT                   LNQRYPGLRVLFSPAQVQGEAAPESIVRAIRRVEQDGRAEVLLLARGGGASEDLACFND
FT                   ERVVRAIAECRIPVVTGIGHQRDETLADYAADYAAHTPTAAAERIVPDLGELQRQGSQL
FT                   RQKLIERTRQALERAQQRLQQAQHHLAYVHPERLLQQAQDRLTQHQHRLLQAVRHRFQQ
FT                   RQQHQQALQDRLQALDPEAILKRGYALVRDEEGSLIRTHRLPPQTRLMIQLASGSLWVR
FT                   VEESHEPPQT"
FT   gene            105274..105510
FT                   /gene="xseB"
FT                   /locus_tag="CYB_0089"
FT   CDS_pept        105274..105510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="CYB_0089"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by similarity to SP:P22938"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01090"
FT                   /db_xref="GOA:Q2JQ26"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ26"
FT                   /protein_id="ABD01090.1"
FT                   /translation="MSRRKREEPWRYEAAIAEVETLIAQIESGELDLAEVVERFQQAAQ
FT                   TLKTCADFLEQKRQQVEIIIEQLGQEEEDLPES"
FT   gene            105603..106484
FT                   /gene="folD"
FT                   /locus_tag="CYB_0090"
FT   CDS_pept        105603..106484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="CYB_0090"
FT                   /product="FolD bifunctional protein"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by similarity to SP:P54382; match to
FT                   protein family HMM PF00763; match to protein family HMM
FT                   PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01091"
FT                   /db_xref="GOA:Q2JQ25"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JQ25"
FT                   /protein_id="ABD01091.1"
FT                   /translation="MPAKILDGKALAARLQAEMAAQVQAWIPQVGRPPGLAVLRVGEDP
FT                   ASAAYVRGKERACERLGIASFGRHFSAQDSPAHLLDTIDQLNQDERVDGILVQLPLPPG
FT                   WDPIPPLLAINPDKDVDGLHPLNLGRLLRGEPGLRSCTPLGVMRLLQAEGIPIAGRKAV
FT                   VVGRSILVGKPLSLMLLAADATVTLAHSRTPDLAEVTRAADIVVMAVGRPRLLRADMVK
FT                   PGAVVIDVGINRIETPTGAEQLVGDVDYEAVKELAAAITPVPGGVGPMTVTMLLANTLQ
FT                   SYKLRSHLCSHY"
FT   gene            complement(107027..107731)
FT                   /locus_tag="CYB_0091"
FT   CDS_pept        complement(107027..107731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0091"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AH2164"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01092"
FT                   /db_xref="GOA:Q2JQ24"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ24"
FT                   /protein_id="ABD01092.1"
FT                   /translation="MFCTVGALSSDGTLYAYGWSIRGRAAVDAFCLTRHVSLWLAVVSM
FT                   CVLICSFAQAVASFFAGGPLLNRALRGKGSLVLSVALVGVGVLVQGLRAQTLEKPMLEA
FT                   LEDSVEGNVVPVLHSEPALPPQAVPTSARTGPFRVGNRTPHPVRLVILMRSGERMINPE
FT                   TAHWDFAPGEGGSEGLLLSLGEEPLQIGPGDIVVAFALDGTRRYWGPNVVGESLAPFWD
FT                   GESGSWSMILQP"
FT   gene            complement(107841..108458)
FT                   /locus_tag="CYB_0092"
FT   CDS_pept        complement(107841..108458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0092"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /note="identified by similarity to SP:Q51521; match to
FT                   protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01093"
FT                   /db_xref="GOA:Q2JQ23"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024015"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ23"
FT                   /protein_id="ABD01093.1"
FT                   /translation="MKDPKGNSTADPSWRALIQAALHRNRSDPSVRYLQLATVDPQGHP
FT                   RNRTVVFRGFLGDTDRIQLAVDSRSEKIRQIAHCPQAQICWYFCKTREQFRIAGTLEAI
FT                   AADHPDPQAQRQRQQLWQQISEKGRLLWFWPEPKGPLAPPEAFIQELPKEKDLLPPQTF
FT                   VALLLEPTEVDHLQLKGDQIYPQLRTVYERTSKGWQRRAVNP"
FT   gene            complement(108515..109690)
FT                   /locus_tag="CYB_0093"
FT   CDS_pept        complement(108515..109690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0093"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01094"
FT                   /db_xref="GOA:Q2JQ22"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ22"
FT                   /protein_id="ABD01094.1"
FT                   /translation="MEEILAQAFDEEYSSRSVDIRRQVRRLRQWYGPLKTLTLFPNRFQ
FT                   HMFTVHVAELEGKIQGVIQVSPFNHSRSTWRVDHIAVAPSAQRQGVGSRLLKHCMEHFR
FT                   EARTWILEVNIHNKGAMALYRRNGFQPLAQITYWSIPADILAALSQHEPKLPNLVPVTN
FT                   RDAYAIYQLDTGSMPATVRQVYDREVNDFRTSPLDWLLEQAKCAISQTERVEVCVYEPE
FT                   RKTAIGYFNLKLDRTGQQPHVAKLTVHPAYTWLYPELMAKMAQLTQAHPPQSLALASTD
FT                   YQPEREEFLLKLGAQDVERTLLMSRSVWHKIRESRLFTWDSAYLNAMLRGLQVKQPVPE
FT                   RFEGPPEGWVEHHFHPISPTEPDPSSGRISGVESSPGLSRDSQSEASPPPS"
FT   gene            complement(110017..110670)
FT                   /locus_tag="CYB_0094"
FT   CDS_pept        complement(110017..110670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AC2428"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01095"
FT                   /db_xref="InterPro:IPR021809"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ21"
FT                   /protein_id="ABD01095.1"
FT                   /translation="MIATQVSAQELFRAAYENRYTWDPAFPGYSAEVTYWDGERTFVGQ
FT                   VRVGADLKATVTGVEDEEARKAIHNQLWEIAIHRVRRSFDETHGNNTFRYGQTLPDGTV
FT                   EILVGGKAEGDRYHVRDNQVTMVHRHIHGVVVTIHTFSSHDTGEGYLSHRYDSVYHDPQ
FT                   TGEQKGGRSQFEDLYTKVGKYYILSERRIQTETETGPVEKRFTFSNLTLLDTGA"
FT   gene            110944..112338
FT                   /gene="murA"
FT                   /locus_tag="CYB_0095"
FT   CDS_pept        110944..112338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="CYB_0095"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01096"
FT                   /db_xref="GOA:Q2JQ20"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ20"
FT                   /protein_id="ABD01096.1"
FT                   /translation="MKGFDNRVSGADPLEPGLTPPQTGMATAPEMMGPVLKIIGKQTLS
FT                   GHIPIGGAKNSALALMAGAILAPEACRIHNVPRLLDIERMGQILATLGVKVSHVGNTLD
FT                   LDASSLKTSQAPYELVSQLRASFFIIGPLLARLGVARVPLPGGCAIGSRPVDLHVRGLQ
FT                   ALGATVQIEHGVVHAYARKLLGTRIYLDYPSVGATETLMMAATLADGETVIENAAQEPE
FT                   VADLARFCQAMGARIRGVGTNTVVVVGVPRLHGTEYTVIPDRIEASTYLIAGAITRSHL
FT                   TVGPVIPDHLRAVIAKLQAMGLRVEEEGPNRLRIAPAQLSSGWLCQATDIQTLPYPGFP
FT                   TDVQAPIMALAALSEGSCTIEETVFENRMHHIPELNRMGADIRLKNRVALIRGVPSLSG
FT                   APVVATDLRAGAALVLAGLAAEGCSTIHGLHYIDRGYEAIDEKLRSVGAKVYRSESPTG
FT                   IPQLGK"
FT   gene            112532..114667
FT                   /locus_tag="CYB_0096"
FT   CDS_pept        112532..114667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0096"
FT                   /product="transglycosylase, SLT family"
FT                   /note="identified by match to protein family HMM PF01464;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01097"
FT                   /db_xref="GOA:Q2JQ19"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ19"
FT                   /protein_id="ABD01097.1"
FT                   /translation="MGILTSSQRRWTRWAAGVLAAGAALGGAVWGFYTSSWAETVEVAS
FT                   AREGRDPTQLPQTSTTAFLRAYAALQAGQAQSALKDLQGLEESLPVLREEIWKLRAQAY
FT                   EQLQDKETAQGIWWPQILQEYPHSPVAAYALWGMGQVDRLRQQFPTHPLTGRALKHLLE
FT                   LNPDRYDLLRDLAQHHPQTPGLTPLLDRWRQAQEGSLTASDWQILADAYWEQREYGKAA
FT                   RAYGRAPATSQNLYRWGRSHQISREFPQAKAAYQALLAQFPDGPEASLTRRRLAELSDL
FT                   PTAIDLLRQVGSGSDKEAPEALLSLSQLYDRNASPQSAQATRQALWDRFPASEAAANAA
FT                   WTVAWSQAQAGNLSQAIALAQQIGSAQRDTEMGAQLLYWAGKWREQQGDVAAARQTYRQ
FT                   VLRQFPHTYYGWRSAVQLGWPVGDFYSGRKRVEVDFQPVRQPLPGVSAVTQTLHLMGAS
FT                   QLAWERWQGETPVQRDPGQMSVAERFVTGILRNSAGDHLRGINQVAALRFSEEPDPLLE
FT                   TLRQRQDFWQAIYPLHYYAGPDNSWSGDPYAQPGLAHWSRQFNLNPLMVAALIRQESRF
FT                   EPEIVSASGALGLMQVMPATGRWIAQQIGLAQYSLTNPADNLYLGSWYFDYTHRTYQDN
FT                   TLLALASYNGGPGNVARWLNRFGFEDPDVFVEQIPFPETRGYVKSVFGNYWNYWQLYTQ
FT                   EGRTLVSQRLHNPSSSS"
FT   gene            114811..115398
FT                   /gene="sixA"
FT                   /locus_tag="CYB_0097"
FT   CDS_pept        114811..115398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="CYB_0097"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR00249"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01098"
FT                   /db_xref="GOA:Q2JQ18"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ18"
FT                   /protein_id="ABD01098.1"
FT                   /translation="MVSGFEQQEGVCVSSAEHHQGAAEKQTARQELAVDFIRHGIAEEP
FT                   RPEVEDAFRALTDEGRKRCRKVARQLKNMGWRWDLLLTSPLVRARQTAEIFLDENLAEA
FT                   VEVFEPLAPGGSFADLVRWQAEREPLASLALVGHQPDLSLWVQAAVGLNPANAHAITLK
FT                   KAGLAQVRFAEGRIDYRQGSLTLLLSPKVVLR"
FT   gene            complement(115467..115760)
FT                   /locus_tag="CYB_0098"
FT   CDS_pept        complement(115467..115760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01099"
FT                   /db_xref="GOA:Q2JQ17"
FT                   /db_xref="InterPro:IPR021434"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ17"
FT                   /protein_id="ABD01099.1"
FT                   /translation="MSSASPQGSPHPFSALLGAAIAVSLGYGFFQLLLSMLAKLPPIEV
FT                   EIGSLARGISILVRYLLVGSVSLIAFMFALVGLGLAAYFLQLLGERLTSSRR"
FT   gene            115840..116520
FT                   /locus_tag="CYB_0100"
FT   CDS_pept        115840..116520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0100"
FT                   /product="DnaJ family protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01100"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ16"
FT                   /protein_id="ABD01100.1"
FT                   /translation="MESGSHYEVLGVSVAATAEEIKSAYRRLVKYHHPDSLLAKKDRAT
FT                   SERIRQINAAYAVLKDPQSRRDYDRQLHSSRTSPCPQPRGSPHETVSHEAIARAAWIQQ
FT                   VYTPLNRVLGPLLSSLEPQLHALAADPFDPNLLQSFADYLEECAQKLAQAQQIFGRLPN
FT                   PSSLGGVASRLYYALNHLEDALEELQYFPLNFDDRHLHTGQELFRRAGGLRLEAMEAYA
FT                   KSSP"
FT   gene            complement(116512..117381)
FT                   /locus_tag="CYB_0099"
FT   CDS_pept        complement(116512..117381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0099"
FT                   /product="peptidase S49 (protease IV) family,
FT                   nonpeptidase-like protein"
FT                   /note="identified by match to protein family HMM PF01972"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01101"
FT                   /db_xref="GOA:Q2JQ15"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ15"
FT                   /protein_id="ABD01101.1"
FT                   /translation="MDWGSLFWIFLIFSSLQPLLNRRAQEFRRLMAIRELEQKRGSRVI
FT                   LLIHRQESISFLGIPVSRYISIEDSEQVLRAIRLTPPNTPIDLILHTPGGLVLATEQIA
FT                   RALIRHPAKVTVFVPHYAMSGGTMLALAADEIVMDANAVLGPVDPQLGGYAAASILQVV
FT                   ADKPIAEIDDQTLILADLARKAMQQVQNFVRDLLKDDVPKRKIAPERIEPLIQYLTSGQ
FT                   VTHDYPITAEEAQRLGLPISTELPPQIYALMDLYPQAAIGRPSVQYIPIPYDPRPALPR
FT                   GGSRSGLG"
FT   gene            complement(117452..118333)
FT                   /locus_tag="CYB_0101"
FT   CDS_pept        complement(117452..118333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ14"
FT                   /protein_id="ABD01102.1"
FT                   /translation="MVWPTLQVPQVLLFVEAASLLQDSSQVLLQAGRATADLPELIAEA
FT                   QARAEAQVQLLGIPADLRAQVRGILRLTSPQEVLAYLQDLLDRGSGPDLEAFLEQAGSA
FT                   STVLRFPPLLVGAVALEVVLERLDFSPEERAVVQAQRDQWEQALAELAIHHRVSPEPLQ
FT                   AAAETVLRAASAEELLQLGQDLFQDLQDLAVADSEPEAEPQVELAGPLLFMMVADHLLA
FT                   QTEYPLTPEQRLDLQTNRAEAETRYLAMQKLGRIENLAEQQAYIRSWIDQASVPDLLQA
FT                   LDRLFAASEPNS"
FT   gene            complement(118335..119306)
FT                   /locus_tag="CYB_0102"
FT   CDS_pept        complement(118335..119306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0102"
FT                   /product="beta-carotene ketolase , putative"
FT                   /note="identified by similarity to GB:AAF78203.1; match to
FT                   protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01103"
FT                   /db_xref="GOA:Q2JQ13"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ13"
FT                   /protein_id="ABD01103.1"
FT                   /translation="MTVAATAEPAQKPFALPRELLGPPSEFWNPTLLMFLAAVVLSASC
FT                   FGGYAFWHWPKWMVFWLNFVALYVLGTVIHDASHGSAHRNRFLNEALGHGSALLQGFVY
FT                   PVFKRVHMQHHAHVNHPEDDPDHYVSTGGPLWLIAPRFFYHEVFFFKRQLWRKGRWDLL
FT                   EWGLSRLVVILTFGLASYFGYTDYIMNYWLPPAFIMGFLLGLFFDYLPHRPFQSQERWY
FT                   NARVYPGWLTNILLLGQNYHLIHHLWPSVPWYKYQAAYWAAKPELDARNCQQTLGIWEK
FT                   GEFWGFLYDALIGLHWHKPTSAHPAAPANPESEGSPADPQLG"
FT   gene            119664..119909
FT                   /gene="psaK"
FT                   /locus_tag="CYB_0103"
FT   CDS_pept        119664..119909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaK"
FT                   /locus_tag="CYB_0103"
FT                   /product="photosystem I reaction center protein PsaK"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01104"
FT                   /db_xref="GOA:Q2JQ12"
FT                   /db_xref="InterPro:IPR000549"
FT                   /db_xref="InterPro:IPR017492"
FT                   /db_xref="InterPro:IPR035982"
FT                   /db_xref="InterPro:IPR037101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ12"
FT                   /protein_id="ABD01104.1"
FT                   /translation="MMPVVALLALTAQTSPWSPLNAVIILLCTGLAYLSFKSSSGVASE
FT                   TGPVLGMTWPEVIGVASFGHLLGVGVVLGLSNIGVL"
FT   gene            120040..120168
FT                   /gene="psbK"
FT                   /locus_tag="CYB_0104"
FT   CDS_pept        120040..120168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="CYB_0104"
FT                   /product="photosystem II reaction center protein PsbK"
FT                   /note="identified by match to protein family HMM PF02533"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01105"
FT                   /db_xref="GOA:Q2JHR3"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR3"
FT                   /protein_id="ABD01105.1"
FT                   /translation="MVFLASLPEGYELFDPLIDILPIIPVLFFLLAFVWQAAVGFK"
FT   gene            complement(120507..121046)
FT                   /locus_tag="CYB_0105"
FT   CDS_pept        complement(120507..121046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01106"
FT                   /db_xref="GOA:Q2JHR2"
FT                   /db_xref="InterPro:IPR022051"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR2"
FT                   /protein_id="ABD01106.1"
FT                   /translation="MNEPMSPSVRAAVERMKSRLRLTRRFGFWFQAILGATALLLWFGF
FT                   LIGQNTVYRDDSLGAIIAFWFTLFTLLTLAAGLFFNWRYLLHAERRSASADALSQLDLP
FT                   KQLQLVTYISLIGAFLALIGMEAQVGELLARMFSRTQANQVTGVLLLAANINVTFAHFV
FT                   CLAGVLWITGVLDREP"
FT   gene            complement(121122..121568)
FT                   /locus_tag="CYB_0106"
FT   CDS_pept        complement(121122..121568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01107"
FT                   /db_xref="GOA:Q2JHR1"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR1"
FT                   /protein_id="ABD01107.1"
FT                   /translation="MSGKASRRWWTAFPIQSVVQKGLVGLIWVCTWIPVLTVSLAVAQT
FT                   PTTSVVLSDEQVTMYARIVLEMEPHRQEAQKRSQATNDPASKDQIRREFIRTATEIITR
FT                   HGMTVPDYNRITLLIRSEEGKALQQRIEAEILRLQSEDPQPPAR"
FT   gene            121855..122913
FT                   /gene="chlI"
FT                   /locus_tag="CYB_0107"
FT   CDS_pept        121855..122913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlI"
FT                   /locus_tag="CYB_0107"
FT                   /product="magnesium chelatase, ATPase subunit I"
FT                   /EC_number="6.6.1.1"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM TIGR02030"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01108"
FT                   /db_xref="GOA:Q2JHR0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHR0"
FT                   /protein_id="ABD01108.1"
FT                   /translation="MHLERRPVFPFTAIVGQEEMKLALLLNVIDPRIGGVLIMGDRGTG
FT                   KSTTIRALADLLPQIEVVKGDPFNSHPRQRDLMSDQVWERLQAGETLESTWIQVPMVDL
FT                   PLGATEDRVCGTLDIERALAQGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAA
FT                   ASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMFVQIETVRDAALRVRI
FT                   VEERSQFDADPQAFLAKYADSQQRLRERIEKAQHLLPNVAVDPDLRLKISGVCAALEVD
FT                   GLRGDIVTNRAAKALAALEGRSEVTVADIRRVISLCLRHRLRKDPLETIDSGYKVEKAF
FT                   SEVFQVSLESAA"
FT   gene            complement(122953..123651)
FT                   /locus_tag="CYB_0108"
FT   CDS_pept        complement(122953..123651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AF2283"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01109"
FT                   /db_xref="GOA:Q2JHQ9"
FT                   /db_xref="InterPro:IPR021325"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ9"
FT                   /protein_id="ABD01109.1"
FT                   /translation="MTVEPTPAPRDPNRWLRRLPLVTGLLGSALLVINRLAFTPELLTS
FT                   QSRSDALGILLSAVLILTGLLWQQIQPLPPQTAPLQGIPGCDWHPDLSESEKLELAWAS
FT                   HTLLSTTAARTVVIWVGGRTLLQRGLLANPGQMPSIQPKSVLQRVLQTGRPVYLVDLKL
FT                   FPARAEFNDLLPPGSQAVLCQPIGQKGCLILGSDTPRSFSRQEQTWIAAIADKLAATLL
FT                   PSPPGRGAGG"
FT   gene            complement(124060..124593)
FT                   /gene="nucH"
FT                   /locus_tag="CYB_0109"
FT   CDS_pept        complement(124060..124593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucH"
FT                   /locus_tag="CYB_0109"
FT                   /product="thermonuclease"
FT                   /EC_number="3.1.31.1"
FT                   /note="identified by similarity to SP:P43270; match to
FT                   protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01110"
FT                   /db_xref="GOA:Q2JQ11"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ11"
FT                   /protein_id="ABD01110.1"
FT                   /translation="MFQRIALGSAALGLLLAIPVLPSHGFGEPRVVPDTPFYFDNHRFD
FT                   RYPDAVVVRVVNGDTLVVQIEGEQKMRLIRLAGIEGLSPEENPYYQQAIELMRERILYR
FT                   TVKLEGDKLLRNVDATGLVEAYVWLEGHQMNAMLVRNGLARIIPYSHNIKYDSYYGGLQ
FT                   EKAQQERLGIWSRL"
FT   gene            complement(124796..124924)
FT                   /locus_tag="CYB_0110"
FT   CDS_pept        complement(124796..124924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01111"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ10"
FT                   /protein_id="ABD01111.1"
FT                   /translation="MLRTTDATERRIHQAIQNAQARFDSDKFADKFAQQLRGESGN"
FT   gene            125417..126004
FT                   /locus_tag="CYB_0111"
FT   CDS_pept        125417..126004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0111"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01112"
FT                   /db_xref="GOA:Q2JQ09"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ09"
FT                   /protein_id="ABD01112.1"
FT                   /translation="MTSQIQPCTREQILNGMGITTLFSALIVGLWIWLGSSFPVPFRWD
FT                   PLALAWGAGLGLGVALLSGGVYRLWPAYRRAATAYLHWVADPLQWGDILWVGLLPGWSE
FT                   EWLFRGVLMSLLVASPLGWTGGILLSGLLFGALHWLGWQGWPYAVWAGGVGILMGIGLW
FT                   LSGNLLVTIVAHTLVNWIGVCAWKCFFSQAEP"
FT   gene            126236..127117
FT                   /locus_tag="CYB_0112"
FT   CDS_pept        126236..127117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0112"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01113"
FT                   /db_xref="GOA:Q2JQ08"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ08"
FT                   /protein_id="ABD01113.1"
FT                   /translation="MTVFVDAFSSMPIRDLLQFPVLGSFSWLRVGRSLLLVGLVVYGYL
FT                   LWLGWFQSERMIFLPRPASYRDGDAILKLTTSDGLQISAVYLPNPAAAYTLLYSHGNAE
FT                   DLGDILPRLVHLQQAGFAVLAYDYRGYGTSEGIPSEAGAYKDIEAAYTYLVAQGILPEQ
FT                   ILVYGRSVGGGPSVYLAAQKPVGGVILESTFVTAFRVLTRIPLLPFDRFDNLSRMAKIN
FT                   CPLLILHGTQDRLIPFWHAEALYQAARDPKRLVPIEGADHNNLLQVAGERYVPILHQFV
FT                   AELVDPHVVFPQ"
FT   gene            127262..127912
FT                   /locus_tag="CYB_0113"
FT   CDS_pept        127262..127912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0113"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01114"
FT                   /db_xref="GOA:Q2JQ07"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ07"
FT                   /protein_id="ABD01114.1"
FT                   /translation="MSLRLGDTAPNFTQKSTHGEIDFYSWAGDSWVVLFSHPADYTPVC
FT                   TTELGTVAKLMPEFEKRGVKVIALSVDDVDSHVGWVKDIEETQNATLTYPILADADRKV
FT                   SQLYGMLDQTNLNQEGLPLTVRSVFVIDPNKKIRLILTYPASTGRNFDELLRVIDALQL
FT                   TDKYNVVTPADWKDGDDVIIPPSLKDPEVLKEKFPKGYKEIKPYLRVAPQPNK"
FT   gene            complement(128097..128666)
FT                   /gene="scpB"
FT                   /locus_tag="CYB_0114"
FT   CDS_pept        complement(128097..128666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="CYB_0114"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by match to protein family HMM PF04079;
FT                   match to protein family HMM TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01115"
FT                   /db_xref="GOA:Q2JQ06"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ06"
FT                   /protein_id="ABD01115.1"
FT                   /translation="MAPRRLTSISDPLLAERQGQRERVLALKNQIEAILYLKGQPLELS
FT                   ALAQLAHCSRDEAYDALLELMEDYAHRDSALEVLQVEEGFALQLREPFLELANQLLPPE
FT                   IGVGATRTLATIILRGPLSQAELVELRGQGAYQHVAELVEKGFVTRYRKEGSRSPWLRV
FT                   TDKFHRYFMVDELAKKATEAASFPEE"
FT   gene            complement(128766..130922)
FT                   /locus_tag="CYB_0115"
FT   CDS_pept        complement(128766..130922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0115"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase, F
FT                   subunit"
FT                   /note="identified by similarity to SP:Q55429; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   PF00662; match to protein family HMM TIGR01974"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01116"
FT                   /db_xref="GOA:Q2JQ05"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ05"
FT                   /protein_id="ABD01116.1"
FT                   /translation="MEFIYTYAWLIPVYPLVAAFLLGLGILMFNAWTRANRSLAAFLSV
FT                   FATGTAMVHAFALLVSQVQGHEAVLRTITWAQAGSFSVDMGFVVDHLSAMMLVVVTTVA
FT                   FLVQIYSDGYMAHDPGYVRFYAYLSLFSSSMLGLVVSPNLVQIYIFWELVGMCSYLLIG
FT                   FWHDRQAAAEAAQKAFVVNRVGDFGLLLGILGFYWISGTFAFDEIGRNLQEMLAAGAVS
FT                   SSLIALFAVLVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLLARMF
FT                   PVLEGIPAAMDIIAWTGAGTAFLGATIAITQNDIKKGLAYSTISQLGYMVMAMGCGAYG
FT                   AGLFHLMTHAYFKAMLFLCSGSVIHGMEAVVGHDPVLAQDMRLMGGLRKYMPVTAITFL
FT                   IGTLAICGIPPFAGFWSKDEILGAVFERNPALWGVGFLTAGITAFYMFRIYFLTFEGEF
FT                   RGTNLRLRQEVAISQGRPVPAFAYVFAGKQPAFGPGAMNIQEKPQPSSHPEAHENLHDG
FT                   DAHASEPHESPWSMTFPLLALAVPSVLIGLVGTPFANFFEAFIHPPTESVAEAGSILPL
FT                   VAAEWQEVLAGHFDWAEFLIMAGSSVGIGLIGITLASLIYWQKRIDPGTFPQSLQPLYY
FT                   FSLNKWYIDDLYERVFVQGTRFVAREALEVDSRIVDGVVNLTGLVTMVSGEAMKYLESG
FT                   KAQFYALIIFAAVVVMVVASGVGF"
FT   gene            130928..131140
FT                   /locus_tag="CYB_0116"
FT   CDS_pept        130928..131140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01117"
FT                   /db_xref="GOA:Q2JQ04"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ04"
FT                   /protein_id="ABD01117.1"
FT                   /translation="MLLNASSHSNEPALLALQLAGGSVWWAGICSTASAIVNFCDRVRS
FT                   RIPSIKSITAEAFPRDQSGSPQLNL"
FT   gene            131259..131615
FT                   /locus_tag="CYB_0117"
FT   CDS_pept        131259..131615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0117"
FT                   /product="putative single-strand binding protein"
FT                   /note="identified by similarity to SP:P28046; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01118"
FT                   /db_xref="GOA:Q2JQ03"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ03"
FT                   /protein_id="ABD01118.1"
FT                   /translation="MSLNLVTLVGRAGMDPEVRYFESGKVVCTFSLAVNRFRKGEDKPD
FT                   WFSLELWGRTAEVAGEYVRKGSLIGVTGSLKFNRWTDKSTGEERQRPIIAVDRLELLGS
FT                   RQDRDSNLPPEEPF"
FT   gene            complement(131641..132396)
FT                   /gene="cobK"
FT                   /locus_tag="CYB_0118"
FT   CDS_pept        complement(131641..132396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="CYB_0118"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="identified by match to protein family HMM PF02571;
FT                   match to protein family HMM TIGR00715"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01119"
FT                   /db_xref="GOA:Q2JQ02"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ02"
FT                   /protein_id="ABD01119.1"
FT                   /translation="MALIGGTSESRSLADALSRQGIPWVATVTTEGARRLYQDLPGQVV
FT                   VTRFSPPSLEQFLQECRIRVVVDASHPFAQQISQLAIQVTAQLRIPYLRYERPPLELDP
FT                   WVQVVPDWQGVLTEAVLAGRRVLLTVGVKALPLFVPWQDRCQLWARVLPESVPQAVQAG
FT                   IPAERVIGMRLPLSFEQELQLWQRFSPQVVISKASGEAGGLGIKQAVAKTLGIPLWVIR
FT                   RPPLDYPWCSQDLTEVVQECRRCLGRAKP"
FT   gene            132488..133003
FT                   /locus_tag="CYB_0119"
FT   CDS_pept        132488..133003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:S77403; match to
FT                   protein family HMM PF02577"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01120"
FT                   /db_xref="GOA:Q2JQ01"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ01"
FT                   /protein_id="ABD01120.1"
FT                   /translation="MIEMHVAGIAVDAVNQNPIVILRDGSERRALPIWVGKAEANAILQ
FT                   ALDDQKPLRPMTHDLILNSWKTWGIKLERVIIHALLDNTFYAVLVTVNGDKKQEIDCRP
FT                   SDAIALALRAHVPIWTVEEVIAEASIPMNQDADEAEREAFRKFVENVTPRDFIRSYPMT
FT                   DHPTEADS"
FT   gene            133034..133855
FT                   /locus_tag="CYB_0120"
FT   CDS_pept        133034..133855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0120"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473;
FT                   match to protein family HMM PF03476"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01121"
FT                   /db_xref="GOA:Q2JQ00"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JQ00"
FT                   /protein_id="ABD01121.1"
FT                   /translation="MPQVARLTVYPIKSLDGIPLSEVRLTAGGTLEGDRRYALVDAEGK
FT                   RVNGKRHAAVHRLRARFDPQLGQVQLWGDGKAAQFDLQQQRDALQTWLSDWFGFPVQLL
FT                   EEPLRGFPDDPYADGPTLISTATLETVAGWFPNLTLEAVRQRFRMNIELSDCSAFWEDR
FT                   LFARADQGVRFRIGEVELLGLNPCARCVVPSRDPLSGEAYPGFQKHFVAQRQKTLPPWA
FT                   EASRFDHFYRLGINTWIPRTETGKHLRVGDPVEILGVEPLSLYPELSRIPG"
FT   gene            133905..135134
FT                   /gene="ispG"
FT                   /locus_tag="CYB_0121"
FT   CDS_pept        133905..135134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="CYB_0121"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01122"
FT                   /db_xref="GOA:Q2JPZ9"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPZ9"
FT                   /protein_id="ABD01122.1"
FT                   /translation="MQTLDRPNAPTQQPYPEPVYPRRPTRTVAVADVLIGSQHPVVVQS
FT                   MINEDTLDVDAAVAGIRRLHEAGSEIVRVTVPSMAHAKAMEAIREKLIQTYKPVPLVAD
FT                   VHHNGIKIALEVAKYVDKVRINPGLFVFEKPQPGRTEYTQAEFEAIRNKIRETFTPLVQ
FT                   TLKAQNKALRIGVNHGSLAERMLFTYGDTPEGMVESALEFAQICAEQDFHNVVLSFKAS
FT                   RPQVMLAAYRLAARRFDALGLNYPFHLGVTEAGDGEYGRIKSAVGIGTLLAEGIGDTIR
FT                   VSLTEAPEKEIPVAYGILQALNLRKTMVEYVACPSCGRTLFNLEEVLQKVRAATQHLVG
FT                   LDIAVMGCIVNGPGEMADADYGYVGKTPGVISLYRGKEEVKRVPESEGVQALIDLIKAD
FT                   GRWVDPPSSH"
FT   gene            complement(135204..135632)
FT                   /locus_tag="CYB_0122"
FT   CDS_pept        complement(135204..135632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01123"
FT                   /db_xref="GOA:Q2JPZ8"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ8"
FT                   /protein_id="ABD01123.1"
FT                   /translation="MSAASSCTLPTSMLTGSHFSSTGQTIRQQVAQLDEGSRRDKAWLG
FT                   DAVLSLFARQWLLGPPQDWQVPSPPSCDLNRAELFTWLTSNQFLSAFRDPTQVEAEIGL
FT                   VYEKEGLQAAFEYIQAHLLPLFVRQVNNRAKALRGKRH"
FT   gene            135720..136391
FT                   /locus_tag="CYB_0123"
FT   CDS_pept        135720..136391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01124"
FT                   /db_xref="GOA:Q2JPZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ7"
FT                   /protein_id="ABD01124.1"
FT                   /translation="MLLELTPEECESVIPVVPTRLQYAAYWSDALKSTGRIITAILVGV
FT                   ALLVLSRAFGEGSFLGAISFLVGILSLLYPFLWGPLYTISRRQLAFREIPYGGLFFGQV
FT                   LRTRRYEVVVEEREKLDEDGNFYIEEVRERQFEMEIGDETGVVYRVRAKDDPRYRRIVK
FT                   KQSVLGLVKAYSRDLQRRPTLSEVYVVKLGEWVGDVSYLDREAFLDMADELLELQAQGQ
FT                   A"
FT   gene            136597..136893
FT                   /locus_tag="CYB_0124"
FT   CDS_pept        136597..136893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:S75241"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01125"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ6"
FT                   /protein_id="ABD01125.1"
FT                   /translation="MGDPLTPQVSERICKHMNEDHADAIALYARVFGQVEGVTQARMQA
FT                   IDPEGMDLRVQVDGAVQTLRIRFDHPLRDSEDAHQTLIAMVKQARAQVKQATK"
FT   gene            complement(136913..137173)
FT                   /gene="grxC"
FT                   /locus_tag="CYB_0125"
FT   CDS_pept        complement(136913..137173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="CYB_0125"
FT                   /product="glutaredoxin 3"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01126"
FT                   /db_xref="GOA:Q2JPZ5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ5"
FT                   /protein_id="ABD01126.1"
FT                   /translation="MTVEIYTWRFCPFCIRAKQLLDRKGVKYIEYAIDGDEAARAEMAK
FT                   RANGRRSVPQIFINDQHIGGCDDLYALEARGQLDLLLQQAS"
FT   gene            complement(137266..140061)
FT                   /gene="polA"
FT                   /locus_tag="CYB_0126"
FT   CDS_pept        complement(137266..140061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="CYB_0126"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01127"
FT                   /db_xref="GOA:Q2JPZ4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ4"
FT                   /protein_id="ABD01127.1"
FT                   /translation="MAWQTPTLLLVDGHSLAYRSFYAFAYSREGGLRTSTGIPTSVSFG
FT                   FLKSLLEVLDKYTPTHVAVAFDTRQPTFRHEADETYKSGRPETPPEFIEDVENLKQVLT
FT                   ALRIPILVVPGFEADDILGTLSRLAPQDYRVQILSGDQDLFQLIDTDGRVRVLHLNSKD
FT                   RISEFGPEQVKEKLGIWPWQVVDYKALCGDPSDNIPGVKGIGPKRAVELLERYGSLDEI
FT                   FDHLDEIQGKVQQYLKEGIPAAHHSQFMARIKCDVPLSPDWESMKLTGFDQAELLPLLE
FT                   KLEFHSFIAQVRKIQTALGGIPTEAEVVGAFNPTGDPANAPDEALWFDFALDPVPSLPA
FT                   VRIIDTPEQLELLRQELLACPGIVAWDTETTSLDPRDAQLVGIGCCWSEGDIAYLPIGH
FT                   RQGSNLDWELVKQSLQPLWEDPNRPKSLQNCKYDLSIFRAHGIRLQGIQFDPMLASYVL
FT                   DPEASHNLADLAATHLNLPTTSYKKLLGKEQSIADIPISKVAEYCGTDAYCAYRLVPIL
FT                   TEKLQKTDPRLWDLFIQVELPLAQVLEEMEWIGIRVDTEFLRQFSQELEQELQSLEQKA
FT                   YAQAGETFNLNSPKQLGSLLFEKLKLDIRKTRKTATGYSTDASVLEKLEGDHPLIETIV
FT                   QYRTLAKLKSTYVDALPALVRSDTGRVHTDFNQTVTATGRLSSSNPNLQNIPIRTEFSR
FT                   RIRQAFIPQEGWLLTAADYSQIELRILAHLSQEPALLEGFRSGEDVHTLTARLLLEKQE
FT                   ITSEERRLAKTINYGVIYGMGAQRFARTAGVSLSEAKQFLQRFNERYAGIFAYLRSTEA
FT                   FVEKHGYVETILGRRRYFPNLSRLTGHRKQAELRAAVNAPIQGSASDIIKVAMVRLRQK
FT                   LQNFRSRLLLQVHDELVFEVDPSEWQALKPLIQREMEGAVPLSIPLVVDIQIGHNWKEA
FT                   N"
FT   gene            140385..141068
FT                   /locus_tag="CYB_0127"
FT   CDS_pept        140385..141068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0127"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01128"
FT                   /db_xref="GOA:Q2JPZ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ3"
FT                   /protein_id="ABD01128.1"
FT                   /translation="MLFSSRQILPPSLYPPLHWGLKTLFPDGLWELPADPHTQRVALTF
FT                   DDGPHPEYTPALLQVLMDFQVPATFFVLGERVQRWPHLARQIRQQGHRIGLHGWQHRPF
FT                   TELAPGELYQSLKRSQAALVAACGGIPDDYRAVRPPNGLFWPQTLADLRRWGFCPVMWS
FT                   VVPEDWLIPPVSVVVERVLAQVRPGSLIVLHDGVQGGAQVVEVTRQLIPTLKKRGFEFV
FT                   HLPDP"
FT   gene            141133..141891
FT                   /locus_tag="CYB_0128"
FT   CDS_pept        141133..141891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0128"
FT                   /product="pspA/IM30 family protein"
FT                   /note="identified by match to protein family HMM PF04012"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01129"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ2"
FT                   /protein_id="ABD01129.1"
FT                   /translation="MGARKIIYGIFGQRAGSVIVGTWNWLWGIPVEKGGTGAVMVAEES
FT                   LRTMQETVQRLTEAVATQVAAYQRAEQKYMQKVREYQALENKARLAAQRGDQEAARLAM
FT                   SQALQIEAILGPLKENVETAERYVNAAKQKLAREKERLAAYKSELSNLKDINEVNQALE
FT                   QMTRVNNSYNIDSAKSQFEAAKNAIQARQLKSRAMSELSEDRSEQIAAQLDEMAMDDEI
FT                   SRRLAMLTGQGGAQANLPMPDLDFEKRLPQ"
FT   gene            142155..142679
FT                   /gene="psbP"
FT                   /locus_tag="CYB_0129"
FT   CDS_pept        142155..142679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbP"
FT                   /locus_tag="CYB_0129"
FT                   /product="photosystem II oxygen evolving complex protein
FT                   PsbP"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01130"
FT                   /db_xref="GOA:Q2JPZ1"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ1"
FT                   /protein_id="ABD01130.1"
FT                   /translation="MLLCVCLSLVVGACSAGSNLRAYRDPSGAFAFAYPNGMVAVNLGP
FT                   GKGPVVLLRDLVYETENVSLMIAPFDKGETIADLGSPAEVGQLVAEKIIAPEGSGRSAK
FT                   LLAAEAFERQEHPYYLLEYQTDMGSQLRHEVVTVTVRHHRLYTLTASTQESRWPQVQAA
FT                   FRNVGRSLNVS"
FT   gene            142995..143789
FT                   /gene="icc"
FT                   /locus_tag="CYB_0131"
FT   CDS_pept        142995..143789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="CYB_0131"
FT                   /product="icc protein"
FT                   /note="identified by similarity to SP:P36650; match to
FT                   protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01131"
FT                   /db_xref="GOA:Q2JPZ0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPZ0"
FT                   /protein_id="ABD01131.1"
FT                   /translation="MTVYVVQISDLHLFAKPHHRLLGVDTEASFLQVQKAIAALDPLPD
FT                   LLLLTGDLSQDGSAASYARLRAHLQALPIDTYWLAGNHDRLHTMNQELHAERLFGDKSF
FT                   SRENWSFILLNSLVPGKDSGYLTERTLLWLRQELQRSKAAQHHVLLALHHPPFSVDSAW
FT                   LDQSALQQPERLFGVLDEFDHIRLVVFGHIHQDLHRRREGVDYLACPSTCVQFRPKSPQ
FT                   FGLEVIPPALRQIWLERDGSFKTQVQRVGAALQRPNLALKGY"
FT   gene            complement(143786..144610)
FT                   /locus_tag="CYB_0130"
FT   CDS_pept        complement(143786..144610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0130"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01132"
FT                   /db_xref="GOA:Q2JPY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY9"
FT                   /protein_id="ABD01132.1"
FT                   /translation="MKGRRWIGGSLLRLGVAGVALLWALPFGVLALWAFTRAWYFPDAL
FT                   PRAWSIAGWQQLLSWGSQFRAAFGQSLQIALFTTLLALGVGIPAGRVLGTRPVPAWLRL
FT                   LLLLPVITSPLAVLMGIQGVLIRLRLDGALLGVVLVHLIPTIPYMALVMGSVFARFDRG
FT                   YEAQARCLGADPWQVWWQVTLPLIAPGAAIGAVFAFLISWNEFLLTFFVGGGRVLTLPM
FT                   LLYSLLQGGNNTLVAAVAFLSLLPGWLALLGASVCLGQAIGLPPTEVQEGES"
FT   gene            complement(144607..145536)
FT                   /locus_tag="CYB_0132"
FT   CDS_pept        complement(144607..145536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0132"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01133"
FT                   /db_xref="GOA:Q2JPY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY8"
FT                   /protein_id="ABD01133.1"
FT                   /translation="MNSLNGRGSGPVGLKGIRQYGPLLPALGLVGLLYGGGLLLALAQS
FT                   VGLYGLGERGFTLQGYGELLRDAEVGGSLLLSLRIALLATGLALLLGLGLALLLRGVGG
FT                   WAIWLGQLTLPIPHLVGVAGMLLLLGPSGWLARLAFQLGWIASDQDFPLWVNDRGYVGV
FT                   LLYWLWKEIPFAALVALTLLRGMGSELEQQARLLGASAAQTFWYVTLPLLRPGLLATGI
FT                   LIFGFVFSAFEVPLLLGPTYPRTLPVLIYQRFTHINLEQRQQAVALGIILLAVSAAVVS
FT                   LIGGLFAARVSFLQLPFGSAGRSPWRKP"
FT   gene            145666..146820
FT                   /locus_tag="CYB_0133"
FT   CDS_pept        145666..146820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC09914.1; match to
FT                   protein family HMM PF01837"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01134"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY7"
FT                   /protein_id="ABD01134.1"
FT                   /translation="MERTLDQINQRIAKGQVRVWTALEAKAKLATLGIQEAFEQVDVIT
FT                   TGTFEPMESSGAIVNLGHTDPPIKIRQAWLNGVPAYAGFGAVDLYLGAAQPSEQADQAY
FT                   GGGHVIADLVAGKRVHLRAIGQVTDCYPRADYETTLTRDQLNQFYLFNPRNAYQNFIVG
FT                   VNGGDRPLYTYLGLLEPHLGNAVYSNPGELSPLLNDPLLRRVGIGSRIFLGGGIGYVAW
FT                   EGTQHFPLQKRLPNQTPIGPAATLALIGDAKQMQAEWVRGCYFRNYGPSLMLGVGIPIP
FT                   ILAPADLEAIAIRDEELVAPVIDFSIPRRVRPTFGLVSYAQLKSGQITLNGRKVRTAPL
FT                   VSLRRSMQIAEILKQWIESGQFTLTQPVAPLPLDREFLPQNPLR"
FT   gene            complement(147255..148340)
FT                   /locus_tag="CYB_0134"
FT   CDS_pept        complement(147255..148340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0134"
FT                   /product="polysaccharide pyruvyl-transferase"
FT                   /note="identified by match to protein family HMM PF04230"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01135"
FT                   /db_xref="GOA:Q2JPY6"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY6"
FT                   /protein_id="ABD01135.1"
FT                   /translation="MKRPQVLICGYYGYGNAGDEALLVALLRELEQLPSPVQPVVLSRR
FT                   PAETAATYGVLAYPRFNSLALRRCLQEAQAFIWGGGGLLQDRTSWRSPLYYLGVMGLAQ
FT                   RWGLRTVAWAQGIGPLQRGWIRALARRSLAGCTAISVRDGVASQWLQEWGIPHQVAPDP
FT                   VWSLPSKTLPEWETWPQPRIAVVLRPHPQLTGACLEALSQGLQRLQASTGAYLLFVPFQ
FT                   LAPPGSPDLGPDYHLAQQLQQRLPHRSQVLEIRDPCLLKGVFRGVRLAITMRYHGLVMA
FT                   AAEGCACFGLSYDPKVKTLLQELGMPGWDLQEMPTDPEALHQAWLACYSESLALSPAQA
FT                   DLWARQSAQHAQLLRQHLKWG"
FT   gene            complement(148418..149311)
FT                   /locus_tag="CYB_0135"
FT   CDS_pept        complement(148418..149311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD01852.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01136"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY5"
FT                   /protein_id="ABD01136.1"
FT                   /translation="MAYDNVCKYLVEWFPESFARWLLGSPVSLAQLQPTELSTEPIRAD
FT                   SLILLRAQNLILHLEFQTDPDPDIPLRMADYCLRLFRRYPDQEVRQIVIYLRKTQSERV
FT                   YQTSFQRGSLSHRFEVLRLWEQDPEVLSQYPGLLPLAVLADPENPEPRLRQVARAIAEI
FT                   EDPKLRQEVKAATAVLAGLTWTPEEISRVLGGLAVRESTIYQMWRAEALKEGREEGLKQ
FT                   GLEQGLQQGLQQGLQQEAARLTLSQLRRKLGSLPEDLSETIRLLPTEQLEALAEALLDF
FT                   QTLADLIQWLRESSSN"
FT   gene            complement(149363..149767)
FT                   /gene="psbU"
FT                   /locus_tag="CYB_0136"
FT   CDS_pept        complement(149363..149767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbU"
FT                   /locus_tag="CYB_0136"
FT                   /product="photosystem II 12 kDa extrinsic protein PsbU"
FT                   /note="identified by match to protein family HMM PF06514"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01137"
FT                   /db_xref="GOA:Q2JPY4"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPY4"
FT                   /protein_id="ABD01137.1"
FT                   /translation="MSLLDSAWRSDAMRWLLSILVRVVLVLCLCFAPLGIPVVARAAEL
FT                   PPVKHLDTPIDVNNTILRNYRQLPGFYPTLARILVKNAPYKSLEDMLQISGLTEQQKAL
FT                   IKANAENFVFGEYQEGANQLENRINQGYYG"
FT   gene            149926..152892
FT                   /gene="gcvP"
FT                   /locus_tag="CYB_0137"
FT   CDS_pept        149926..152892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="CYB_0137"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by match to protein family HMM PF01212;
FT                   match to protein family HMM PF02347; match to protein
FT                   family HMM TIGR00461"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01138"
FT                   /db_xref="GOA:Q2JPY3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY3"
FT                   /protein_id="ABD01138.1"
FT                   /translation="MSDLALLHSTRLDPPSRDPSTGIPQPTPSPELELLGQTELFLRRH
FT                   IGLDARQIGQMLQVLELSSLQELVEKAVPPAIRSSQPLQLGSPCPEQQVLAELQAMAAQ
FT                   NQVWRSFLGMGYSNTLTPPVIQRNILENPAWYTPYTPYQAEIAQGRLEALLNFQTMVID
FT                   LTGMEIANASLLDEATAAAEAMALAYTLAGRGSPVFWVDRGCHPQTIAVVQTRAEPLGI
FT                   QVRIADPTELSLEKGFGLLLQYPSTYGEIRDYRQLVEQAHQKGMVVAVAADLLSLTLLQ
FT                   PPGEWGADIVVGSTQRFGVPLGYGGPHAAYFATREAHKRLLPGRLVGISQDAQGKPALR
FT                   LALQTREQHIRRDKATSNICTAQVLLAVMASMYAVYHGPRGLRHIAERIHRQAHHLATG
FT                   ICQLGYEVGPEHFFDTFWVKVASPEQVQAIQAGAAQRQINLRQIDDQTLGISLDEATTA
FT                   QDLRDLWEIFAGTLPRSGTESLPPAWDPDSPELDLGQSLPPQLLRTTPYLTHPVFNRYH
FT                   SETELLRYIHRLQSRDLALTHSMIPLGSCTMKLNATVEMMPVTWPEFAQLHPFVPLEQA
FT                   RGYQALFAQLEKMLAEITGFAGVSLQPNAGSQGEYAGLLAIRRYHQARGESRRQVCLIP
FT                   TSAHGTNPASAVMAGMQVVSVACDEAGNIDIEDLRAKVEQHRERLAALMITYPSTHGVF
FT                   EEGIREICQIIHEAGGQVYMDGANLNAQVGLCRPAELGADVCHLNLHKTFCIPHGGGGP
FT                   GVGPIAVAPHLVPYLPGHPVLPGCNGPVSAAPWGSASILPISWAYIRLMGSAGLTLASQ
FT                   VAILNANYIAKRLDPYYPVLYKGPGGWVAHECILDLRPLKKSAGIEVEDVAKRLMDYGF
FT                   HAPTISWPVPGTMMVEPTESESLEELDRFCEAMIAIRQEIAAIERGEMDPVRNPLKLAP
FT                   HTAEVVAADHWDRPYPRSLAAYPLPWVRSHKFWPSVSRIDNAYGDRHLVCSCQPWLDE"
FT   gene            152926..153597
FT                   /locus_tag="CYB_0138"
FT   CDS_pept        152926..153597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01139"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY2"
FT                   /protein_id="ABD01139.1"
FT                   /translation="MVVSKGGIRYNQSGIPGQRMRKNPRLERFTSVGPSSLPILTRLTL
FT                   GLLAGSLVACRKMPDPVAQEVDQDPVRRHIGKDGTHFEASLGDARALPPQFPPHLQLPN
FT                   ASIISSGQIRDREGGLASLILQTSQPLEAIAAYYRRTLWGRGWDILSDIEQANGIRTLV
FT                   FESPPHPKKPLQQAVVQVGSPRRGPDQVEYRDILILLSTVSPSATAEDLSAAKLAPPTS
FT                   P"
FT   gene            153600..154037
FT                   /locus_tag="CYB_0139"
FT   CDS_pept        153600..154037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01140"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY1"
FT                   /protein_id="ABD01140.1"
FT                   /translation="MPIYTQSIPIAASVAQVDRCLTDLELMKRWLNPLLGCEAVGSPLA
FT                   ELGSRYRFFLRLPFVSPSLDCVITERAEGLVQWQFKGFFEGTDRWECHPQPGGTLLVNC
FT                   FNFRIPSPWVAAGFYLLAAGPTQQDMRAQLRRLKAVAEALG"
FT   gene            154075..154656
FT                   /locus_tag="CYB_0140"
FT   CDS_pept        154075..154656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0140"
FT                   /product="AhpC/TSA family protein"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01141"
FT                   /db_xref="GOA:Q2JPY0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPY0"
FT                   /protein_id="ABD01141.1"
FT                   /translation="MTSNSGLFNRRFADNFIPQPANTSLEIGQIAPDFELPRVQGDPVR
FT                   LSDYRGQKPVVLAFTRIFTEKLFCPFCYPHIQELKARYGEIQALGAELLMVTSTDPVQS
FT                   QQIQADLQLPYPLLVDPECKTFRLYGVGQALGAPLPAQFVVDREGKLRFKHVFSFAQPN
FT                   ADTDEVLRVLREGLQTGWDGTRRVAPIPFF"
FT   gene            154702..156357
FT                   /locus_tag="CYB_0141"
FT   CDS_pept        154702..156357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0141"
FT                   /product="ABC1 domain protein"
FT                   /note="identified by match to protein family HMM PF03109"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01142"
FT                   /db_xref="GOA:Q2JPX9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX9"
FT                   /protein_id="ABD01142.1"
FT                   /translation="MFARLAQSGARQAEILEVVLRHGWDYMRRLLSFGKAGEPQLPPPM
FT                   VLRNILVDLGPVYVKLGQLLSTRPDLLPREYIEALSTLQADVPPVPWNAVEILLRQQLR
FT                   QPLEQVFSSLDTESVAAGSIAQVHRACLVSGEWVALKIQRPGLEAVVERDTRLIRGIAE
FT                   LVAQTEFGRLADVVALADEFCRAIQAELDFTQEARHTEQLRQQLQRGRWFDPAQLVVPR
FT                   IHWPLTTPKVLTLEWIEGRPLLEADRSDADPENIARLLTRAFFQQICIDGYFHADPHPG
FT                   NLFYLGSGRVALLDCGMIGRLDPRTQQILLELMLAIVSLDAQRCAELTLELALPERSAA
FT                   RSRDQTVSLAQLQSDYERLLRQYYALSIAELNFSQLFSEILQAARRNQIRIPGNLGLCA
FT                   KALANLEGIARQLTPDYNLPEQLRPLMADVFRAQLLGEAPLPSLLRTALDLKNLSLQSP
FT                   RQMELLLSRITSETQRWNLTIQELDGIRSSLDQSANRLSYSIVVGSLIVGAAIISAQTQ
FT                   RFQVFWLSELLFGAASLLGLWLVISILRSGRLRG"
FT   repeat_region   156596..159176
FT                   /rpt_family="CRISPR"
FT                   /note="GYMB_CRISPR01"
FT   gene            159250..160389
FT                   /locus_tag="CYB_0142"
FT   CDS_pept        159250..160389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0142"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01143"
FT                   /db_xref="GOA:Q2JPX8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX8"
FT                   /protein_id="ABD01143.1"
FT                   /translation="MGKGLNSLRWLARQYALRVLDAAGITLNGSQPWDIQVHDERLYLR
FT                   CLLYGSLGFGEAYMEGWWDCEAIDELVCRLLTAQAPQQVGWLTQPLLGLDSCLINRQRG
FT                   KGAFVIGQRHYDIGNDLYEDMLDRRMIYSCAYWDGGAQTLDEAQEAKLDLIARKLELQP
FT                   GMRVLDIGCGWGGTAQYLAERYGVQVVGITVSKEQAKLASERCRGLPVEIRLEDYRQTQ
FT                   GKFDRILSVGMFEHVGYRNYRTFMQVARRLLNDNGLFLLHTIGSNVAYQGRDPWIERYI
FT                   FPNSMLPSPHLITAAFEGLFVLEDWHNFGINYVATLKAWHANFEQAWPKLADRYDERFR
FT                   RMWRLYLLMSAGSFKARASQLWQLVLSPRGVSGGYRSLR"
FT   gene            160487..160930
FT                   /locus_tag="CYB_0143"
FT   CDS_pept        160487..160930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0143"
FT                   /product="Fe-S metabolism protein, SufE family"
FT                   /note="identified by match to protein family HMM PF02657"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01144"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX7"
FT                   /protein_id="ABD01144.1"
FT                   /translation="MPAALQQIVNRFQKAKTSRQKYELLLAYAKRLPPFPEAERKEENL
FT                   VRGCASRVWLATEFREGKVYIQGDADAQLVKGLVAIVVEGLSGLAPEEILGVSPEFVRE
FT                   MGLNFSLSPSRSNGLVSMFSLLQQRALAFRRSGSASSAVSVVL"
FT   gene            160944..162065
FT                   /locus_tag="CYB_0144"
FT   CDS_pept        160944..162065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0144"
FT                   /product="putative zinc ABC transporter, periplasmic
FT                   zinc-binding protein"
FT                   /note="identified by similarity to PDB:1PQ4_A; match to
FT                   protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01145"
FT                   /db_xref="GOA:Q2JPX6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX6"
FT                   /protein_id="ABD01145.1"
FT                   /translation="MTDRLNSLRSVRSMRLLVSLVAALSVGILGSLQMRQEESRAQQGS
FT                   SPPKVVTTILPITQFTRAVAGDRAEVTPLLPPQMGPHDFQARPEEVRLLAQADVLVING
FT                   LGMETFLEGLIASAGNPQLQIVDSSEGIPTLRAEEPEHGHSHGHGHGHSHGHSHGHSHG
FT                   HGHGHSHGHSHGEFNPHIWLDPRRAIQQVENIRDGLISVDPAGAEIYQANAAAFIEKLK
FT                   ALDEEIAARLAPFAGRSFVVFHDFAPYFAERYNLKAEFLVEIPEANPSPEDVRRVMETV
FT                   RESGLKTILVEPQLGSNNPFEVLARDLGIQVRVFDPIETAGPEGIEPEYYLTILRQNVE
FT                   NLVSAFEKETAFLPLQLPLLGQAALEHLLARGR"
FT   gene            162062..162862
FT                   /locus_tag="CYB_0145"
FT   CDS_pept        162062..162862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0145"
FT                   /product="manganese/zinc/iron chelate ABC ransporter (MZT)
FT                   family, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q55281; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01146"
FT                   /db_xref="GOA:Q2JHQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ8"
FT                   /protein_id="ABD01146.1"
FT                   /translation="MISCSGEVVLRVEGLTVYRGSQLAVQNVSFELRAGSHTAVVGPNG
FT                   AGKSTLVQAILGILPRQCGSVWILGEPVRLSGYLPPSVRQQVAYVPQRFQFNPGIPMVV
FT                   EEFVALGWGALQPRWPWQQRSARQQAVQEALERAGASHLSSKALGQLSGGELKRVLLAY
FT                   CLAWPRRLLILDEAPAGLDTLSEGEFYRLLEELRQSLGWTILQISHDLEMVSCYCDRVL
FT                   CLNQSLICQGSPQVALAPEVLSRVYGPVRDSGAEHHFVRYIHRH"
FT   gene            162873..163709
FT                   /locus_tag="CYB_0147"
FT   CDS_pept        162873..163709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0147"
FT                   /product="manganese/zinc/iron chelate ABC transporter (MZT)
FT                   family, permease protein"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01147"
FT                   /db_xref="GOA:Q2JHQ7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ7"
FT                   /protein_id="ABD01147.1"
FT                   /translation="MLEGWVRVVELLQLPFMQRAMLGGILTGMTGGLLGSFVILRQLSF
FT                   FSDALGHSALLGIVLGVLLGLNPTVVLMVFGVGFALGVTFVLERTQLSADAVLNIIYSS
FT                   SLALAVIALSLLPGYRGNLNQLLFGEILGISPAALWTSGILLLISSAYVGLTLPSQMLL
FT                   TLDEPLARARGVQVGWQKLAFVVLLAVVVALAIRSVGVLLVSAFVVIPASTARMLGSRF
FT                   TTYVLLAIGIGGLSAVLGMIASATFNLPSGPSIVATQLLFFLLAMALKGVSQLLQL"
FT   gene            complement(163678..164529)
FT                   /locus_tag="CYB_0146"
FT   CDS_pept        complement(163678..164529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01148"
FT                   /db_xref="GOA:Q2JHQ6"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ6"
FT                   /protein_id="ABD01148.1"
FT                   /translation="MRRRILQLCILGWTMLLVLAVGGRGSLPVPHFFGIEALQAQAQTQ
FT                   AGELPQPMRLKLPPGLDRYAYDKAVGDYFEEIEPLLPGGAYAQWAFYPVPIYIQGDHPQ
FT                   WKASVEQAVKEWSAYIPLKVVAKEEEAFYGMSIYRVPPIGGGVAGAARPEFFFASDGSL
FT                   QQRVRIVIAEGQGLAEITAVARHEIGHGLGLWGHSPNLRDLMYGGHHAAATGNRRVLRV
FT                   PNITKRDLNTLKRVYEQPTLSGQVFPESYRRLFGQLLQEKPLPERALGLPLARAAGVAT
FT                   PP"
FT   gene            165050..165229
FT                   /gene="rpmF"
FT                   /locus_tag="CYB_0148"
FT   CDS_pept        165050..165229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="CYB_0148"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01149"
FT                   /db_xref="GOA:Q2JHQ5"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JHQ5"
FT                   /protein_id="ABD01149.1"
FT                   /translation="MPVPKKKTSKARSRRRYAVWLGKAKLQAQRAMTIGRAILSGRNTG
FT                   FYYPKAKSEEDEEE"
FT   gene            165341..165757
FT                   /locus_tag="CYB_0149"
FT   CDS_pept        165341..165757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0149"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01150"
FT                   /db_xref="GOA:Q2JHQ4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ4"
FT                   /protein_id="ABD01150.1"
FT                   /translation="MRSLTSLTYYQRLGLSPGASPEAIRRAYRQLSKRYHPDTSPLAPE
FT                   VAIRCFQELQEAYLVLSNPTKRAIYDASLRAVTANTGSLSMTGSLGADSLELRMETRPL
FT                   SAGELCALLLMGSTLVVCLVLAGVLAWLRESGAS"
FT   gene            165885..166148
FT                   /locus_tag="CYB_0150"
FT   CDS_pept        165885..166148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91454.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01151"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX5"
FT                   /protein_id="ABD01151.1"
FT                   /translation="MPLPPATTPLYNHPLHTIERWLEDQGCTRDPQDVEQWFCERPGWK
FT                   AILRLEETSIWVRYTYPDGNTKTLSFPYSLSRQDVEQAIFES"
FT   gene            166156..166914
FT                   /locus_tag="CYB_0151"
FT   CDS_pept        166156..166914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0151"
FT                   /product="glyoxalase II family protein"
FT                   /note="identified by similarity to SP:P72933; match to
FT                   protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01152"
FT                   /db_xref="GOA:Q2JPX4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPX4"
FT                   /protein_id="ABD01152.1"
FT                   /translation="MRVLQLPALRDNYIYLLHNPDTATAAVVDPAVAEPVLEKLAELGA
FT                   ELVAIFNTHHHHDHVGGNRQLLERYPRARVYGSQVDRGRIPGQTVELKAGETVEFAGRL
FT                   AKVLFVPGHTRGHIAYYFSESGDLFCGDTLFAGGCGRLFEGTPEQMVGSLDQLRQLPEA
FT                   TRVWCAHEYTLNNLRFALTVDGDNPDLQARYQQVAALRQTGSPTVPSTIGEERRTNPFL
FT                   RWDQPALQAATGLQDPVRVFARLRGMKDQF"
FT   gene            complement(167037..168230)
FT                   /locus_tag="CYB_0152"
FT   CDS_pept        complement(167037..168230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0152"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01153"
FT                   /db_xref="GOA:Q2JPX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX3"
FT                   /protein_id="ABD01153.1"
FT                   /translation="MPDSPSALRFIVLLGIVSLCADATYEGARSISGAFLGSLGASGTV
FT                   VGLVAGGGELLAYGLRLGVGYWSDQLGRDPLHRSRGHWQLTTLGYVINTAVIPALAWVG
FT                   SWPWAAVLLLAERTGKGIRTPPRDVLLSHAALQVGRGLGFGLHETLDQIGAVAGPLLVA
FT                   AMLGAGYGFRGAFLALGIPAAIGLGVLGLAQWLYPSPRDFEPEPEMTSAKGLPRVFWLY
FT                   LLAAACVAMGFADFPLIALHLQQQSGSDGAGIPLLYALAMGVDALAALGCGWLFDRVGL
FT                   WSLLGAVAVSAGFAPLAFSGTYALTVLGMVLWGIGLGAQESIMKAAVAGMVAPETRGFA
FT                   FGLFTSVYGLAWFVGSALMGVLYDFSLTGLVLFSVVTQGLGAAILLALVSRRQAEVG"
FT   gene            complement(168273..168617)
FT                   /locus_tag="CYB_0153"
FT   CDS_pept        complement(168273..168617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT65828.1; match to
FT                   protein family HMM PF02641"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01154"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX2"
FT                   /protein_id="ABD01154.1"
FT                   /translation="MLDDEPEVYKLDIYIGESDRWQGKPLYLALLELGRQRGLAGGTVV
FT                   RAIAGFGRNSHIRSSNLLELSTDLPILVTFIDTPEKIKAFLPEVKTLMHDGLVTCHRVQ
FT                   VFHHVPHQQQ"
FT   gene            complement(168927..169358)
FT                   /gene="crcB"
FT                   /locus_tag="CYB_0154"
FT   CDS_pept        complement(168927..169358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="CYB_0154"
FT                   /product="crcB protein"
FT                   /note="identified by match to protein family HMM PF02537;
FT                   match to protein family HMM TIGR00494"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01155"
FT                   /db_xref="GOA:Q2JPX1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPX1"
FT                   /protein_id="ABD01155.1"
FT                   /translation="MRLQSVWAYLNHGLVSPSLRVPFAVALGAIGGSLSRYYLSLWFAE
FT                   RFGPSFPYGTLIINLSGCVVMGWFMTVAMERPEISPEIRLLFGVGFLGSYTTFSTYELD
FT                   TFSLWQQHRFATGLVYWLGSCLFGALAMELGILLARLWR"
FT   gene            complement(169411..171030)
FT                   /locus_tag="CYB_0155"
FT   CDS_pept        complement(169411..171030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0155"
FT                   /product="sodium/hydrogen exchanger/universal stress family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00582;
FT                   match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01156"
FT                   /db_xref="GOA:Q2JPX0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPX0"
FT                   /protein_id="ABD01156.1"
FT                   /translation="MGFFVGQIVGRLGMPPLLGMILVGILLGDVLSPEVLAAAGDLRVV
FT                   AVMIILMKAGLGLDREKLAQQGSVALRLGFLPAACEAVAVALLSTWILGLDWPTGLLLG
FT                   CVIGAESPAVIVPGMLRLKSLGWGVTKGIPDAILTGSALSDVLLLLGFSLLLSFLGQGS
FT                   AASVRLGSLELSPLQWLPFQVVMEILLGVAVGYLGARVLVSLLTQQNWTRNSVQEVLLA
FT                   ACMALGLVLAPQVWPYFSGYLAVMAMGFFLIELDAPLARRLRGGFDALWTVAEIVLFVL
FT                   LGASLDLGVLGSVFWPGLLLLTLSLLLGRGLGWWLSTLGSNWNGRERLFLLPGNMAKAT
FT                   VQAAIGGIPLAQGIPGGEIILALAALSILVTAPLGAWLTQVCAPRLLEKGEVDPTKVGS
FT                   QGKVSFLAAVDTSPLAEAVLRKVADLARRVDGEVIVLHVTDKPQGKGVELLRQLTQRLL
FT                   ADIRHQFCLASGPLAETIVTLAQERQVTDIVMGKRGHRGWEQVLVGSTSQAVLETSPIP
FT                   VILVEEEDFKRSRIPISEGRKS"
FT   gene            complement(171358..171999)
FT                   /locus_tag="CYB_0156"
FT   CDS_pept        complement(171358..171999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22030.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01157"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW9"
FT                   /protein_id="ABD01157.1"
FT                   /translation="MSPEGGAPADPSPSSWDPSLDKAHLDLRAARCGQVDLETDRETLA
FT                   RYLRGHAQWIQRCFRPLQVEALSAETYRLQFFRMGGLGFELEPSFGVKIWPDKDYRFCL
FT                   TSIELPGDEGMPYRVSCQADFRLEELQGSLKDLPTTRVHWSLHLEIGLALPRFLQVLPR
FT                   KLVYRVARQVVQQVTRGMSDRLTHNVCSDFYRSIGCPDHPYRLIAVEDKA"
FT   gene            complement(172007..172630)
FT                   /gene="hisIE"
FT                   /locus_tag="CYB_0157"
FT   CDS_pept        complement(172007..172630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /locus_tag="CYB_0157"
FT                   /product="histidine biosynthesis bifunctional protein
FT                   HisIE"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="identified by match to protein family HMM PF01502;
FT                   match to protein family HMM PF01503"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01158"
FT                   /db_xref="GOA:Q2JPW8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW8"
FT                   /protein_id="ABD01158.1"
FT                   /translation="MAWLGSLTYNEQGLIPAIVQDYLDGTVLMMAWMNRESLQKTLETG
FT                   RTWFWSRSRQALWPKGETSGHVQWVKQIRYDCDGDALVILVEQVGDAACHTGARSCFFR
FT                   PLQGDPIPAADTLSQVFAVVKARQADPRPDSYTSSLLAKGENAILKKLGEETAEVVMAA
FT                   KDQDRVALAREMADLWYHCLVALAHYQVDVRDVYRQLQARRSAK"
FT   gene            complement(172724..172831)
FT                   /locus_tag="CYB_0158"
FT   CDS_pept        complement(172724..172831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01159"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW7"
FT                   /protein_id="ABD01159.1"
FT                   /translation="MLAWAAGLLNGFSKLALAWRALLEVPLGELALLSC"
FT   gene            172909..173700
FT                   /gene="phnC-1"
FT                   /locus_tag="CYB_0159"
FT   CDS_pept        172909..173700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC-1"
FT                   /locus_tag="CYB_0159"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.28"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01160"
FT                   /db_xref="GOA:Q2JPW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPW6"
FT                   /protein_id="ABD01160.1"
FT                   /translation="MRIQVENLWVAFKNKVALREVYLDLFGDGAQVVALIGPSGAGKST
FT                   FLRLLKGMVKLSGGKVWVDSLPLHEGQRDALQQLRRRTAMVYQTFQLIGRLTVLENVLV
FT                   GRLPHMSPIRGLFKHFSVQDLAKAEKLLEEVGLLEHAWQRADALSGGQQQRVGIARALI
FT                   QEPALILADEPISALDPKNAKVIMELLLGAVRRQGIPLLVTLHHLEMVRHYADRVVAFK
FT                   EGQVFFNGPLSDFTSEKEKELYFGEKETHEASEWFSSTLMV"
FT   gene            173747..174643
FT                   /gene="phnD-1"
FT                   /locus_tag="CYB_0160"
FT   CDS_pept        173747..174643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD-1"
FT                   /locus_tag="CYB_0160"
FT                   /product="phosphonate ABC tranporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01098"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01161"
FT                   /db_xref="GOA:Q2JPW5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW5"
FT                   /protein_id="ABD01161.1"
FT                   /translation="MRRRKILFLAAFLMGISSWVPGLAQKQNWPKELVIAEVPVESAAD
FT                   YEARYAPFLDYLKQKLGIPVRLFVAGDYTAVMVSQAQGQTHVAFYGPGSYVDAIEKANA
FT                   PIEAFVKEDSLRSGTVYHSLILSKKGSGIKTLEDAKGKDFAFVDPESTSGFKVPMAYFC
FT                   LEAKIKPKEYFKRVAFAGTHESVILGIAQGTIPVGVTWDTGISIATNKGQIKGIEDLEV
FT                   IWRSDPIPSSPWAYRKDLPEDLKEALRTAYLEYENTPEGQKWLEARGLKGFEPASDADY
FT                   DPFRKVNDALKKPECQL"
FT   gene            174612..175430
FT                   /gene="phnE-1"
FT                   /locus_tag="CYB_0161"
FT   CDS_pept        174612..175430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE-1"
FT                   /locus_tag="CYB_0161"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01097"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01162"
FT                   /db_xref="GOA:Q2JPW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW4"
FT                   /protein_id="ABD01162.1"
FT                   /translation="MLLRNLSANSRRLPPLPAELKRRELITVVLYGGVFLALLLTAEPA
FT                   GISPGKLLAGLGRSAAFLARFFPPSFYFLPNFLYSLLQTLMMALWGTFLATFLTVPLAF
FT                   LGSRNVMRSPAVYLLVRGLMDVLRGLNELVLALVFVAAIGLGPLPGILALTLHTAGVAG
FT                   KLLSEAIETVDMKQVEAVEATGSHPLLVIAYGFWPQVAPAFYSSTLYLFEVNVRSATVL
FT                   GLVGAGGIGFDLMQTIRAFRFQDAATVVLLILLAVFTIDKVSARIRQTLI"
FT   gene            175440..175859
FT                   /locus_tag="CYB_0162"
FT   CDS_pept        175440..175859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0162"
FT                   /product="putative phosphonate metabolism protein PhnG"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01163"
FT                   /db_xref="GOA:Q2JPW3"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW3"
FT                   /protein_id="ABD01163.1"
FT                   /translation="MQPLEMLELLQEAPEKEVLALAREVRPALGSSQKLREGAGLLALP
FT                   FEDSRTGTPFYVGEVLVYEVWLRFPKKGVEGYGMVLGEKPRLARALAYLDAALQAGIAV
FT                   EKIQALALAAQKDLQEEDERLWRKVAATRLEVETL"
FT   gene            175868..176437
FT                   /gene="phnH"
FT                   /locus_tag="CYB_0163"
FT   CDS_pept        175868..176437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="CYB_0163"
FT                   /product="phosphonate metabolism protein PhnH"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01164"
FT                   /db_xref="GOA:Q2JPW2"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW2"
FT                   /protein_id="ABD01164.1"
FT                   /translation="MSKAYGPTPGLAEKQSQQVFRALVRALSYPGRLESFPARSLRQAF
FT                   RLIGLTLVDGNVGVWAPSWLLSDLRGQDPRPVALEAADFVFAEQLESLPAGPDSLLALK
FT                   RGTHLEPEAGATLILGAPLGRGSPVLLRGPGIAGEIQLAVGLPSLFWQLRSQILAYPLG
FT                   VDILLTDGPQVVGLPRSVEVGGWAMS"
FT   gene            176422..177474
FT                   /gene="phnI"
FT                   /locus_tag="CYB_0164"
FT   CDS_pept        176422..177474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="CYB_0164"
FT                   /product="phosphonate metabolism protein PhnI"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01165"
FT                   /db_xref="GOA:Q2JPW1"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW1"
FT                   /protein_id="ABD01165.1"
FT                   /translation="MGYVVARGSQEAILNAEALFRELLSAAEAKSRRGRTKQLAGLPYL
FT                   LDHVMAEAGLWAPELAATALVQTGGDLYEALLLLRAHRTTLPRLGKAQLQKKEDLLLVR
FT                   RLSSAFKSIPGGQVLGPTLDYSLRLLGFSESPPLEPAAVAAAQHYPSVRSWLREQGLLE
FT                   EDPTAEQQASSPAPGEEIPDLTRQPLLFPAPRAHRLQALARGDTGGLLALAYSAMRAYN
FT                   VHTHPTVAELGVGYLEVRAFHPVRGGSFRLGRIRLVFTEVVGHGEKGYRLGFAASLGWN
FT                   EGRAIAGAMLDLEMDRPSHPARSEEFVLVHTDPVEASGFALHYKLPHYVTFLSNWMSHF
FT                   QKEASLETQA"
FT   gene            177458..178324
FT                   /gene="phnJ"
FT                   /locus_tag="CYB_0165"
FT   CDS_pept        177458..178324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="CYB_0165"
FT                   /product="phosphonate metabolism protein PhnJ"
FT                   /note="identified by match to protein family HMM PF06007"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01166"
FT                   /db_xref="GOA:Q2JPW0"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPW0"
FT                   /protein_id="ABD01166.1"
FT                   /translation="MKPKHSYAYLDLEAKREIRRKVLKALAIPGHQVPFASREMPLARG
FT                   WGTGGLQLTLSLVGPQDVVKVIDQGADDSVNAANLRRFIAQVSGARTTTDTLEATLIQS
FT                   RHRIPEERLQEGQILILQVPIPEPLRYVEPSDARARELHALGDYSLLWVDLFEEHLRHG
FT                   QSRKGAAYPVLVHGRYGMDPSPLPRWDLPKLHLAAHITLFGAGREKRLYAVPPYTRVEP
FT                   LAFVDRPFQPEPILGSCRRSGCRHVFLNAIPQEDGSLAYEISDQGYMEKLLAGKTSGPL
FT                   FVEKEHG"
FT   gene            178317..179084
FT                   /gene="phnK"
FT                   /locus_tag="CYB_0166"
FT   CDS_pept        178317..179084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="CYB_0166"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01167"
FT                   /db_xref="GOA:Q2JPV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV9"
FT                   /protein_id="ABD01167.1"
FT                   /translation="MAEETPLLELVKVCKAYGDRWALKNVSLKLYPQEVLGVVGASGSG
FT                   KTTLLKILYLQETAQGEYRLNVPGWEGRNLLLLSRYEQPAARHYLAMVYQDAAQALRMG
FT                   FAALTNVAEPLVLRGERRFGVLEAEAQEALERADFPLERAGDPPASLSGGERQRVQIAK
FT                   ALVQKPLAVLLDEPTTGLDLLVQATFLDTLRRLKRQLGMSLILVSHDLSVVRAVADRIV
FT                   VLYQGEVVEEGLADQVLEDPRHPFTQDLVAARL"
FT   gene            179095..179790
FT                   /gene="phnL"
FT                   /locus_tag="CYB_0167"
FT   CDS_pept        179095..179790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="CYB_0167"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01168"
FT                   /db_xref="GOA:Q2JPV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV8"
FT                   /protein_id="ABD01168.1"
FT                   /translation="MLQVVNLEKRFFLHRLGREVLAFQQVSFSLQAGEFLLLEGPNGSG
FT                   KSSLLRTLYRSYWPTAGQALLQTPLGTVDLARLGDREVLAIRRERIGYVSQFLDPRPRT
FT                   TALELVAEPLLWQGVAENQARHRAAELLLELGLKPELLETFPTSFSGGEKQKVNLARSL
FT                   IHPYPLLLLDEPTASLDTAAKLALRERLRALKQQGTAIIGVFHSLDDVSGLVDKTYSLE
FT                   VRANVASRA"
FT   gene            179771..180910
FT                   /locus_tag="CYB_0168"
FT   CDS_pept        179771..180910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0168"
FT                   /product="putative phosphonate metabolism protein PhnM"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01169"
FT                   /db_xref="GOA:Q2JPV7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV7"
FT                   /protein_id="ABD01169.1"
FT                   /translation="MWLAGPKLVLPDGVLPVGSLRLEEERIAEIRQGQVGEGIPLRGLT
FT                   LVPGVVDLHTDSLEPELEPRPGVQLAVDMALGIWENRALAAGITTAFVTLSFWEGLPGW
FT                   RSPETALAMAEQLVALRSQLALDLRIHARYELSRPLGAAAVRQALSQGWVDLLSFMDHT
FT                   PGQGQFRTPEDYIRYMARHLARPSEEVAASLAAKAGEETLQSFAQLAQQAQALGVPLAS
FT                   HDDDCPAKVQLMAKMGLKISEFPVTLAAALEARKLGLLVVMGAPNALRGSSHVGNLSAS
FT                   EALQVGALGALATDYSPASALRAAFALAEKQLLDLPQAIALVTHNPAQAVGLQDRGALR
FT                   PGLRADLVVLREKPFQVMGVFVAGRPVFLRDSLCWRGVF"
FT   gene            complement(180951..183122)
FT                   /locus_tag="CYB_0169"
FT   CDS_pept        complement(180951..183122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0169"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01170"
FT                   /db_xref="GOA:Q2JPV6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV6"
FT                   /protein_id="ABD01170.1"
FT                   /translation="MILLGFGTGALVAWATAHPDWVSRLPGLSPPLAEIPAPRAHAKAA
FT                   QQRLPISLETQLERDPFALDPLASLSYVPAIMYHDVVAGRKQVWFDTTAAELRQHFEAI
FT                   KQAGLTPIHIDQLYKHLRDGDPLPEKAILLTFDDAYLGLYENAYPLLKEYNYPATYFVQ
FT                   TGFVGVPTSKDHFTWDQMREMDASGLIDFAAHTVNHPPDLRVLDDARLRREVFDCKAKL
FT                   EQELGHPIHYFAYPEGNRDERVKQYLADAGYRMSFTMDPGFTGQSPNLLEVRRFNQFRI
FT                   TEAIIGARTFSLNRSPDYRLDVTQPLALTDEVINQVRVLTLRGGRAATVHAERRYEVST
FT                   LAQRYQADAGINGSFFSIPWINSASNVMVGPAMAANHKTFIPGRPEDDQAIRGRPLVLL
FT                   GRDRLRFVPFDPDTMTHLENIRQLMPDVTDLFVAGLWLVKDGHALSPAEINSFRLASAA
FT                   EFRPRAFFGVDDQERVVIGVTKTHVNAAILASLLPKTGIREAVLLDSGFSTSLVYQGEI
FT                   LATGHAGPNQPSRPVPHAILLYDLTRLWREDPHPEAKAGSEGDQLEGLVQLLPASDQDA
FT                   AKAQLESVLASQRTLRRGDRGAAVVAVQLGLSHLATQQGRLDLLPSGPDGVYGQELAQA
FT                   MAELVLAAPERSEMGSPLPATPTPLVAGTATARQGVDIIDAQLLRRLLERVNLASPSVL
FT                   VDTRLERPALSLERKPTRKLLPRVAFGQD"
FT   gene            complement(183572..183931)
FT                   /locus_tag="CYB_0170"
FT   CDS_pept        complement(183572..183931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0170"
FT                   /product="CpcD/allophycocyanin linker domain protein"
FT                   /note="identified by match to protein family HMM PF01383"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01171"
FT                   /db_xref="GOA:Q2JPV5"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV5"
FT                   /protein_id="ABD01171.1"
FT                   /translation="MEAEDDHIAGSYKVVYRLAPAYPRSWRLLLERESVATAPQVASAP
FT                   EPEVAQASSSEGGLPNSDKIFAIKVSGLVGGGVRRSVVEYKVPFSRLSQEVKRITQMGG
FT                   KIVSIAESNLLSTLE"
FT   gene            184303..184857
FT                   /locus_tag="CYB_0171"
FT   CDS_pept        184303..184857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2054"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01172"
FT                   /db_xref="GOA:Q2JPV4"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV4"
FT                   /protein_id="ABD01172.1"
FT                   /translation="MNLLSLALPDLSAASDGLAATLQPVAQFFAGLNLPQPIVQWGHPL
FT                   MMGIVVVVMGSFVGLTGWRGRALRLAAASTAPEGSLPEAAQKPLLDHRKLAPWMATFIA
FT                   LGYTGGLLSLVMQGKPLLSSPHFWTGSLVLLLLAVNGALSLSGFGGNRAALRTTHAYVG
FT                   SLILCVLFAHALLGLKLGLSL"
FT   gene            complement(184891..186201)
FT                   /locus_tag="CYB_0172"
FT   CDS_pept        complement(184891..186201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0172"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01173"
FT                   /db_xref="GOA:Q2JPV3"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV3"
FT                   /protein_id="ABD01173.1"
FT                   /translation="MGVSYRRSNRAKAVLEGRGFRPSFLVKFGTARIRDCLKLLLNPVS
FT                   QVTASMRPTSLPPPERKAFMNWLMLLGLLCLPASLFSFVEYLRSQRLVQQLSATRLLKI
FT                   AELRHLGQTNPQAKGANLAQVYGRVVCDRPLVSELSRQPCVYYKSEISWEYDEIECYRR
FT                   YLNSRGDVAYSERISEGEYQNALRLGSRAKSYPGEMVGKKPGLGYSDSGSFQKRVDPDY
FT                   SNSFPQKPNPGYPQQLGSPGYPQKSPFSEVSSPQKHYANVYYDPSTGREYLLERETRTR
FT                   DETLHSVVRQIPFFIEDETGRVRVDPTGAEIEAMSVVDEHIFPGKGPSRFNFNLKRYLS
FT                   GVRTENRSTRAFIYKEWVIPVDAMAFTMGQVRFEAGDPVIRKPLSGERFMIAPKSPEAL
FT                   LEEQRSNASSYLVGSVVLLGIGIFTVLHLLQSLQPYR"
FT   gene            186543..186698
FT                   /pseudo
FT                   /locus_tag="CYB_0173"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error"
FT   gene            complement(186762..187454)
FT                   /locus_tag="CYB_0174"
FT   CDS_pept        complement(186762..187454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0174"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01174"
FT                   /db_xref="GOA:Q2JPV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV2"
FT                   /protein_id="ABD01174.1"
FT                   /translation="MPEPEPSSAHILVIEDEAKLARFVETELTCEGYRVSVASDGMAGL
FT                   RAACDQNPDLVLLDWMLPGISGLEICRRLRSTGNRVPVVLMTARDEVSDRAAGLDAGAD
FT                   DYVVKPFSIQELLSRIRIYLRQPRRSRDGQLVFMDLILDPVTREVTRGERQVELTAKEY
FT                   DLLRYLMEHPRQVLTRQQILEHVWGCDFTGDSNIIEVYIRYLRLKIEGPGEKRLIQTVR
FT                   GVGYVLRD"
FT   gene            187662..188435
FT                   /locus_tag="CYB_0175"
FT   CDS_pept        187662..188435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AI2283"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01175"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV1"
FT                   /protein_id="ABD01175.1"
FT                   /translation="MTLSPVRLTPPLPPIRWEKLPEDFPLPDEPVESTLQPLLAAALRE
FT                   ALELAQMIPAQALIASNFGLCSTVGDKVVVKAPDWVYVPAVQPIPEGEIRRSYTPHLEG
FT                   DPPAIVMEFISETEGGEYSINPHYPYGKWYFYERILQVPVYVIFHPKTGELDVYRLENG
FT                   RYTPVSADENRRYWIPEIGLFLGVWRGQKAETKANWLRWWTADGNLLLWGIEQVEQERQ
FT                   RAEAAEAALEQARLEQQRLAAKLRELGVDPEAIAD"
FT   gene            complement(188444..189625)
FT                   /locus_tag="CYB_0176"
FT   CDS_pept        complement(188444..189625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0176"
FT                   /product="glycosyl transferase, group 2"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01176"
FT                   /db_xref="GOA:Q2JPV0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPV0"
FT                   /protein_id="ABD01176.1"
FT                   /translation="MNGIPAWAGDAAALSLLVMQVPMLAVLLARLLPSLRRPSPLPPGQ
FT                   PGIPLQPGLVSVLLPTLNEAERIDPCLEGLHQQSSVLREVLVVDSRSQDGTPEKVLQMA
FT                   KRDPRFRLVTDDPLPNGWVGRPWALHYGFLQSDPASEWILGIDADTRPQPGLVERLLET
FT                   AQAQGLDLITLAPQFILQHWGEGWLQPALLVTLIYRYGAAGDTATLPERTMANGQCMLV
FT                   RRSVLEAMNGYTVARASFCDDVTLVRQIAAAGFKVAFYDGRHLLKVRMYTSFGETWREW
FT                   GRSLDLKDATPVAQLWGDIALLVLTQGIPGPVVVGLLGKAGMGFPFSLTEQVLLGLNLG
FT                   LLILRLGVLLGIRGSYQDPPWTFWMSPLADPLAVLRIILSALSRPRSWRGRTY"
FT   gene            189779..190126
FT                   /locus_tag="CYB_0177"
FT   CDS_pept        189779..190126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0177"
FT                   /product="anti-anti-sigma factor family protein"
FT                   /note="identified by match to protein family HMM PF01740;
FT                   match to protein family HMM TIGR00377"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01177"
FT                   /db_xref="GOA:Q2JPU9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU9"
FT                   /protein_id="ABD01177.1"
FT                   /translation="MDVFIRLSHKGSPVTVVKLHSERLNAAIAREVRKELSQILTEKPG
FT                   HFLLDLSQVSLIDSMGLSVLVWAHRHCRTLGYQLKFCSLQEQVKLLFSITGLDAIYEIY
FT                   PSVEKALESFP"
FT   gene            complement(190206..191030)
FT                   /locus_tag="CYB_0178"
FT   CDS_pept        complement(190206..191030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0178"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01178"
FT                   /db_xref="GOA:Q2JPU8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU8"
FT                   /protein_id="ABD01178.1"
FT                   /translation="MPQSKPQESPARKLLNILLLVVGTVTFLGFSFGPLFQALGPSESP
FT                   EASLVTEQLRAQADGYRVVLEREPDNPIALRGLIDTQLQLNEPQGAIEPLKKLVELEPE
FT                   NRQLRAFLAEIQQDTGDFEGALEQLQILYEGDPKDRQVLQQLVDVQLTLGRTSEAIALL
FT                   EKHLEEAPEDNDVRLRLAFVYARNNQTEKAVVLYDKLIAADPSDFTPVLGKAIALSSAT
FT                   DENLRAKAPELFEQAARLAPPQVREQIQQQAEIYAQVNRPQTVERQNDNPTP"
FT   gene            191204..192235
FT                   /locus_tag="CYB_0179"
FT   CDS_pept        191204..192235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0179"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01179"
FT                   /db_xref="GOA:Q2JPU7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU7"
FT                   /protein_id="ABD01179.1"
FT                   /translation="MRITCYPDNLTLEANPLLTVLENLLKAGVRHVHACGGNAACSTCR
FT                   ILILEGSQNCRSMTPAEKRLAQRLDLPVHIRLACQTRITGDVTLQRLVIDKADVEVAQH
FT                   QLQAHSVGSQVTAAILSASLRGTANFDEENFPYDVVYTLGRYFAQMGALVQQYGGVLAN
FT                   QSGLRSLALFGLKQPELAVQQALQAGLALGQSVAELNRCLRQLSYPQVKLTLGIHYGPV
FT                   LLLPLDPQDPQRLSAFGKSVQFATWLESVEDVSQGGEQSEEQSSRLLISAAVYRAVEGQ
FT                   LLQVEPLSVKPFPNAKPIRVYRVHPNPVSLPTGEEQAPEATKPEPLGWLEALREWLQAW
FT                   SRF"
FT   gene            complement(192245..194026)
FT                   /gene="sir"
FT                   /locus_tag="CYB_0180"
FT   CDS_pept        complement(192245..194026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sir"
FT                   /locus_tag="CYB_0180"
FT                   /product="sulfite reductase, ferredoxin dependent"
FT                   /EC_number="1.8.7.1"
FT                   /note="identified by similarity to SP:P30008; match to
FT                   protein family HMM PF01077; match to protein family HMM
FT                   PF03460; match to protein family HMM TIGR02042"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01180"
FT                   /db_xref="GOA:Q2JPU6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011787"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU6"
FT                   /protein_id="ABD01180.1"
FT                   /translation="MPPMIPSEAKRSKVEQIKADSHFLRDPLQQELAQDTTHFSEAAVQ
FT                   VLKFHGAYQQDDRDRRQQRKQEGLERAYSIMLRTRIPGGHVPPQLYLTLDRLADEYGNG
FT                   TLRATTRQTFQLHGILKKNLKATIASILKQMGSTLAACGDVNRNVMAPVAPYKNRPAYR
FT                   YAQEYARKLADLLAPKTSAYYEIWVDGEPVPIPPVDEEVVEAEKFVGNGVRLEGPEPLY
FT                   GPVYLPRKFKTAIAVAGENTVDVYSQDLGLIVLTDRKGNLKGFNIVVGGGMGRTHGKEE
FT                   TQPLLAQKLCFAPPESVYRVCQAVLAVQRDYGNRHDRKQARLKYLVRDWGIRKFRRVVE
FT                   QYLGEKLLPFRRMPKFVPNSDDYLGWHEQGDGRWFLGISIENGRIQDTPERQLKTALRR
FT                   IVEAFSLHVRLTPTQDLLFIDIAEQQRDAINQILKSHGVLSKEEIPQLVRLSMACPALP
FT                   TCGLAITESERALPGLVRQLDRLLQELDLQDSPFLVRMTGCPNGCARPYLAELGLVGSA
FT                   PNGYYQIWLGASPQGDRLAQVFQDRVHISQIVPLMRVLLQVYKQERRPGESFGDYCHRM
FT                   GIPYLQAQVQQRDGVFA"
FT   gene            complement(194180..196207)
FT                   /locus_tag="CYB_0181"
FT   CDS_pept        complement(194180..196207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0181"
FT                   /product="peroxisomal fatty acyl CoA ABC transporter
FT                   (P-FAT) family, transmembrane ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01181"
FT                   /db_xref="GOA:Q2JPU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU5"
FT                   /protein_id="ABD01181.1"
FT                   /translation="MSILLSPPTAKMESQASQFNFDRKLWDRFITVAQPYFYPRVRYGG
FT                   WIFLGLLAAAMVFVVALMFFVEIGVTLVGQALFPEFFTNVAAGLVAQTKRNLSSPVLWV
FT                   ASVSLALSSLCFGAVWRQLRQRWLQWALLTFLLFLSLTVNRLNVMISFIFRFIDTALQQ
FT                   KEEPTFWQFLIIYGVLIISAIPILVIYRYTRLKLGLFWREWLTDHFLDRYFNQRAYYEL
FT                   DSNAANTEIDNPDQRISEDVRSFTGTTLSFLLDILDSILTLYAFTGILYGISRPLALGL
FT                   VVYATIGTAIAILAGRKLIKINFDQLRYEADFRYSLVHVRDNAESIAFYQGEDQELRQI
FT                   LHRFGAALRNFNLLIIWQAIIDIFQYAYNYFTRIVPYVIVAPLYFSGVRDFGTITQATI
FT                   AFSQVLSALSIVANQIQSISSFAAGINRLGSFHESLEDPALRHTSARESNIQTRIAQQL
FT                   ALHHVTLLTPNSERTLVRDLSFALEADQRLLIVGVSGSGKSSLLRAIAGLWTNGQGSIA
FT                   RPDTQEMLFLPQKPYMLLGSLRDQLLYPKRRRDLTDEDLIRVLAQVNLGDLPERVGGFD
FT                   VEKDWASTLSLGEQQRLAFARILITQPRYAILDEATSALDVANEKLLYLQLQHLNTTYI
FT                   SVGHRPTLLAYHDLVLELQGNCAWQLWSVQEYGARLALAS"
FT   gene            complement(196291..197484)
FT                   /locus_tag="CYB_0182"
FT   CDS_pept        complement(196291..197484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0182"
FT                   /product="conserved hypothetical protein TIGR00299"
FT                   /note="identified by match to protein family HMM PF01969;
FT                   match to protein family HMM TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01182"
FT                   /db_xref="GOA:Q2JPU4"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPU4"
FT                   /protein_id="ABD01182.1"
FT                   /translation="MKIAYFDCAAGIAGDMCLGALLDCGVPLEYLNRQLQALGIEGEYG
FT                   LQVSRVQRCGQPALQAVVEVLGSQSGGSLARHWAEIQALIAGSQLSPAIKARSLAVFEK
FT                   LAQAEAKVHQMPVEEVHFHEVGAVDALVDIVGTCIGLDWLQVERVLSSPHPVGGGWVST
FT                   EHGKLAVPVPAVIELWEMGRVPVFSNGVEAELVTPTGAALAVALAEEFGPCPPMRVEKV
FT                   GRGAGAQELPIPNVFRLWIGEANGGELTETVSVLQTQIDDLNPQVIAYTCEQLLALGAW
FT                   DVFTQPITMKQGRPGILLTVICPPDRVPECQDLIFRETTTLGIRHFQQQRTLLERVVER
FT                   VETPYGLVDIKVARHHGRIVNAQPEFRDCVARAQEFHVPVQTVWLAAQSAWQNRLQG"
FT   gene            complement(197581..198018)
FT                   /locus_tag="CYB_0183"
FT   CDS_pept        complement(197581..198018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB1900"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01183"
FT                   /db_xref="GOA:Q2JPU3"
FT                   /db_xref="InterPro:IPR021855"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU3"
FT                   /protein_id="ABD01183.1"
FT                   /translation="MGKSSRQSKTFRRRSPSASVEVEQKPAKKEPVAVIPPEVSRRMVR
FT                   RILVFSGIPSGLGLSSFFVNYYLLTNHVVALPPYFTLAESLTLFGLGFLGISYGVFSAS
FT                   WDPEPGSLLGIGEFRRNLGNIIQQWRESAARSSESSDSREA"
FT   gene            complement(198055..198330)
FT                   /gene="rpsO"
FT                   /locus_tag="CYB_0184"
FT   CDS_pept        complement(198055..198330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="CYB_0184"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01184"
FT                   /db_xref="GOA:Q2JPU2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPU2"
FT                   /protein_id="ABD01184.1"
FT                   /translation="MALLQQEKQQIIESYRLHDTDTGSAEVQVALLTSRINQLSQHLQR
FT                   NPKDFNSRRGLLMMIGRRKRLLNYIAKHSPDRFRELAERLNIRVKK"
FT   gene            198423..199106
FT                   /locus_tag="CYB_0185"
FT   CDS_pept        198423..199106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0185"
FT                   /product="phycocyanin alpha subunit phycocyanobilin lyase,
FT                   CpcF subunit"
FT                   /note="identified by match to protein family HMM PF02985;
FT                   match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01185"
FT                   /db_xref="GOA:Q2JPU1"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU1"
FT                   /protein_id="ABD01185.1"
FT                   /translation="MTTTSGDPPALPALLELLNSQDLGNRLRAVNKARELPGSEALTLL
FT                   QRAITDENARVRYAAISQMGTLSGVDPNLLLPILQRSLREDPEFDVRAAAAAALGDLKQ
FT                   PQALADLLEAYRRETEWLVRFSIIAALGELGNPAAFDTLVEALQDKSELITTAAAAALG
FT                   DLGDPRAIPYLDPLIDSDDWQLRYRVCIALAKLGTEAARAGLTRLAQDSQEQVAVHARA
FT                   ALGSL"
FT   gene            complement(199111..199596)
FT                   /gene="apcD"
FT                   /locus_tag="CYB_0186"
FT   CDS_pept        complement(199111..199596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apcD"
FT                   /locus_tag="CYB_0186"
FT                   /product="allophycocyanin alpha, B subunit"
FT                   /note="identified by similarity to SP:P80556; match to
FT                   protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01186"
FT                   /db_xref="GOA:Q2JPU0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPU0"
FT                   /protein_id="ABD01186.1"
FT                   /translation="MSVINQIIETADDQLRYLSVSELEAIRNYMTTGERRLQIAQVLAE
FT                   NKKRIIDQAQKQLFAKRPEYVQPGGNAYGDKRYNQCLRDYDWYLRLVTYGIIAGSKEPI
FT                   ESIGLIGVREMYNALNVPIAGMIDAIVFLKEAALSLLEPAAAAEAAPYFDYIINAMS"
FT   gene            complement(199788..201146)
FT                   /gene="pilT-1"
FT                   /locus_tag="CYB_0187"
FT   CDS_pept        complement(199788..201146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-1"
FT                   /locus_tag="CYB_0187"
FT                   /product="twitching mobility protein PilT"
FT                   /note="identified by similarity to GB:AAB30824.1; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01187"
FT                   /db_xref="GOA:Q2JPT9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT9"
FT                   /protein_id="ABD01187.1"
FT                   /translation="MLGSASQGMGSRPVNAKSPPNPILGRPLPPGVAVAPPQVPVPVPD
FT                   PVAPPRMPPPTPAPAAAARPPVSPPVPTPAAPPFAPPARPTAAGRIPVAPAAPAGLTLR
FT                   QLVQEAYDKGYSDIHLGVGEVPRFRDRGQMLLTNYPVTTTEMFYGWLRESLPESQIRQF
FT                   EECLELDTAIQYEGLVRCRVNCFVSLLGPAMVMRLIPLKILTLEQLRAPEVLKRIAEEH
FT                   KGLVLVTGPTGSGKSTTLAAMVDYINSNFPKHIISIEDPIEFVHQSKKSMVRQREVGIH
FT                   TLEFANALKASLREDPDIILIGEMRDRETVDIALKAGQTGHLVFGTLHTNSAVRTIERL
FT                   LGIYKPEEQEPMRLQLAETLVAIIAQTLVRTTDGKRAAAHEIMRNTDAIRDYIKRGAVD
FT                   EIEELIADGSYEGMCTMNQSLFRLYQEGRITEEVCLEAAPRRNEMAQWLRGRI"
FT   gene            complement(201389..202078)
FT                   /gene="folE"
FT                   /locus_tag="CYB_0188"
FT   CDS_pept        complement(201389..202078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="CYB_0188"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01188"
FT                   /db_xref="GOA:Q2JPT8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPT8"
FT                   /protein_id="ABD01188.1"
FT                   /translation="MTLAKPGSGSQSRMDDKAHFKSRVIRDRATFAEEELGSSDVSDPA
FT                   MVAAVETLLRGIGEDPQREGLRKTPERVVAALKFLTSGYRQSLEELLNSAIFDEGHDEM
FT                   VLLRDVSLFSLCEHHLLPFIGKAHVAYIPKQKVVGLSKIARIVEMYSRRLQVQERLTRQ
FT                   IAEALMEVLDPYGVGVVIEATHMCMVMRGVQKAGSWTVTSSMVGVFQEDPRTREEFLSL
FT                   IRHPSNF"
FT   gene            complement(202191..202922)
FT                   /locus_tag="CYB_0189"
FT   CDS_pept        complement(202191..202922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0189"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01189"
FT                   /db_xref="GOA:Q2JPT7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT7"
FT                   /protein_id="ABD01189.1"
FT                   /translation="MSFETKFPERALITGASRGIGRAVALALARQGIAVALVARSQPDL
FT                   LAVQAQIQAQGGKAAVFPMDLADLAALPQQLQALLDRFGVCDVLVNNAGMAHVGPLATL
FT                   PLSDWQRVIDLNLTAAFLCAQAVLPGMRRQRCGTIVNVISIAGKRAFPNWGAYCASKFG
FT                   LMGFSQALAEEERQHGIRVTSLCPGAVDTSLWDTGTVGVNFDRSKMLSPEWVADLITYI
FT                   VRLPTGAVVEDLTFMPAVGAF"
FT   gene            203165..204388
FT                   /locus_tag="CYB_0190"
FT   CDS_pept        203165..204388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0190"
FT                   /product="ferric iron ABC transporter (FeT) family,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01190"
FT                   /db_xref="GOA:Q2JPT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT6"
FT                   /protein_id="ABD01190.1"
FT                   /translation="MAESLFSPSPTAAREDPSYILQLEGISKGFPGQRQLVLREVEFRL
FT                   PQGDILSIVGPSGCGKTTLLRTIAGFEQPDSGRILLGGQVVAGEGQWIPPERRGVGLVF
FT                   QDFALFPHLNVLANVMFGLRPTTPFASAAGGGNRSSSTELRAELQGAAQQARERAYEVL
FT                   RLVGLEDYTHRYPHELSGGQQQRVALARALAPKPSLILLDEPLSNLDVQVRYYLREEIR
FT                   KILKQTQTSAIFVTHDQEEALCLSDWVAVMREGRIEQWGSPEEVYREPATRFVAEFITQ
FT                   ANFLRCERREFGWQAEELLHIPFQALRDQPDPSLRCAELMVRQEELHLHPDPQGGIVIR
FT                   DRQFLGREYRYSLITAAGKELHALAREALPVGARVHIAVGQGRLFPLAEGSSVAEKEPN
FT                   RAKSKSVA"
FT   gene            204872..205585
FT                   /locus_tag="CYB_0191"
FT   CDS_pept        204872..205585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0191"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01191"
FT                   /db_xref="GOA:Q2JPT5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT5"
FT                   /protein_id="ABD01191.1"
FT                   /translation="MENRIALAEFRVGVDAVIFSIDTEQNRLLVLLVRRREDPFRGCWA
FT                   LPGTLVRRSESLEAAAYRILAEKIRVRNLYLEQLYTFGGPERDPREAEDGYGVRYLSVS
FT                   YFALVRFQDAELLADGVEGIAWYPADQIPPLAFDHEEICRYARRRLCAKLEYSPIAFDI
FT                   LPATFTLGEVYQLYGTVLGEGFSDYSNFRARLLKLGILQDTGQKSSQGTGRPATLYRFD
FT                   AAAFEKIRHKPMVFV"
FT   gene            206258..206599
FT                   /gene="trx-1"
FT                   /locus_tag="CYB_0192"
FT   CDS_pept        206258..206599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx-1"
FT                   /locus_tag="CYB_0192"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01192"
FT                   /db_xref="GOA:Q2JPT4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT4"
FT                   /protein_id="ABD01192.1"
FT                   /translation="MSAAIDIADATFEAEVLRSDIPVLVDFWAPWCGPCRMVAPVVQEI
FT                   AEQYVGKVKVVKINTDENPQTASQYGIRSIPTLMLFKGGQKVDVVVGAVPKATLTTILE
FT                   KHFDTPAEA"
FT   gene            206714..207784
FT                   /locus_tag="CYB_0193"
FT   CDS_pept        206714..207784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0193"
FT                   /product="conserved hypothetical protein TIGR00730"
FT                   /note="identified by match to protein family HMM PF03641"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01193"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT3"
FT                   /protein_id="ABD01193.1"
FT                   /translation="MTDSVSSLLQEVFSNAETRLKQLEYHPNRTAWLRILQSLQRMGSL
FT                   ELSRLDAKILAATLEDLEQGFAAFQNYAHQRKITVFGSARLGPESPEYRQAQLFAYCIS
FT                   QRGFMVMTGGGGGIMEAGNRGAGLENSFGLNIQLPFEQMANPVIAASDRVINFKYFFSR
FT                   KLFFVKETDALVLFPGGFGTQDEAFECLTLMQTGKTKLMPLVLVDRTGGCYWKEWDEYV
FT                   REHLLGRGLISPEDLFLYTLTDDVGDACQQIVDFYRVFHSNRYVRELLVLRLNTRLSLE
FT                   ALDILNEEFADILDSGRIEQTGALPEEAEEDIAHLPRLVMHFNQRNFGRLWQMVRRINK
FT                   LHPEQPDPLQMRPEQK"
FT   gene            207847..208548
FT                   /gene="trpF"
FT                   /locus_tag="CYB_0194"
FT   CDS_pept        207847..208548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="CYB_0194"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by similarity to SP:Q56320; match to
FT                   protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01194"
FT                   /db_xref="GOA:Q2JPT2"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPT2"
FT                   /protein_id="ABD01194.1"
FT                   /translation="MGRLFVKICGITRQDQAEAIAALGVSALGFIAVPNTPRYLPLSEM
FT                   ARWVGSLPGPVEKVGVFLDQDPRAIAAWVETVGLTAVQLHGQESPQDCQQLGEWLPGIR
FT                   RIKALRVRQPQDLEVANLYRDCVEMLLLDAYHPQQAGGTGRTLNWPELARLSRERALPL
FT                   PWLLAGGLNPDNVLQALSHLQPSGIDLSSGVERRPGDKDIDKVRHLLQQLGSQGWEIAP
FT                   TLPPITPSATG"
FT   gene            complement(208565..209434)
FT                   /locus_tag="CYB_0195"
FT   CDS_pept        complement(208565..209434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01195"
FT                   /db_xref="GOA:Q2JPT1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT1"
FT                   /protein_id="ABD01195.1"
FT                   /translation="MQEPAHSLEALGSLLRQTREARGLTLTEVANDTFIRCQYLQALEE
FT                   ADLSRLPEPVYVQGFLKRYADYLGLDGETLSRRASPLLSAKTPHAPAPLAVVGQQPTFA
FT                   LRPLHLWAAYVVLIVLTVGGLSALLEGTGNPFGRWLVSLSTVSREGSGQQPPAANSPDP
FT                   TLSAVQPTARQLFPTLDQWTRIQGVFPEVLDAHSGGAGRKPVRLDIRVVERPSWLRVIA
FT                   DGQTVFEATLQPGAELNWEAEQSIVLRTGNAGGVLVTFNDRELGVMGRFGEVKELMFEP
FT                   GLDIQSLQ"
FT   gene            complement(209503..210327)
FT                   /locus_tag="CYB_0196"
FT   CDS_pept        complement(209503..210327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0196"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01196"
FT                   /db_xref="GOA:Q2JPT0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPT0"
FT                   /protein_id="ABD01196.1"
FT                   /translation="MAEPQRLQKLLAQQGLASRRQVEAWILAGRVRVNGKVVTELGSKA
FT                   DPERDCIEVNGQVIPLAKDPARYVLLLHKPVGVLSTCADPWGRKTVLDLLPPSWKRQTR
FT                   LYPVGRLDADSSGALLLTNDGDLTLKLTHPRYHLPKTYRVQVQGHPSQATLQHWRDGVD
FT                   LEGYTTLPAEVEFCPAPDFRQREHPNCSWLRVVLFEGRNRQIRRVAERLGHPVLSLHRE
FT                   AIGPLGLGNLKAGQFRQLDPHELQALLAPLTGHSSSSSLGKRPLRPPARSRD"
FT   gene            210425..210802
FT                   /locus_tag="CYB_0197"
FT   CDS_pept        210425..210802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0197"
FT                   /product="ISSoc13, transposase orfA"
FT                   /note="identified by similarity to GB:CAD86359.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01197"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JMH2"
FT                   /protein_id="ABD01197.1"
FT                   /translation="MKLVFLDENKWQKILAFLQTEERVNIGKEANCKQFIEAVLWIARS
FT                   GAPWRYLPEGYGKWYTIYQRFHRWSRFGVWERMFKYFIDDPDLEHLIIDSTMVRAHSCA
FT                   AGKKGSKLWGEAEADTAPRFM"
FT   gene            210760..211167
FT                   /locus_tag="CYB_0198"
FT   CDS_pept        210760..211167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0198"
FT                   /product="ISSoc13, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01198"
FT                   /db_xref="GOA:Q2JPS3"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS3"
FT                   /protein_id="ABD01198.1"
FT                   /translation="MGRSRGGYSTKIHVSVDGLGNPLELRITGGEKSDITQGEELIEGW
FT                   QRKDTKVIGDKGYDADKLIEKIGEAQAVIPPKRNRKTQRHYDKHLYKERHLIECFFHKL
FT                   KQYRHLFSRFDKLARNFLSFLYLVSALFWLK"
FT   gene            complement(211182..211715)
FT                   /locus_tag="CYB_0199"
FT   CDS_pept        complement(211182..211715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC92337.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01199"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS7"
FT                   /protein_id="ABD01199.1"
FT                   /translation="MDVQSPLQPDPSLGGATPLQALQALNQSVAEALVSCLKGQPQQAT
FT                   QHLLLALPQLMAALGALRQKSSLRVSGPEVLAEPAGCPSEAQPKRILHIEGNRVEVWVD
FT                   NQIRSSWSIWSVGDLKEVCRLAEEFDCGLSYSLGGNSESQSEMLLLPSNSDDLSDRLSN
FT                   PVHVSGPEAPGSAA"
FT   gene            complement(212012..212446)
FT                   /gene="rbfA"
FT                   /locus_tag="CYB_0200"
FT   CDS_pept        complement(212012..212446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CYB_0200"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by similarity to SP:P32731; match to
FT                   protein family HMM PF02033; match to protein family HMM
FT                   TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01200"
FT                   /db_xref="GOA:Q2JPS6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPS6"
FT                   /protein_id="ABD01200.1"
FT                   /translation="MATARRVARVAELIKREVSQILLSEIKDDRVGAGMVSIVDVEVSN
FT                   DLQNARIFVSIYGDETAQHQAMEGLAAATPFVRREIGQRLSLRRVPTVVFLQDRSLERG
FT                   SRVLALLNQLRPTFEAKAQTGVEEPLENTAEGEENPSGGE"
FT   gene            212623..212853
FT                   /locus_tag="CYB_0201"
FT   CDS_pept        212623..212853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91135.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01201"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS5"
FT                   /protein_id="ABD01201.1"
FT                   /translation="MDGDVMIKTPEALRRSIEQFMLNVTEPLDPLLSLKLTQLVVMLGD
FT                   TAYAMGYSDGQQKPEERCRYCPSRVFDSLEL"
FT   gene            212976..214439
FT                   /gene="phrB-1"
FT                   /locus_tag="CYB_0202"
FT   CDS_pept        212976..214439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB-1"
FT                   /locus_tag="CYB_0202"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="identified by similarity to SP:P05327; match to
FT                   protein family HMM PF00875; match to protein family HMM
FT                   PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01202"
FT                   /db_xref="GOA:Q2JPS4"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS4"
FT                   /protein_id="ABD01202.1"
FT                   /translation="MTSPVLLWHRRDLRLGDNTALHEAAQRSSQVVPVFIFDPQMLRRS
FT                   DMAPARVAFLLQALQELQERYAQMGIPLIWRLGDPSVELRCLAIDLGARAVFWNADGEP
FT                   FALQQESRVQASLAAAGIQSFSYQDMLLHGPGEVLTQAGEPYSVFTPFWRRWASLPKPD
FT                   PYPIPKGLQPVSGLKAQPLPTLADLGFVCDQRIPAAGEAAAQALLEDFCQGLRILDYER
FT                   ARNFPAEPGTSLLSPHLCWGTIGIRQVWQATREVEAEVRSQEAESSLQTWRQELCWREF
FT                   YKHVLAHWPHVETGAYRRAFDALEWDNRQDWFQAWCTGQTGYPIVDAAMRQLNETGWMH
FT                   NRCRMIVASFLTKDLLIDWRWGERYFMQKLVDGDLAANNGGWQWSASVGTDPKPLRIFN
FT                   PATQAARYDPEGEYIRRYLPELARLDTPALLWVGDDPKGAWALRERRSCGYPDPIVDHK
FT                   VQQQAFKRRYQAVQQAYSRSVRDGLPPPS"
FT   gene            complement(214454..214861)
FT                   /locus_tag="CYB_0203"
FT   CDS_pept        complement(214454..214861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0203"
FT                   /product="ISSoc13, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01203"
FT                   /db_xref="GOA:Q2JPS3"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS3"
FT                   /protein_id="ABD01203.1"
FT                   /translation="MGRSRGGYSTKIHVSVDGLGNPLELRITGGEKSDITQGEELIEGW
FT                   QRKDTKVIGDKGYDADKLIEKIGEAQAVIPPKRNRKTQRHYDKHLYKERHLIECFFHKL
FT                   KQYRHLFSRFDKLARNFLSFLYLVSALFWLK"
FT   gene            complement(214819..215196)
FT                   /locus_tag="CYB_0204"
FT   CDS_pept        complement(214819..215196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0204"
FT                   /product="ISSoc13, transposase orfA"
FT                   /note="identified by similarity to GB:CAD86359.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01204"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS2"
FT                   /protein_id="ABD01204.1"
FT                   /translation="MKLVFLDENKWQKILAFLQTEERVNIGKEANCKQFIEAVLWIARS
FT                   GAPWRYLPEGYGKWYTIYQRFHRWSRFGVWERMFKYFIDDPDLEHLIIDSTMVRAHSCA
FT                   AGKKGSKLWGEAEGDTAPRFM"
FT   gene            215419..215781
FT                   /pseudo
FT                   /locus_tag="CYB_0205"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error; identified by match to protein
FT                   family HMM PF01710"
FT   gene            complement(216392..217609)
FT                   /gene="moeA"
FT                   /locus_tag="CYB_0206"
FT   CDS_pept        complement(216392..217609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="CYB_0206"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454; match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01205"
FT                   /db_xref="GOA:Q2JPS1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS1"
FT                   /protein_id="ABD01205.1"
FT                   /translation="MLPVAEAEALILQAVQPLGPEWVELGSAQGRVLSQTVYSPQDFPA
FT                   HPTSSMDGYAVRHEDVQAGIPCELQVIETLPAGKAPTRELQPGQAVRLYTGSLLPSGAD
FT                   TVVMQEYTQQPSPGTVRLLQRPQRGQFVRPQGDFARQGDPLLPAGQALGGAELAVLAAI
FT                   RQAMVPVFRQPRVALFSTGDELVPIQQVPEPGQVVDSNQYGLAALVKAAGGIPIQLGIV
FT                   PDRPQVLRQVVQQALASADGVISSGGVSVGDFDLVEKVLEELGGEIFIRSVAIKPGKPL
FT                   TVARFPNPHGPPKLYFGLPGNPASALVTFWRFLHPALRKMGGSLPPYWQILSAFSAVDL
FT                   HADGRREHYLWGRLQVRPEGIQFQPAANLNSGNLISLAGCNALAVLPVGTTQIPAGSPV
FT                   QVLQLP"
FT   gene            218005..218367
FT                   /locus_tag="CYB_0207"
FT   CDS_pept        218005..218367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0207"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   subunit 4L family"
FT                   /note="identified by match to protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01206"
FT                   /db_xref="GOA:Q2JPS0"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPS0"
FT                   /protein_id="ABD01206.1"
FT                   /translation="MLNAAVLLTIFLGFWGVVVKRNLIMKILSMDVMSTGVIAFFVIWA
FT                   ARSGVFTPIYKPWRELDYADPVPQGIILTAIVIGLSVQALMLVGVMKLSRNHPTLEVES
FT                   IEQAVASGAQSTSTDD"
FT   gene            218360..219832
FT                   /locus_tag="CYB_0208"
FT   CDS_pept        218360..219832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0208"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01207"
FT                   /db_xref="GOA:Q2JPR9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR9"
FT                   /protein_id="ABD01207.1"
FT                   /translation="MTELTLVWVALPFLLAFTTYLMPALTRPSLVGMAALTVAYAVQQG
FT                   GLPGTTAAPLELQLLDHFGVTLRIDANGAAMLLAHGLVTLGVALYLDRRFAGSRFLAMQ
FT                   LLIVHGSANAVVISADLISVYVSLEVLSIGVFLLLTYGRRAEGQPTVEENAPHRDRQLW
FT                   VGLRYLFMSNVAMLFYLMGAILVYVRTGSLAMSSLTMADPTALALIAVGLLAKGAIFVA
FT                   GLWLPLTYVTADPVVAAVLSGFTTKAGAMALVRCSEASPVLAQGLPYLSAGSAVFGILL
FT                   ALMASTPQHLLAWSSVSQMGFVIAAPQWAGLYGLAHGLAKPLLFVGTSVSHRWRWPMLL
FT                   LGSASLAGVPGSLGYAAKALSLSALDPWHEWLLVGVTVGTTCLGVRVLRAPVSRMKGAT
FT                   TSATPWQDKVALVLWGGGLLWGWLPAAYGADNLLKALLSLGVGIPLGWFWERIPLKGGS
FT                   VNEGLEAVVGGLSIVLVLVWALLAVGNYGTLP"
FT   gene            219834..220220
FT                   /locus_tag="CYB_0209"
FT   CDS_pept        219834..220220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01208"
FT                   /db_xref="GOA:Q2JPR8"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR8"
FT                   /protein_id="ABD01208.1"
FT                   /translation="MGLLEIGLRLLIWFLLTGNLSWDNVAIGVAATLLLPRQASAPVQW
FT                   RDWGRVLQEILLAIPRAYWEAFEMILKPHTVEEVVYKQTLPNRSAGLVFLDIFLITFTP
FT                   KTIVLNCNAQGTYEVHVLKPREDV"
FT   gene            220217..220468
FT                   /locus_tag="CYB_0210"
FT   CDS_pept        220217..220468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01209"
FT                   /db_xref="GOA:Q2JPR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR7"
FT                   /protein_id="ABD01209.1"
FT                   /translation="MNLLLFLLTLTLCLPLYAAWLKEDIWQTMLAFASLATKTAILILV
FT                   VSVVRDDWMIGIVGVLILSVGNAALMLLAHVLKRLEML"
FT   gene            220488..220769
FT                   /locus_tag="CYB_0211"
FT   CDS_pept        220488..220769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC09366.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01210"
FT                   /db_xref="GOA:Q2JPR6"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR6"
FT                   /protein_id="ABD01210.1"
FT                   /translation="MEVWVEGLSYLLFGIGVLFWLWGTAPLLGDRSILFKLHGLSVSDT
FT                   LGSMSIMLGLLLRIPREWPLLVLALISLAIWNTILGYVLAFCSQRKSL"
FT   gene            220779..221300
FT                   /locus_tag="CYB_0212"
FT   CDS_pept        220779..221300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01211"
FT                   /db_xref="GOA:Q2JPR5"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR5"
FT                   /protein_id="ABD01211.1"
FT                   /translation="MEETLLLVMALLLPLTASLVVTQTNPYHALVMRGILGTIAALIYA
FT                   LFGAADVALTEALVGTMLSITLYAIAVRSSLSMRLGVLEGSPVLEASTSAARQLLQQMR
FT                   QGLQRYHMRLELTAYGSSEALVAALRSREVHTIALEPGGEAAEYRLVTRVPRLQAILAQ
FT                   QALATEVMAT"
FT   gene            221297..221977
FT                   /locus_tag="CYB_0214"
FT   CDS_pept        221297..221977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0214"
FT                   /product="transporter, cation:proton antiporter family"
FT                   /note="identified by match to protein family HMM PF04039"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01212"
FT                   /db_xref="GOA:Q2JPR4"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR4"
FT                   /protein_id="ABD01212.1"
FT                   /translation="MKWVYGIAVLLAALQLIVGEVGSVSPNRAAGVALVEAVEILASES
FT                   GVPNAVTGLILRNRLYDTVFEVVVFSTAILGAQYLLADEQPTANVAQFTDIPSIVLARV
FT                   GATISALIAVELAIRGHLTPGGGFAAGVAGGTAIGLVAITASSTWMEAIYKRWRAAMWE
FT                   KLSVVTFIGVAVVALAGWELPRGELGALFSGGWIPILNILVAIKVALGSWAAVLIFIRY
FT                   RGLL"
FT   gene            complement(221972..222487)
FT                   /pseudo
FT                   /locus_tag="CYB_0213"
FT                   /note="putative plasmid stability protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P55511"
FT   gene            222909..226157
FT                   /gene="carB"
FT                   /locus_tag="CYB_0215"
FT   CDS_pept        222909..226157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="CYB_0215"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02786; match to protein family HMM PF02787;
FT                   match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01213"
FT                   /db_xref="GOA:Q2JPR3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR3"
FT                   /protein_id="ABD01213.1"
FT                   /translation="MPRRTDIHKILLIGAGPIVIGQACEFDYSGTQACKALREEGYEVV
FT                   LVNSNPATIMTDPSMAERTYIEPVTVDFVAKIIERERPDALLPTMGGQTALNVAVQLAQ
FT                   QGILEQYGVELIGAKREAIEKAEDRDLFKQAMQRIGLAVPRSGLAHTLEEAKQIAQEIG
FT                   YPLIIRPAYTLGGTGGGVAYNQEEFEEICAAGLEASPVSQILVEESVIGWKEFELEVMR
FT                   DLADNVVIICSIENMDPMGVHTGDSITVAPAQTLTDKEYQRLRDYAIAIMREIGVETGG
FT                   SNVQFAVNPANGEVRVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLPEIPNDIT
FT                   RKTPASFEPTIDYVVTKIPRFAFEKFPGAEPVLTTQMKSVGEAMAIGRTFQESIQKALR
FT                   SLEIDRPGFGSDRPEVFPKPEEVRANLRTPNPFRLLTIRTALLMGFSAQEIAQLTHIDP
FT                   WFIDKLQELVEVEQALKGRELGSLSADDLRHLKQMGFSDRQIAHLTGSTEHQVRACRKS
FT                   LGVIPTYKTVDTCAAEFEAATPYQYSTYESESEIFPARKEKVMILGGGPNRIGQGIEFD
FT                   YCCCHAAFALSRLGYEAIMVNSNPETVSTDYDTADRLYFEPLTHEEVMNLVDAEQPVGL
FT                   IVQFGGQTPLKLAQGLAAAQAPIWGTSPDSIDIAEDRGRFERILRELDIRQPANGIARS
FT                   VEESLEIARRIGYPVVVRPSYVLGGRAMEIVYSDQDLQRYMQLAVAVDPDRPVLVDQFL
FT                   EEAVEVDVDAIADRTGAVTIGGILEHIEQAGIHSGDSACVLPSRTLSPEVLRVIREWTV
FT                   KLAQALKVVGLINVQYAVQKGQVYILEANPRASRTVPFVSKAIGHPLADYAAQVMSGKT
FT                   LEELGFTQEVIPSHIAVKEAVLPFHKFPGTDTLLGPEMRSTGEVMGIDTDFGRAYAKAQ
FT                   LAAGQNLPLQGTVFISVSDRDKQAVIPVAREFVGLGFRLLATEGTQKVLAEHGIPVDKV
FT                   LKLHEGRPHVIDAIKNHQIQLIINTPSGVEAQQDGQKIRRTALAYKIPLVTTLAGAKAT
FT                   AAAIRALQSGSLQVKCLQDFFPPRNAPSKLLEAP"
FT   gene            226514..227569
FT                   /gene="psbA-1"
FT                   /locus_tag="CYB_0216"
FT   CDS_pept        226514..227569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA-1"
FT                   /locus_tag="CYB_0216"
FT                   /product="photosystem II protein D1"
FT                   /note="identified by match to protein family HMM PF00124;
FT                   match to protein family HMM TIGR01151"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01214"
FT                   /db_xref="GOA:Q2JPR2"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPR2"
FT                   /protein_id="ABD01214.1"
FT                   /translation="MSTVIRRSLAARQLWSWNGFCQWITSTENRLYIGWFGVLMIPTLL
FT                   AAAFCFVIAFIAAPPVDVDGIREPVIGSLIGGNNLISAAVVPTSAAIGLHFYPIWEAAS
FT                   LDEWLYNGGPYQLIVLHFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLV
FT                   YPIGQGSFSEGLPLGIAGTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLV
FT                   ISSLIRETSEEESQNAGYRFGQEEVTYNFLAGHYAFLGRLGFPGLGLRNSRSVHFWMAA
FT                   LPTVGIWAAAIGIGIMAFNLNGLNFNQSILDSQGRFIPTYADLLNRANLGIQVMHAPNA
FT                   HHFPLLLAAQP"
FT   gene            complement(227576..229426)
FT                   /locus_tag="CYB_0217"
FT   CDS_pept        complement(227576..229426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0217"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to SP:P41403; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01215"
FT                   /db_xref="GOA:Q2JPR1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR1"
FT                   /protein_id="ABD01215.1"
FT                   /translation="MERSLIVQKYGGTSVGSVERIQAVAQRVAHTVKAGHRVVVVVSAM
FT                   GDETDRLVGLGEQILQGSPTTPAQLREWDMLLSTGEQVSIALVALALQRLGCPALSLTA
FT                   AQVGIVTTRDHSRARILHIHTDRLWQHLEREEVVVVAGFQGITSLAELEITTLGRGGSD
FT                   TTAVALAVALGAELCEIYTDVPGIFTTDPRKVPEARLLPEITSDEMLELASLGAQVLHP
FT                   RSVEIARNYGVKLRVRSSLEPLQAGCEGTLILSPPPRPRAADSSIELGLAVDTVELDRD
FT                   QAKLVLVGVPDRPGIAAQLFQGIAAAGVNVDLILQSLQFTASCASGTDSLPQGSVPQPT
FT                   NDIAFTVSRSQVAEAAAVARQIGQELQCAAVIVDEAVAKVSIAGVGMMGRPGIAAQMFQ
FT                   VLAEAGINLQMISMSEIKVSCVVAAERAGDAALALGESFQVIPHLHRAKMPAAPQDSHP
FT                   VRGVALDLKQSRLGLRKVPDRPGTAAHLFGRLAAAGIIVDTIIQSQRGYHNGIPSTDIA
FT                   FTVPQDQAMAAEAVCRQVAEELQAAGVDADHDIAKVSIVGAEMETYPGVAARLFAALAE
FT                   AGINIEMIATSEIKVSCVVRRDRGIPALQAIHRAFRLDCP"
FT   gene            complement(229471..231006)
FT                   /locus_tag="CYB_0218"
FT   CDS_pept        complement(229471..231006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0218"
FT                   /product="peptidase, M50B family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF02163"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01216"
FT                   /db_xref="GOA:Q2JPR0"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPR0"
FT                   /protein_id="ABD01216.1"
FT                   /translation="MADWILLALVGSATYLLLQKSVARLSKVPWRILWLVMMLPPLVWV
FT                   LGRQVFQYELPPLLMLLLFLTSYFTSMTLVRRGGIRPSTGGPRPEVENSSPEADPSPAG
FT                   EPEPEEEEEDGAADPVSLALAHTPISEVPREKLSHCFPWNVFYLQNVEYRPQAIICRGN
FT                   LRADPSEAYERVQQNVETTFGKRFLVVLQEGFAGKPFFALVPNPAARRSPADSRELPLL
FT                   ALGLLLFTFWTTLSAGAHAAGVSPDRLLHLPSLMKGLPYAVGILAILGSHEWTRYWVAR
FT                   RHHIKTSLPYFIPVPFVLGTFGAFIQLKEPVPNRKVLFDIAAAGPLAGSLVALGMLLLG
FT                   LLFSAPADPPAVPEGQPTPISFHRIDPRLSVLLAILARMVLGDQLQPGQVIELHPLAFA
FT                   GWLGLVVIAFNLMPVGQLDGGHIVHAVYGQQMGANVGRVARWLVLLLALTVQPWLLLWA
FT                   LLLFVISSADEPALNDVTELDEARDLLGLGMLTLLVLILLPVPPFLQNGLGLA"
FT   gene            complement(231034..231132)
FT                   /locus_tag="CYB_0219"
FT   CDS_pept        complement(231034..231132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01217"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ9"
FT                   /protein_id="ABD01217.1"
FT                   /translation="MVAVYGQAKPQLALQGSRLQAVARGLDLPLAW"
FT   gene            complement(231285..231545)
FT                   /locus_tag="CYB_0220"
FT   CDS_pept        complement(231285..231545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC09035.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01218"
FT                   /db_xref="GOA:Q2JPQ8"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ8"
FT                   /protein_id="ABD01218.1"
FT                   /translation="MEPQPLMPQPQPPRRLEDQFVENVSRYPTYFITVLLGGIWAGLQP
FT                   FVGLYRKSPTAAAMVTLGSLLLLLFVYFTLRGMTGNTFWPE"
FT   gene            232121..232591
FT                   /locus_tag="CYB_0221"
FT   CDS_pept        232121..232591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC88789.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ3"
FT                   /protein_id="ABD01219.1"
FT                   /translation="MRVQEALDQLEAAILSSPRLFWSRTLIEEEKILEQLDFIRLNLPT
FT                   ALEEAEELLRQRDRILAEANRYAQEIVAAAQRRAEQLLNESAILRQAQAQAEQLLQQAY
FT                   QHSEEVRRQTLQESERLQREAHRYVDQVLQDLELRLVESLRVIRNGRQNLQT"
FT   gene            232758..233405
FT                   /locus_tag="CYB_0223"
FT   CDS_pept        232758..233405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0223"
FT                   /product="decarboxylase, polyprenyl
FT                   P-hydroxybenzoate/phenylacrylic acid family"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM TIGR00421"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01220"
FT                   /db_xref="GOA:Q2JHQ2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ2"
FT                   /protein_id="ABD01220.1"
FT                   /translation="MTSSLPIILGVSGASGMLYAVRALHVLLSLDYRVEVVASKAAYQV
FT                   WQGEQGVLLPTDPRKQAHFWRQQAESSGGSLVCHRWQDVGATIASGSYRTQGMLVIPCS
FT                   MGTVAKLAAGLSSDLLERAADVQLKEGRRLVVVPRETPFSLIHLRNLTTLAEAGARIVP
FT                   AIPAWYHQPRTILDLVDFVVVKALDQFGIDGDLIRRWQGMRQHQILKLPPDL"
FT   gene            complement(233383..233499)
FT                   /locus_tag="CYB_0222"
FT   CDS_pept        complement(233383..233499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0222"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01221"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ1"
FT                   /protein_id="ABD01221.1"
FT                   /translation="MPQVRAIGTGPPPAWNTPKPNPSLPPGKGIPLRDQGAA"
FT   gene            complement(233532..234650)
FT                   /locus_tag="CYB_0224"
FT   CDS_pept        complement(233532..234650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0224"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01222"
FT                   /db_xref="GOA:Q2JHQ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHQ0"
FT                   /protein_id="ABD01222.1"
FT                   /translation="MSLLLSPTPPLHRLNSHPSPSARVSANSVGNPGFSSVDAPSSSPT
FT                   GSDRDPLSALPRYGYSQTWHWRGWPIHFTYTPSRAQTPAGVVNLTAAPALLIHGFGASV
FT                   GHWRHNILPLGSQRSVYALDLLGFGKSAKPEIAYSVDLWVEQVHEFWQTHIQQPSILVG
FT                   HSIGGLVGVIAAARYPQMVKGLCLISCADGPHPEELPPPWDALVRALCEGILSLLGCPL
FT                   TYPHLFNWLRQTEVLRAWIKNVYKRDEQVDDELVQIFQRPAFEPGAAHVFLDGLRAILC
FT                   RRFDSPKRLLPTLKMPILLLWGREDPAVPSFLADQFKRWQPALTLVKLPGVGHCAHDEL
FT                   PHWVNTLIGEWAASLETCPDLPTPLQRDPRVG"
FT   gene            234765..235391
FT                   /gene="cobH-1"
FT                   /locus_tag="CYB_0225"
FT   CDS_pept        234765..235391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH-1"
FT                   /locus_tag="CYB_0225"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by similarity to GB:CAA04310.1; match to
FT                   protein family HMM PF02570"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01223"
FT                   /db_xref="GOA:Q2JHP9"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP9"
FT                   /protein_id="ABD01223.1"
FT                   /translation="MNEAFQVDPITAASFRQIDQEIGPHPWQGIPYEVVRRAIHATADF
FT                   ELRDRFFFGPNAVEQALAALRQKRPVVVDVRMVAAGIQSGLKAQGIPLYCALDWVEEPR
FT                   WPGQTRAANGMVNLARRYPEALFVVGNAPTALLALVEEIRAQRVKPALVIGVPVGFVAV
FT                   EEAKQALAQTDVPQIRVEGRKGGSPVAAAIVNALLLAAQRDPIPN"
FT   gene            235398..236291
FT                   /locus_tag="CYB_0226"
FT   CDS_pept        235398..236291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0226"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01224"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP8"
FT                   /protein_id="ABD01224.1"
FT                   /translation="MKGYLQTFPMTPEQEEWLIRNLQQQQEQIQEMRAEQQRSAERFEA
FT                   QMVEMRQGFAAQISEIRAEQQRSAERFEAQMAEMRAEQQRSAERFEAQMVEMRQAFAAQ
FT                   ISEIRAEQQRSAERFEAQMVEMRQAFAAQISEIRAEQQRSAERFEAQMVEMRQGFAAQI
FT                   SEIRAEQQRSAERFEAQMAEMRAERQAMEAQLQTEIQEIRALIQQNQERIRQNEERGDE
FT                   LEVAIQECRRDMQAGFAELREAQAMMMEQFRERDGRLIEAQLSFIREMREMQREVAELR
FT                   LDFLNHMRQYHPPVER"
FT   gene            236292..237551
FT                   /gene="cbiE/cbiT"
FT                   /locus_tag="CYB_0227"
FT   CDS_pept        236292..237551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiE/cbiT"
FT                   /locus_tag="CYB_0227"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiE/T subunits"
FT                   /EC_number="2.1.1.132"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF05175; match to protein
FT                   family HMM TIGR02467; match to protein family HMM
FT                   TIGR02469"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01225"
FT                   /db_xref="GOA:Q2JPQ7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ7"
FT                   /protein_id="ABD01225.1"
FT                   /translation="MATAAPGRSPQLAVVGVAGDGSVASWGIPPLSQARVLAGAPHLLR
FT                   HFTDHPARKIPLTGPVESWIPLLQQEMAQGSLVLLASGDPLFFGIGRLLTEYFPAERLA
FT                   FYPQVSSVQLALNRLQIPWQEATILSLHGRGVERLEAVLKQGSPVIVVLTDPEHTPTVL
FT                   AQFIADLRLPVRYQAWVCSQLGSPQEQVVPLQEGEDAVFPSPNVVVLRRVEPEPDPHRW
FT                   PLVGIPDDQFYTFPDQPGLITKQPIRLLTLGSLQLPQEGVVWDIGAGTGSVAIEIARLS
FT                   SRLQVYAVERNAMGICLIRRNRQRFGPENLQVIPGAAPQVLADLPDPDRVVLGGGGKGI
FT                   RDLLPVVGARLRPGGILVANFATLETCSEALQWLRSRGWQVRVDHVQISRSAVLAEGTR
FT                   FAPLNPVYLLQGIPSNWKAQ"
FT   gene            complement(237598..238200)
FT                   /locus_tag="CYB_0228"
FT   CDS_pept        complement(237598..238200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AH1835; match to
FT                   protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01226"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ6"
FT                   /protein_id="ABD01226.1"
FT                   /translation="MLRLDPDPSFQPGDSLQDNRGRVAIFIDGSNLFYAALQLGIEIDY
FT                   TRLLKTLSGRSPLLRSFFYTGVDRNNEKQQGFLLWMRRNGYRVVTKELTQLPDGSKRAN
FT                   LDVEIAVDMLSLVRWYETAVLVSGDGDLAYAVNAVSYQGARVEVVSLRSMTSDQLINLA
FT                   DRYIDLESIKDQIKKTNRPSSAYLYRPGFTADEEDEG"
FT   gene            238504..239223
FT                   /gene="sfsA"
FT                   /locus_tag="CYB_0229"
FT   CDS_pept        238504..239223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="CYB_0229"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01227"
FT                   /db_xref="GOA:Q2JPQ5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPQ5"
FT                   /protein_id="ABD01227.1"
FT                   /translation="MECGDGPVPYRFSSPLHRGVLRSRYKRFLADVELENGQQIIAHCP
FT                   NTGPMSGVCQVGAPVYLSHHPEPKRKLAYTWEMIQVDGVWVGINTSLPNRLVDWGLERG
FT                   WFPQLAGFSRRQREVTCGKSKIDFLLTGDAGSAYLEVKNTTWAVGSRALFPDTVTTRGQ
FT                   KHLEDLIQIRQQGQRALLLYWINRADCTEFAPGEERDPRYARLFREALQAGVEMLPYRV
FT                   EVSPTGIRPLGLAKIVV"
FT   gene            239321..240580
FT                   /locus_tag="CYB_0230"
FT   CDS_pept        239321..240580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0230"
FT                   /product="GTP cyclohydrolase II domain protein"
FT                   /note="identified by similarity to SP:P17620; match to
FT                   protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01228"
FT                   /db_xref="GOA:Q2JPQ4"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ4"
FT                   /protein_id="ABD01228.1"
FT                   /translation="MSEPSSRPHHIVLTSHPSPHGTQAQPIRWGALDPLRRGPVVGSLT
FT                   NLAHRNVIGTHAGAYAVYRALAVASGSLQADHRADLTHTAPVVSIGPHPSWGDPDRIVS
FT                   LDPWGAVVGEVFAPLYAQGYDIRPTIAITQAHIHMPELQEAVNKGRLRVDGRILKDNGS
FT                   LVVTKAAIEPVWYLPGIAKRLQVSESLLRRTLFEQTGGMFPELVTRPDLSVFLPPIGGQ
FT                   TVYIIGQVAAITDPALPLAVRVHDECNGSDVFGSDICTCRPYLVHSIEECVKTAQAGGA
FT                   GVIVYLRKEGRALGEVTKFLVYNARKRQEGGDRADAYFARTECVAGVQDIRFQELMPDV
FT                   LHWLGITRIDRLISMSDLKYRAITNSGIEVVQRVPIPEELIPADARVEIEAKKAAGYYT
FT                   EGEVLDAERLAQIRGRALVE"
FT   gene            240593..241378
FT                   /gene="xth"
FT                   /locus_tag="CYB_0231"
FT   CDS_pept        240593..241378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="CYB_0231"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01229"
FT                   /db_xref="GOA:Q2JPQ3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ3"
FT                   /protein_id="ABD01229.1"
FT                   /translation="MQVATWNVNSIRTRLPQVLAWLDSQGSLDVLCLQETKVVDEDFPR
FT                   AAFQERGFHVEVYGQKSYNGVALISRDPPEKVERGFGALLPSAADLDEQKRLMSAIYRG
FT                   IRILNLYVPNGAEVGSEKYAYKLRWLATLKDYLAVALSQGDPILLCGDFNIALEDRDIY
FT                   DPQKAGEIMASEPERQALQEILALGFEDAFRRFTPDPGHFSWWDYRSGGFQRNRGWRID
FT                   HHYLSRELQEKATACWIDVEPRRAEKPSDHAPVIVALDI"
FT   gene            241643..242836
FT                   /locus_tag="CYB_0233"
FT   CDS_pept        241643..242836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0233"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01230"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ2"
FT                   /protein_id="ABD01230.1"
FT                   /translation="MTQVLTVPCKLKVSQSQAAKLDATMDAFVQALNWVNQNTPEKVVN
FT                   AVKLQSLCYYQIRARFGLSSNLAQQVCRRLAGARKVAQQKNRPVKAFKGGFATYDARIF
FT                   SFREKDWTVSLTTVEGRERFELAIGRYQRERLAGSNPKSATLVKRKDGSYSIQICVEAE
FT                   PSPPQRTGRVLGVDLGRTDIAHTSEGDNWNGQQLNRIRDHYSRLRAALQRKASKGTRSS
FT                   RRRCRQLLQRLSGKERRFQAWVNHRISKAIVSRAKTTNSAIALEDLTGIRKRVNQQPRS
FT                   KAERRRANSWAFYQLRQFLEYKARAAGVSLILVPPAYTSQTCHKCLHIHPEQGKSYRSG
FT                   KSFKCGHCGWEGDADLNGANVIALLGAAVNQPRGSWLACQLQGYRKPALYCEAVRVG"
FT   gene            complement(242791..243252)
FT                   /locus_tag="CYB_0232"
FT   CDS_pept        complement(242791..243252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0232"
FT                   /product="sigma factor, putative"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01231"
FT                   /db_xref="GOA:Q2JPQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ1"
FT                   /protein_id="ABD01231.1"
FT                   /translation="MQAAKDTSDWELIQRCLNGDSQSFRQLYRKYQQSVRNILYPLCGA
FT                   DLLDDLVQEVFIRAWKGLPRFRGSAQFSTWLYRICWNVASDQRRRCARQHSQTQNLALG
FT                   SDIAHPGPDLMHLHYQQALQQSMAQLSPEHRMVVNYPTLTASQYRAGFR"
FT   gene            243545..244477
FT                   /locus_tag="CYB_0234"
FT   CDS_pept        243545..244477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0234"
FT                   /product="polyamine/opine/phosphonate uptake ABC
FT                   transporter (POPT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01232"
FT                   /db_xref="GOA:Q2JPQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPQ0"
FT                   /protein_id="ABD01232.1"
FT                   /translation="MAKTTQITDKPDLFGFLYHHPTLILAILLGPPLIWLLVFYLGPLL
FT                   ALLLQSFYHLDPFTGLILRKLTLATYRELLTPASVDIFVRSLTMALAVTLAAIVLAFPL
FT                   AYTMVRLASPRWKDFLYLLVLLPLWSSYLIRVYAWKLILAKEGILTYLLTHVGLQGWVE
FT                   KILQLPGIGGPSLAVSNLGIFLVFLYVWLPYMILPIQAALERVPDSLIEASADLGAQGW
FT                   QTFRHVTLPLALPGILAGSVFTFSLTLGDFVVPYSLGNSSYFIGQAVLAFQGTSGNIPS
FT                   AAAFTVVPMGIMTVYLLVAKRLGAFESVS"
FT   gene            244559..245227
FT                   /gene="msrA"
FT                   /locus_tag="CYB_0235"
FT   CDS_pept        244559..245227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="CYB_0235"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by similarity to SP:P27110; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01233"
FT                   /db_xref="GOA:Q2JPP9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP9"
FT                   /protein_id="ABD01233.1"
FT                   /translation="MVLFGFGKLGKKLSLPKPEEALPGRAEPMVIVNRHFVNGHPLQPP
FT                   FPEGMELAMFGMGCFWGAERKFWQVPGVFSTAVGYAGGFTPNPTYEEVCTGLTGHNEVV
FT                   RVVYDPAQVSYAQLLKVFWENHDPTQGMRQGNDVGTQYRSGIYVYSPAQRELAEKTRDL
FT                   YQQALTAHGYGQITTEILDAPEFYYAEDYHQQYLAKNPRGYCGLRGTRVCLPEILTEPA
FT                   "
FT   gene            complement(245242..246069)
FT                   /gene="cysW"
FT                   /locus_tag="CYB_0236"
FT   CDS_pept        complement(245242..246069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="CYB_0236"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="identified by similarity to SP:P27370; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR00969; match to protein family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01234"
FT                   /db_xref="GOA:Q2JPP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP8"
FT                   /protein_id="ABD01234.1"
FT                   /translation="MKPDEVAGVKPKPSTWLSGLLIGIVGLYIALLLGIPVVNIFYQAF
FT                   REGIPAFLHRLTERELLSALRLTVLTALVVVPLNTFFGLCAALAIAHRRFPGRALLLSL
FT                   IDLPFSISPVVAGLMLVLIFGRQGWLGSWRVIFAFPGIVLATAFITLPFVAREVLPVLE
FT                   EAGTDQEEAAKTLGATPWQIFWRITLPNIRWGLLYGVILTNARAMGEFGAVAVVSGNII
FT                   GRTQTLPLFVEDAYRSYATGSAYAAAVVLSLLAVVTLVAREFLERGSHSRRVF"
FT   gene            complement(246059..246871)
FT                   /gene="cysT"
FT                   /locus_tag="CYB_0237"
FT   CDS_pept        complement(246059..246871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="CYB_0237"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="identified by similarity to SP:P27367; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR00969; match to protein family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01235"
FT                   /db_xref="GOA:Q2JPP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP7"
FT                   /protein_id="ABD01235.1"
FT                   /translation="MLQALSQLSWPWRLTLGYLFLMLILPLAALIAKSSSVGWAEFWRI
FT                   ATDPVALSAYEVTFVTALLAALINGVMGTLTAWVLVRYAFPGKKLLEGLIDLPFALPTA
FT                   VAGLTLATVYSSNGWIGSLLAPLGIRISFTRLGVGVAMLFISFPFVVRTVQPVLQELEK
FT                   DVEEAAWSLGASRFQTFRRVVLPQILPAVLTGVALGFSRAVGEYGSVVIIASSIPFRDL
FT                   IAAVLVIQRLEQHDYAGATVIGTVMLGISFLSLVVINLLQAWGSRHET"
FT   gene            complement(246878..247921)
FT                   /gene="cysA"
FT                   /locus_tag="CYB_0238"
FT   CDS_pept        complement(246878..247921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="CYB_0238"
FT                   /product="sulfate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by similarity to SP:P14788; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01236"
FT                   /db_xref="GOA:Q2JPP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP6"
FT                   /protein_id="ABD01236.1"
FT                   /translation="MGITIEGVSKRFGEFQALHPTDLTIPTGSLVALLGPSGSGKSTLL
FT                   RLIAGLEKPDTGRISLTGRDATHASVQERNIGFVFQHYALFKHMTVRQNIAFGLEIRKA
FT                   SRAEIRARVDELLELVQLSGFGDRYPSQLSGGQRQRVALARALAVEPQVLLLDEPFGAL
FT                   DAKVRKELRKWLRRLHDEVHVTTVFVTHDQEEAMEVADQIVVMNQGRIEQVGSPAEIYD
FT                   HPATPFVMSFVGPVNELSPRSQLFCQLPEVQAGPHQLFLRPHDVQIEVNPGSSGVSARV
FT                   KEIIHLGREIQAELILSDGGSLWAHLSREQYANQPLQVGQQVYVRPKVVKAFPVKKTEM
FT                   TAMPVGA"
FT   gene            complement(248096..249100)
FT                   /gene="sbp"
FT                   /locus_tag="CYB_0239"
FT   CDS_pept        complement(248096..249100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="CYB_0239"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="identified by similarity to SP:P06997; match to
FT                   protein family HMM PF01547; match to protein family HMM
FT                   TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01237"
FT                   /db_xref="GOA:Q2JPP5"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP5"
FT                   /protein_id="ABD01237.1"
FT                   /translation="MGRWLGMGSLIFGLLLGLSGCVSGMGSGGSREEVAILLASFAVTR
FT                   DAYRQIIPAFEADWLAKTGQRVRVESSYGGSATQSRAVIDGLDADVVALALALDVERLV
FT                   AAGLIQPGWEARTPNQGIVTRSVAVIVTREGNPQGIRSWQDLARPGLQVVTANPKTSGG
FT                   ARWNFLALWSAVPEPQALAFTTQVYKNVRILPRDSREATDVFFQKGQGDALLTYEHEVI
FT                   LASLRGQSLFYVVPDPNISIDNPVAVVDANVDRKGTRAVAEAFVDYLFTPEAQRAFAEV
FT                   GFRPVEPTVAQEFAWRYPPVEKRVTVADLGGWEVVQSRFFADGALFDRIQAQL"
FT   gene            complement(249359..252145)
FT                   /locus_tag="CYB_0240"
FT   CDS_pept        complement(249359..252145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0240"
FT                   /product="putative acetyl coenzyme A synthetase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01238"
FT                   /db_xref="GOA:Q2JPP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP4"
FT                   /protein_id="ABD01238.1"
FT                   /translation="MWQRLDPSVDIWRARSHPLNPIFLPRSVAVVGATEREGSVGRTVL
FT                   WNLISHPFGGTVYPVNPKRHQVLGIRAYERLSALPEPVDLAIIAIPAAGVPKVVQECVE
FT                   AGVKGAIVLSAGFKETGPAGWELEKQIQQTIQSRQRDGVLRKLRLIGPNCLGIQNPHTG
FT                   LNATFAAQMARPGNVGFISQSGALCTSILDWSLQENVGFSAFISLGSMLDVGWGDLIDY
FT                   LGEDPHTHSIVLYMESIGDARSFLSAAREVALSKPIIVIKAGRTQAAAQAAASHTGSLT
FT                   GSDAVLDAAFRRCGVLRVDHIEDLFDLAEVLAKQPRPQGPHLTILTNAGGPGVLATDAL
FT                   IRAGGSLAQLSPQTLEQLERILPPHWSHGNPIDILGDADPERFAQVLEVVLQDPGSQGC
FT                   LVILTPQAMTDPTATAEKVVETWRRSGSRQPILASWMGGAGVDAGEHILNQAGIPTYRY
FT                   PDQAARVFGYLWRFSDNLKALYETPTLAPTRPVEQEKVQQTLAQARREGRTLLTEVESK
FT                   EILAAYGIPVVPTRVAESPEAAVEAAEAMGYPVVVKLYSHTLTHKTDVGGVQLNLPDAE
FT                   AVRRAFGQILRNVSEKAGPEHFQGVTVQPMVDTDGYELILGSSQDPQFGPVLLFGSGGQ
FT                   LVEVFQDRSIGLPPLNTTLARRLMENTLIYKALRGVRGRPAVDLEALEQLLVRFSQLVA
FT                   EQREIKEIDINPLLASSEGLLALDARVILRTEQDPQVPLAIRPYPTQYIWSFRDGITIR
FT                   PIRPEDEPLVIDFHRHVSDYSVYLRYFHPIKYSARIAHERLTRICFNDYDREIALVAEK
FT                   QEPEANRVSGTKSLILGISRLSRKHGFPQEAEFAMLVADPYQRQGIGTELLTRLIQVAR
FT                   CEGIQHLTGEVLCENEAMRRLCQRLGFQLRPSPEDPGILKAALALISDPPILATCSP"
FT   gene            complement(252156..254786)
FT                   /locus_tag="CYB_0241"
FT   CDS_pept        complement(252156..254786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0241"
FT                   /product="aldehyde-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="identified by similarity to SP:P17547; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01239"
FT                   /db_xref="GOA:Q2JPP3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP3"
FT                   /protein_id="ABD01239.1"
FT                   /translation="MPVTNLAELETLIQQVKAAQAEYATFTQEQVDRIFHKAALAANNE
FT                   RIPLAKLAVQETGMGIVEDKVIKNHFASEYIYNKYKHEKTCGVIERDESFGYERIAEPV
FT                   GLLAGIVPVTNPTSTTIFKALITLKTRNGIIFSPHPRAKKCTIAAAKVVKEAAEAAGAP
FT                   VGLIGWIDEPTIELSQALMQHPEVKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVID
FT                   ASADIPMAVSSILLSKTFDNGMICASEQAVVVVDAIYEQVKAEFGHRGAYILDPEQIEA
FT                   VRRILLKDGRLNPAIVGQSVQTIAALAGIQVPEGTKLLIGEVEKVGPEEPFSYEKLAPV
FT                   LALYRANDFHSAVDVAVQLVNFGGRGHTSVLYTDPANRDDIAYFENALQTGRVLINTPS
FT                   SQGAIGDLYNFKLDPSLTLGCGTWGGNSISENVGPRHLLNIKTVTQRRENMLWFRIPPK
FT                   VYFKPGCLPIALRELAGKKRAFLVTDKPLFELGILHPITQVLDEIRVSWDVYHDVEPDP
FT                   TLSNVNRGLEQLRQFQPDVIIAVGGGSPMDAAKVMWLMYEQPQVEFEGLAMRFMDIRKR
FT                   VYELPPLGQKAQLICIPTTSGTGSEVTPFAVVTDDRVGIKYPLADYALTPTMAIVDPDL
FT                   TLKMPKKLTAYGGIDALTHALEAYVSVMASDFTDGLALQAIKLLMTYLPRAYEKGAEDP
FT                   EAREKVHYAATIAGMAFANAFLGVCHSLAHKLGSTFHLPHGLANALMITHVIRYNATDA
FT                   PFKQAIFPQYRYPNAKHRYAEIADYLQLGGADDDEKVMRLIEAIEELKRKLGIPATIRE
FT                   ALGEKEREFYDRLEAMAEQAFDDQCTGANPRYPLIQDMKELYVLAYRGCRVDSALYHQP
FT                   EPVLA"
FT   gene            complement(254879..255289)
FT                   /locus_tag="CYB_0242"
FT   CDS_pept        complement(254879..255289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0242"
FT                   /product="OsmC family protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01240"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP2"
FT                   /protein_id="ABD01240.1"
FT                   /translation="MEVCVTYRDGVQFQAESRGHRILSDQPLDNHGRDQGMTPPEWFLA
FT                   SLGACVGFYAVKYLEARQLDPSGLEVVVTAEKVEHPARLDNIRIQVKIGIPLDERHQKG
FT                   LEKTVDACIIHNTLTHPPTLTTEIQVPAPVGA"
FT   gene            complement(255472..256221)
FT                   /gene="pflA"
FT                   /locus_tag="CYB_0243"
FT   CDS_pept        complement(255472..256221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="CYB_0243"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02493"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01241"
FT                   /db_xref="GOA:Q2JPP1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP1"
FT                   /protein_id="ABD01241.1"
FT                   /translation="MDTVMNPLTPIAGRIHSVETCGTVDGPGIRFVIFTQGCPLRCLYC
FT                   HNPDCRDPQAGQLVTVESLIAEIQRYKNYLRGGGVTATGGEPLMQPTFVAEIFRRCHEL
FT                   GLHTALDTSGYGQLEAAKPVLEHTDLVLLDIKSYLPELYRKVTGVSLEPTLNLARYLDQ
FT                   IHKPTWIRFVLVPGLTDPEENIKGLAEFVATLSNVERVEVLPFHKMGEYKWQQLGLPYT
FT                   LADVDPPTPEQVNHALQIFRDQGLVAI"
FT   gene            complement(256447..256857)
FT                   /locus_tag="CYB_0244"
FT   CDS_pept        complement(256447..256857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0244"
FT                   /product="pentapeptide repeat family protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01242"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPP0"
FT                   /protein_id="ABD01242.1"
FT                   /translation="MIMTVCSAADLVSQYASGRRDFREIDLQGAELQGIHLAGADLSYA
FT                   DFSGANLAGANLRGCDLSFADFSGANLSEADLRGCLLFGSNFRGALLEGALLDHADFDA
FT                   YTHFPKDFDPKAHRLHGITVDTSVPSPHDPSV"
FT   gene            complement(256939..259245)
FT                   /gene="pflB"
FT                   /locus_tag="CYB_0245"
FT   CDS_pept        complement(256939..259245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="CYB_0245"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01243"
FT                   /db_xref="GOA:Q2JPN9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN9"
FT                   /protein_id="ABD01243.1"
FT                   /translation="MVASVQRSVASPTELKAEPRTGSNAAGQKVLSDFATGAWQRCIDV
FT                   RDFIQRNYTPYTGDETFLAAATERTQRLWAKVKDLMALERERGILDADTAVPSTITSHA
FT                   PGYIDPELEQIVGLQTDKPLKRAIMPFGGIRVVESSLKAYGYELDPRTKEIFTQYRKTH
FT                   NDGVFDAYTEEMRRCRRSGIITGLPDAYGRGRIIGDYRRVALYGVDRLIEDKQAQKASL
FT                   DLDTMDEETIRLREELSEQIKALQELKEMGSRYGFDLGRPAANAREAIQWLYLAYLAAV
FT                   KEQNGAAMSLGRVSTFLDIYIERDLQAGILTEEEAQELIDHFVMKLRMVRFLRTPEYNE
FT                   LFSGDPTWVTECIGGMGLDGRPLVTKTSFRMLHTLYNLGPAPEPNLTVLWSERLPEAFK
FT                   RYCAKVSIETSSIQYENDDLMRPYWGDDYGIACCVSAMRIGKQMQFFGARVNLAKCLLY
FT                   AINGGRDEISGEQVAPAFAPITADVLDYDEVWPRMAQMMAWLAKTYVNTMNIIHYMHDK
FT                   YCYERLEMALHDRDVLRTMAFGLAGLSVTADSLSAIKYARVRAIRDERGLVVDYAVEGD
FT                   FPKYGNNDDRVDSIAVQLVQTFMAELRKHKTYRNAIPTQSILTITSNVVYGKKTGNTPD
FT                   GRRAGEPFAPGANPMHGRDTKGAVASLASVAKLPYDDALDGISNTFSIVPAALGRTAEE
FT                   RVANLVGLLDGYMRDGGFHLNVNVLNRETLLHAMEHPELYPQLTIRVSGYAVNFIKLTR
FT                   EQQLDVINRTFHQHC"
FT   gene            259659..260738
FT                   /locus_tag="CYB_0246"
FT   CDS_pept        259659..260738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0246"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase, putative"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01244"
FT                   /db_xref="GOA:Q2JPN8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN8"
FT                   /protein_id="ABD01244.1"
FT                   /translation="MNQSNRIVQGIHHLHFYLWDLPRWQEHFCQVWGFRMEGQLGSTLC
FT                   LRQGSLRLRLSQPAHAGDEVDRYLQQHSPGVVDVALAVVEQELLGLAELLQRRGAQVEW
FT                   IPAEEEGGPTLRLRTPYGLRHSLLPGSGIPDSAPAEENLFSHWDHLVLNVEQGSLQAAA
FT                   DWYEQVLGWRSLYRYSIRTNTSGLESVVVGDPEAGIQLAINEPTCAASQIQEFLDAHHG
FT                   PGLQHAALHSSDVFASVRRLRQGGVNFLQVPPEYYTNLARELASGAILRSGGLPPAISW
FT                   HDLVEQQLLLDATLPASDSPHPPLLLQTFTQPLFGRPTFFFEVIQRLGGATGFGEANFQ
FT                   ALFEALERQQRQRQQALVC"
FT   gene            complement(260889..262250)
FT                   /locus_tag="CYB_0247"
FT   CDS_pept        complement(260889..262250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0247"
FT                   /product="ISSoc9, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01245"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN7"
FT                   /protein_id="ABD01245.1"
FT                   /translation="MQRLQAFKYELLPNGQQERQMRRFAGSCRFVYNKALALQKERHEQ
FT                   GQKKLGYAGLCQLLTAWRHSADTAWLADAPVHPLQQALKDLERAYSHFFAQRAGFPKFK
FT                   KKGRSDSFRYPAPKQIQLDQANSRIFLPKLGWLRYRNSRDVVGKVKSVTVSKHAGKWFV
FT                   SIQTEREVDRPIPQGGAVGMDMGIARLATLSDGTFYAPLNSFKRHEARLRKAQQALSRK
FT                   VKFSNNWKKAKARLQRIHSQMANARRDFLHKVSTAISKSQAIVCIEDLRVRNMSKLAAG
FT                   TADAPGKNVRAKSALNKAILDQGWYEFRCMLEYKLAWKGGRLIVVPPQNPSRTCPCCGH
FT                   VSSDNRQTQAWFECVACGYENNADRGSGPEAFRGSGPEAFRGSGPEAFLVGAINILARG
FT                   IQLLRDEGQDTADAAVGMRVDQPPVSARMACGSNCTGGRKQEPAETTAQGAIHA"
FT   gene            262491..264302
FT                   /locus_tag="CYB_0248"
FT   CDS_pept        262491..264302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0248"
FT                   /product="peptide/opine/nickel ABC transporter (PepT)
FT                   family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01246"
FT                   /db_xref="GOA:Q2JPN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN6"
FT                   /protein_id="ABD01246.1"
FT                   /translation="MTEAVSTADSALLTVQGLRVFLPSRAAGEPSGSPVVDGLSFQIGI
FT                   GQTLGLVGESGSGKTMTALTLIDLLPSSARVEGKILFKGPDGTVDWLQLDPRQRRRYRG
FT                   SQIAMIFQEPSTALNPLYTCGQQLQETLRANTSLSPAEIRAQAIRLFEEVQLSPQMLER
FT                   YPHQLSGGQIQRAAIACAIASNPQLLIADEPTTALDVTVQAEILRLLWELQQHRQMAIL
FT                   FITHDLNLVAELADQVVVMRRGQAVEQGSVEQIFRDPQHPYTRGLLACRPVLERRLRRL
FT                   PTVQDFLEKGGSPEEQWQQVEIPAAVRVSGTESLEEERLRRLYSQPPLLQVRDLRTHYA
FT                   VRRGPFGRQVGEIRAVDGISFDLYPGETLGLVGESGCGKTTLGRTLLRLVRASSGQVIY
FT                   DGEELLRLPPQRLRRLRREIQLIFQDPAASLDPRMSVGASVIEPMALHGIGRNAAERRA
FT                   RAQRLFERVGLDPEALDRLPHQFSGGQRQRICIARALASEPRLIVCDEAVSSLDVSVQA
FT                   QVLNLLKDLQEELGLAYLFISHDLSVVKFMSDRIMVMNRGRIEELGPASQIYQQPQQDY
FT                   TRRLIAAFAPAVRSTSPKGRSVRDSGP"
FT   gene            264506..265258
FT                   /locus_tag="CYB_0249"
FT   CDS_pept        264506..265258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0249"
FT                   /product="DNA-binding response regulator RpaA"
FT                   /note="identified by similarity to GB:AAD30120.2; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01247"
FT                   /db_xref="GOA:Q2JPN5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN5"
FT                   /protein_id="ABD01247.1"
FT                   /translation="MARILIIEDDPSILDILRINLELAGYEVVKATDGVRGQALALQVL
FT                   PDLIILDLMLPQVDGLTVCQRLRREERTSEIPILMLTALGQTQDKIEGFNAGADDYLTK
FT                   PFEVQELLVRVRALLRRSDRIPQAAKHGEILTYGPLTLVPERFEALWFGKTIKLTHLEF
FT                   DLLHCLMQRHGQTVSPSEILQEVWGYEPDDDIETIRVHIRHLRTKLEPDPRHPQYIKTV
FT                   YGAGYCLELPNIADPVPPQPELAKDSHK"
FT   gene            265343..267475
FT                   /locus_tag="CYB_0250"
FT   CDS_pept        265343..267475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0250"
FT                   /product="amidinotransferase family protein"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM PF04455; match to protein
FT                   family HMM TIGR00300"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01248"
FT                   /db_xref="GOA:Q2JPN4"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN4"
FT                   /protein_id="ABD01248.1"
FT                   /translation="MPGAIRYLMCPPDHYEVDYVINPWMVGNVHRSSRERALQQWQALY
FT                   RHLSQRAEVKLIQPVPGWPDMVFTANAGLILGSKVVLSRFYHPERQGEQPHFKAWFEEQ
FT                   GYTVYELPPALAFEGAGDALLDRAGRWLWAGYGFRSMLESHPYLAKWLGIEVLSLRLVD
FT                   ERFYHLDTCFCPLSEGYLLYYPPAFDAYSNRLIEMRVPPEKRIPVQEADAIHFACNAVD
FT                   VNGTILVNRVSPELEATLQERGFAVVQTELTEFLKAGGAAKCLTLRLDETVAPQTDPVA
FT                   TVLSRTVTLQGHLVDSDLLTRAVDCIVDNGGSFQILKFQLGEKRQSTSTVELAVSAPTE
FT                   ETLDTILSALIEQGARLSEETQQDARLERVEKAGVAPDDFYVTTIYPTQVRVAGQWIPV
FT                   QRQRMDGVIVVKGSDCNGKTEFSAYCTLIRDLQVGDAVVCGVEGIRTVRQASKERSSQE
FT                   FTFMGSGVSSERRVEILVEQIAWELRQIKERGGKTVVVAGPVVIHTGGGSHLATLIREG
FT                   YVQALLGGNAIAVHDLEQNLYGTSLGVDLSRGTPVKGGHKHHLKTINLIRKYGSIRAAV
FT                   EAGVITGGVFYECIRAQVPFSLAGSIRDDGPLPDTEMDLIKAQQDYARLLQGADMVLML
FT                   SSMLHSIGAGNMTPAGVKLICVDINPAVVTKLADRGSLESVGIVTDVGLFLSLLVQQLA
FT                   RLGQVYERPQPALAAR"
FT   gene            267462..267557
FT                   /locus_tag="CYB_0251"
FT   CDS_pept        267462..267557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0251"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN3"
FT                   /protein_id="ABD01249.1"
FT                   /translation="MLPASHPIHKRCYLLGSLNWDPQASKGYAFY"
FT   gene            267544..268326
FT                   /locus_tag="CYB_0252"
FT   CDS_pept        267544..268326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC90863.1; match to
FT                   protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01250"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN2"
FT                   /protein_id="ABD01250.1"
FT                   /translation="MPFISLLTDFGLQDPYVGIMKGVIHTLSPQAQLIDLSHGIPPQDV
FT                   AAARFALMTAYPYLPSGTIHLAVVDPGVGSSRRAVAIQTETGFLVGPDNGLFSGVLAQT
FT                   PALAAVELNRPRYWRTPSPSRTFHGRDIFAPVAAHLANGIPLAELGDPLDVAELTRWEW
FT                   PPPQMETNGCRGLVQAIDHFGNGITNLPGHWVEGRSWSAWIKGIPVRSVATFAEGEVGE
FT                   VLALVGSSGWVEIVQNRGNASRALGFKVGDEVRVQWSG"
FT   gene            complement(268365..268817)
FT                   /locus_tag="CYB_0253"
FT   CDS_pept        complement(268365..268817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0253"
FT                   /product="small heat shock protein (HSP20) family protein"
FT                   /note="identified by similarity to SP:Q06823; match to
FT                   protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01251"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN1"
FT                   /protein_id="ABD01251.1"
FT                   /translation="MATLYFSPLFEVQALQAEPNRGRSRSFLPTPLQVWESGEAYTVQL
FT                   WVPGANRERFHIEATAQQLSISGEIQVHGPEGAELRYQEVEPQPFQRILKLARRIQPEK
FT                   VSATYRDGILTLTLPKADAARVIKVQVGASNPTTPTEAVTVESQPA"
FT   gene            268891..268983
FT                   /locus_tag="CYB_0255"
FT   CDS_pept        268891..268983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01252"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPN0"
FT                   /protein_id="ABD01252.1"
FT                   /translation="MACTWDLNSQNPALIIQESHPSEGGQTDLR"
FT   gene            complement(268915..269121)
FT                   /locus_tag="CYB_0254"
FT   CDS_pept        complement(268915..269121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01253"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM9"
FT                   /protein_id="ABD01253.1"
FT                   /translation="MGVGSITVFFFHSHLPHSVLSKMFRVNHWIALFVFIPLPHEVRGS
FT                   CLSQIGLPSLAGMAFLDDQSRIL"
FT   gene            269105..269263
FT                   /locus_tag="CYB_0256"
FT   CDS_pept        269105..269263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01254"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM8"
FT                   /protein_id="ABD01254.1"
FT                   /translation="MDPTPIPIRFQVNGQPYGQVVPPGITLLSLLRELGWVGVRRRRGV
FT                   FRLPRDP"
FT   gene            269266..269412
FT                   /locus_tag="CYB_0257"
FT   CDS_pept        269266..269412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01255"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM7"
FT                   /protein_id="ABD01255.1"
FT                   /translation="MPELAQRASDPIEVELHHAADESSVSFAVAGVELAVDMETGQIEL
FT                   LIA"
FT   gene            269597..270751
FT                   /locus_tag="CYB_0258"
FT   CDS_pept        269597..270751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0258"
FT                   /product="ISSoc8, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01256"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM6"
FT                   /protein_id="ABD01256.1"
FT                   /translation="MSQTISVRCKLIVPQELRQEIDRTLQGFANACNQILDTAKQKNCW
FT                   NTAKLHHLVYRPVRAATGLKANHVCQALRRVISNAKAVKQVHRFRPTSLTLDARTFKYR
FT                   ESDQAVGVTLMSGRVWLKLKIGGYQIALLRGQTPTSATLSKTKQGDYYINIAVELDTPP
FT                   TGKTPKVIGVDLGRRDIATASNGRSWSGEHIQAVRDRFSRVRAKVQSKRTRSSRRLLRR
FT                   LSGRERRYQTWLNHNISKTLVRDAQAIGAALAFEDLTGIRDCLNQKPRSKAERRRTNNW
FT                   AFYQLRTLVAYKAAIAGVPVVLVPPAYTSQTCHKCLHIHPERGKSYRNGKSFKCGHCGW
FT                   EGDADHNAAQVISLLGATVNSPEIPKLSCPLGPLGIGIKLAPCA"
FT   gene            270933..275033
FT                   /locus_tag="CYB_0259"
FT   CDS_pept        270933..275033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01257"
FT                   /db_xref="GOA:Q2JPM5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM5"
FT                   /protein_id="ABD01257.1"
FT                   /translation="MYVYCPEEFLGSKTQCNLEALIERLEEGGRTLLSQLFDVRYPYWK
FT                   RNLRNNIRLVGELRYVGEVPVLVLFGLWPRGSHEYREFLDRRRDPDYQERVRSWVPDDR
FT                   LQAWLAQRHEPGDPPNHLPPLPDELYEWTQFLNAPNPQERLVLESGEWVRQVRALSPEQ
FT                   RRQAYQAVSRLVIEGRLYRQLPPFYLEAEVKCWQEESLYLAVSLVQACEQPGRLFPFLI
FT                   GVYDHAPEQKERFELGCQTCLFGMKAKQPDILQHPQPLEVWKRYARRAYPDYMVMDETI
FT                   WLEMQEITEGNLALSMEEEEILQSTSMPLLINGRAGSGKSLMLYYRFADYCSHYLKTSK
FT                   QRPLEYRPLFLTYSPSLVQQARDRVSSILRISHRYREKGCSFSTEEIQQCQTFFSTFQD
FT                   YLLNCLPAERQERYQPDRYVNFYRFQSWYCGRRDVELAWHTIRTLIKGYEVSDYLDPDS
FT                   YRELPEADRSVDEEAFERIYEEIWPGYRDRTTHEGYWDDQDLARDVLQNGTLNPIHPVI
FT                   FCDEVQDFTQLELNIIFCLSPWGKYKLDWAIEHLPYAFAGDPLQTINPTGFRWAALKKY
FT                   LYEHIRAYLLPSHPFEIAGPQELRNNYRSNPQVTRFSNVVNLWRRVLSKSREIYPQQPW
FT                   RPHEQGMPVQRFVLDGQERNLIEDELRKMLSDLTGTVCILPCPVGEELNYVRQDPELQK
FT                   IFAEELKQNLKPPLLQTATSVKGMEFKKVILYKFGNAYRQNFNRQLNYYARGAGEAISL
FT                   QLHYFLNQLYVGITRPIEALAIVDTSAGWREFWDPSLESNSWLDHPSLQPDRSEWETDP
FT                   PVLGYPVKGINIQYWTNTSLEDLQEAALELLRRGIEEGNPKLLEDVQTLARKAKKPPLE
FT                   QECQAWLLKLQRDYVSAGQKFLSLEQSALPNKNLKREAWECFWRGKAWLELQRNAAYFA
FT                   GCPGIPDYSPLVDLMVATQRTSVKSMERFRQVVRVRDWLSVEVSPKDRDFVPLTRTDST
FT                   WKECVQQFLAELEQVLNNLGTFCPQEEARSRFLQETLEALKGRLAFLGQRQPFANQYYK
FT                   IWGICHFYRQEFERAVEVWDQGGQTEHSPYYRAKIHLEPLPGKVRWLSKDRQDSVVLDR
FT                   WQEAGRPLTGEWAEYIGDVVTSLERLKDWPLMLRVLIQCREWEKLWKTVQAHPQAWQRG
FT                   HDYELVAAMARDIRTNWEDLRRKSPGLRDFLQEVVTSTQMERAWWLQPLEVGLACERLG
FT                   HYRDTLRFYERFTESRTGRLTRQQRSQIRQRWLVTHQRYQEVLQAEGRPTDRLAEEFRQ
FT                   AQERWREQLPQAEPELDERDPWALDFVEHPSPVQSWLLQRAQTDTQSRLRAEIAQALEH
FT                   LDERHLQQVHSLIQRFSRADPST"
FT   gene            complement(275061..276122)
FT                   /gene="hisC"
FT                   /locus_tag="CYB_0260"
FT   CDS_pept        complement(275061..276122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="CYB_0260"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01258"
FT                   /db_xref="GOA:Q2JPM4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPM4"
FT                   /protein_id="ABD01258.1"
FT                   /translation="MCALQYLRPDLLYLKPYDAVPAPAADKLDANEFPLDWPAGFKQKL
FT                   SLLWEKGIPSNRYPDAHHRGLKQAIAAYAGAEPEQISLGNGSDELIRSLLIATCLGGRG
FT                   GILVAEPTFSMYAILAQSLGIPVVRVPRDPETFALDLERCQQALREHPIRVVCLVDPNS
FT                   PTGNGLTAAEWEWVEGLPEEILVILDEAYFEFSRHTALPKLAEHPNWVILRTFSKAFRL
FT                   AAHRVGYAVGHPQLMQVLDGIRLPYNLTALSQWAVQMALEHAEELLADVTLICQEREAL
FT                   YQALQELPGVRVWPSQANFLYFRVAGWDPQELQRAWQELGTGVRYTGGGLRLTVGTPEE
FT                   NRRALERLRQILQ"
FT   gene            complement(276171..276629)
FT                   /locus_tag="CYB_0261"
FT   CDS_pept        complement(276171..276629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0261"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01259"
FT                   /db_xref="GOA:Q2JPM3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM3"
FT                   /protein_id="ABD01259.1"
FT                   /translation="MPFHVVLVAPEIPANTGNIARTCAATDTPLHLVDPLGFRLSDRYL
FT                   KRAGLDYWQHVQLYRYPSWSALVQAHPEARFWCFSVRGKALYTEVTYQPGDWLVFGSES
FT                   RGLDPLFLETYPSVRIPLRGPVRSLNLSNAVAIALFEALRQQGSLTKE"
FT   gene            complement(276639..278102)
FT                   /gene="ffh"
FT                   /locus_tag="CYB_0262"
FT   CDS_pept        complement(276639..278102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="CYB_0262"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by similarity to SP:P37105; match to
FT                   protein family HMM PF00448; match to protein family HMM
FT                   PF02881; match to protein family HMM PF02978; match to
FT                   protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01260"
FT                   /db_xref="GOA:Q2JPM2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM2"
FT                   /protein_id="ABD01260.1"
FT                   /translation="MFDALSEKLELAWRKLRGQDKITETNIQEALREVRRALLDADVNL
FT                   QVVKQFIEDVREAALGSEVILGVTPDQQFIKIVHDELVKVMGEANVPIAQAEQPPTIVL
FT                   MAGLQGSGKTTTCAKLALYLRKQGKKSLMVAGDIYRPAAIDQLKTLGQQIQIPVFDLGK
FT                   ADPVEIARQGVETARQQGYDYVILDTAGRLQIDLEMMAELERIKAAVQPHEILLVVDAM
FT                   IGQEAASLTRAFHERLGITGAILTKLDGDTRGGAALSIRQVSGQPIKFIGVGEKVEALD
FT                   PFYPDRMASRILGMGDILSLVEKAQEEIDLGDAASMAEKMMTAQFDFTDFLKQMRLIKR
FT                   MGSLAGLLRLMPGMGKISEEQLQKGQDQLARAEAMINSMTPEERRNPDLLARSVSRKRR
FT                   VARGSGHKLEDVSRLVSDFQRMRDMMRNMGMGGGFPGMGWGGGRTSLPGGDPSWRGRST
FT                   ASPSRQQPSRKPGKGGGKKGGGNRGFGGK"
FT   gene            278269..279717
FT                   /locus_tag="CYB_0263"
FT   CDS_pept        278269..279717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0263"
FT                   /product="lignostilbene-alpha,beta-dioxygenase, putative"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01261"
FT                   /db_xref="GOA:Q2JPM1"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM1"
FT                   /protein_id="ABD01261.1"
FT                   /translation="MVSVASLPYSTTDWQLGYRSLSQEYDYWITEIEGRIPAGLRGTLF
FT                   RNGPGKLEAGSQRYGHPFDGDGMVCAITFVEGKVHFRNRFVRTREFEAEEKAGRVLYRG
FT                   VFGTQKPGGWWSNFLDLRFKNPANTNVIYQGDKLLALWEASAPYRLNPATLATEGIETF
FT                   AGGISASQPFTAHPRRDPHTGDLIAFGVRAAQNSTLLFYRLDSRGRLVEKRDYRLPGFA
FT                   FLHDFVWTPRYRIFFQNPLAFNPLPFVLGWQPAGTCLTLKPGEPTRIWLFPQGDEPLQL
FT                   ETEPGFVFHFVNGYGVGDRVVVDAVLYESYPALEPDADYLQIDFAQIPAGKLWRFYLDP
FT                   KGGSVKRELLLDRSVEFPAIHPARMGGSHRYIYIGATHAPGPNAPLQAILKLDTATGRT
FT                   QQYSFAPRGFVGEPVFIPNPEDQGEEAGWIVTVVFDAASQRSQVVILEAADLTAGPVAR
FT                   IPLRHHIPYGLHGSFTPQVWVTPA"
FT   gene            complement(279728..279832)
FT                   /locus_tag="CYB_0264"
FT   CDS_pept        complement(279728..279832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01262"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPM0"
FT                   /protein_id="ABD01262.1"
FT                   /translation="MFLHSRDPTDRSPGLPQRLGRMIFPEPMGSIQPS"
FT   gene            280292..281254
FT                   /locus_tag="CYB_0265"
FT   CDS_pept        280292..281254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AF2018"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01263"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL9"
FT                   /protein_id="ABD01263.1"
FT                   /translation="MSSDLRPPFRPVRPPRPSSTGEAKGSLSSAKAQDPAAAPGAVRDS
FT                   GTESLQPVVSTTASLEEKKERVCLEPIPPPGEKMQYRAIGLIEGQYIPSPEHFTRGILR
FT                   TSDGLDLNAVLLGRVMSLVRKHLRPERNYLWVVYPRTRDKTEDLHVQLLGVWAPEEMGR
FT                   TLPEGSRPTVVPDWFSIRGEVVFQSQEKGFIIVKIRQSGKKASANSPAQRVQKDGTAAS
FT                   KPQAFKLRLIGSLPGKGVGNFWDLQVRRRGSLLYVEAGTPIGPVLKTPPRPRLKRSPPQ
FT                   PKARKSSTPSTRGEASIQEPFYPLRDPTKVPKPVKRKRP"
FT   gene            281337..281615
FT                   /locus_tag="CYB_0266"
FT   CDS_pept        281337..281615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AD2089"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL8"
FT                   /protein_id="ABD01264.1"
FT                   /translation="MAEPTPPNKDEFISPRYPYWGEVKPQNLVFDANLQEFSNKVSLIC
FT                   SLETGGKITPEEAYRQIKELWKQLKQTKKAILDDPQWKESPPELPEE"
FT   gene            281683..283410
FT                   /locus_tag="CYB_0267"
FT   CDS_pept        281683..283410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0267"
FT                   /product="NitT/TauT family ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01265"
FT                   /db_xref="GOA:Q2JPL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL7"
FT                   /protein_id="ABD01265.1"
FT                   /translation="MRTFPSPEALRRLPAGAADGAIILGTLVLLALVAQVGVGAFERFQ
FT                   PPAVVPRIDLDPRNLPYYAARSTLRMFIALAFSTLFTLIYGYIAAKSRWAERILIPLLD
FT                   VLQSVPVLGFLSITVTGFIALFPGSLLGLEAASIFAIFTSQVWNMTFSFYQSLRTLPQE
FT                   LVEAATLYRLSGWQRFTQLEVPAAMVGLIWNAMMSFGGGWFFVAASEAISVLNQEYTLP
FT                   GLGSYVEAAVQAEDLPKLGWALLTMAGVILLVDQLFWRPLVAWSDKFRLEQSSGAAAPE
FT                   SWLYDLLTTARIPRLIGSWLSPLAELVDRLLSYLTRPHWVDPLSPEAERRRERLLTQLS
FT                   RAAIGGIGIWIVYFVATTVGFGEVMLTFGLGILTLLRVSVLLVFATVIWTPIGVAIGFN
FT                   PKLAKLLQPVVQFLAAFPANFLFPFATLFFIRAQISIEWGSILLMSLGAQWYILFNSIA
FT                   GAQSIPTDLREMAVDVGLRGWQRWRKLIIPGIFSAWVTGGVTASGGAWNASIVSEIVAW
FT                   GSTTLTATGLGTYIAEATAVGDWPRITLGIGMMSLFVVGINRLFWRRLYQLAEEKYHL"
FT   gene            283433..284806
FT                   /locus_tag="CYB_0268"
FT   CDS_pept        283433..284806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0268"
FT                   /product="NitT/TauT family ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01266"
FT                   /db_xref="GOA:Q2JPL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL6"
FT                   /protein_id="ABD01266.1"
FT                   /translation="MSSAASPVLIEVEKVYKRFPLPEGKGEFTVLSQIDLQVRAGEVLA
FT                   LLGRSGSGKSTLLRIMAGLIPPSQGRVLSNGQPLRGPNPDVAMVFQSFALLPWLTVQEN
FT                   VELGLQAQGIPREIRRQRALKAIDLVGLDGFESAYPKELSGGMKQRVGFARAFVLEPKV
FT                   LFMDEPFSALDVLTAENLRGEIDELWNAQAFPSQSILIVTHNIEEAVFLADRVVILGSN
FT                   PGRIRGEVRIDLPRPHERTDPRFKSLVDYIYEIMTNPEIAVTGEVALPALAGDKATSPY
FT                   ALPLPHARVGGISGLLELIVEWPQGRAEIADLAERLQLAVDDLLPILDAAVLLGFAEVA
FT                   SGVVQLTEIGQDFANTTILRSKDLFRQQLLARVPVFRSILQTLEEKGSRSMRADFFLDL
FT                   WDEHFPHAEAERQFATAIDWGRYAELFEYDASEERLYLPEPSESSTAQKPVGLNSRSD"
FT   gene            284955..285965
FT                   /locus_tag="CYB_0269"
FT   CDS_pept        284955..285965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD02009.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01267"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL5"
FT                   /protein_id="ABD01267.1"
FT                   /translation="MLLVLRQHLKSWPGNFKAYAAACRRGEVQPGKMFVFETGNLTNPR
FT                   YIINFPTKRHWRGKSRIEDIEAGLKSLAEEIRHLGLRSVALPPLGCGLGGLHWPDVRSR
FT                   IEQALAELPDVHILVFEPTGPQPLPKSMRRGQVPTLTPGRAVLVGLMERYTNGLLVPFV
FT                   SLLELHKLMYFLQEAGEPLRLRFTKGVYGPHAENLRHVLKEIEGYYISGYGSGSDRPDK
FT                   KLELVPGAVEEAHRYLAGQPETRERFERVSDLVEGFESPYGLELLATVHWIVTRGHPST
FT                   TAELVESFYAWGDRKQQFSSKQILLAARVLAEKGWFKALPTEPLAASRSQFETRP"
FT   gene            complement(286029..286478)
FT                   /gene="ndk"
FT                   /locus_tag="CYB_0270"
FT   CDS_pept        complement(286029..286478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="CYB_0270"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by match to protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01268"
FT                   /db_xref="GOA:Q2JPL4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPL4"
FT                   /protein_id="ABD01268.1"
FT                   /translation="MERTFIAIKPDGVQRGLVGTIIQRLESRGYQLVGLKLVQVSQELA
FT                   EAHYAEHKERPFFHSLVKFITSGPVVAMVWQGKGVIAAARKLIGKTNPLEAEPGTIRGD
FT                   FGIDIGRNLIHGSDGVETAQREIALWFDESELVSWTPVAQSWIYE"
FT   gene            complement(286566..287237)
FT                   /locus_tag="CYB_0271"
FT   CDS_pept        complement(286566..287237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0271"
FT                   /product="HupE/UreJ family protein"
FT                   /note="identified by match to protein family HMM PF04955"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01269"
FT                   /db_xref="GOA:Q2JPL3"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL3"
FT                   /protein_id="ABD01269.1"
FT                   /translation="MSWLWQQVPSPLGRWRKEGIPSFAAAGGALAVTGFFSPAFAHHAL
FT                   GGKLPATAWEGFLSGLAHPVIGLDHLAFVVAIGLVAAGQPWRYGIPLGFVLAGLVGTGI
FT                   HLAGWDPLGLTELAIASSVVLFGLLLVQPRQIPSWLLLIGGSLAGLFHGYAYAETIIGA
FT                   QPMPWVGYLLGLSTVQYGVALLALWAAERWGLRIPGLTRWAGWAITVVGAAFLTLAVVG
FT                   A"
FT   gene            complement(287288..287800)
FT                   /locus_tag="CYB_0272"
FT   CDS_pept        complement(287288..287800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01270"
FT                   /db_xref="GOA:Q2JPL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL2"
FT                   /protein_id="ABD01270.1"
FT                   /translation="MSYLIAVLPDRIAAEAAYSALEQAGFSLERLHLLGRGYKSADEFG
FT                   LIDPAQAARRQMRRLAIWLVPFGFLAGVGFSVLSGLDTFAWAGPIGNHLIGGLLGAMGG
FT                   AMGSFFVGGGVGLSGGSGDALAYRNRLAAGKYVLIVEEENETRLREATRILRQFEPENL
FT                   QGYRERP"
FT   gene            287862..288215
FT                   /locus_tag="CYB_0273"
FT   CDS_pept        287862..288215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0273"
FT                   /product="putative methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01271"
FT                   /db_xref="GOA:Q2JPL1"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL1"
FT                   /protein_id="ABD01271.1"
FT                   /translation="MTQSGSTSAPSTSLYQRFYEVVRRIPPGRVATYGQVARVAGYPGY
FT                   ARQVGYALFRLQGQNTDIPWQRVINAQGRISYSPFRLGYDDLQKALLQAEGIHFDAEGQ
FT                   VDLQQFGWDPGEA"
FT   gene            288323..290380
FT                   /locus_tag="CYB_0274"
FT   CDS_pept        288323..290380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0274"
FT                   /product="5'-nucleotidase domain/ Ser/Thr protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01272"
FT                   /db_xref="GOA:Q2JPL0"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPL0"
FT                   /protein_id="ABD01272.1"
FT                   /translation="MKPACRARGSAPAKRWLPDWLNPLARSLWVGLWCLVLSLASACGS
FT                   SSSVPPTGGGAGFIASDPNVALSTQPPAFTLQILHASDLEASIAAVQDAPRFSAVVNAL
FT                   RPQFPNTVVLSSGDNYIPSPFYNASTDRSLQGRYNLTPGKADIEIINAIGFEAAAFGNH
FT                   EFDQGTRQIRDLIRPDTGRGYAGARFPYLSANLSFSGTGELASSDFAADGQEASSIRGK
FT                   IAKTAVITVGGQRIGLVGATTTRLAAISSPGPEVRVEGRVDDTDQVSAALIQGFVDQLT
FT                   AQGINKIILLAHLQQLQNEVALASQLRNVDIIIAGGSHRVIAKPTDRLRTDLPDTRRGD
FT                   YPILRSSASGQPVAVVNTGSNYRYVGRLVVSFDANGVIARIDPVSGAYATDDQGVAAVR
FT                   GTPNPDVVRIANEIGNIIRTKDGRTFGSTTQFLNGLRAEVRTEETNLGNLTADANLAYA
FT                   RTVDPSTVISLKNGGGIRAPIGATTGGGGGEPVRRIPPVANPEAGKQSGQISQLDIETA
FT                   LAFNNGLSLLTVTAEELKQIVEHGVAQTQPGATPGRFPQIGGFAFSFDPSRPPGSRVLS
FT                   LRVDTPTGRDVVVRNGQVQGDPRRTFRLVTLDFLANGGDDYPFPRLSNPNRVNLAPSSG
FT                   ITFDTPGSEQDALARYLRQIGVFTQADTPPAQDTRIQNLSARPDTVLQGL"
FT   gene            290738..291265
FT                   /locus_tag="CYB_0275"
FT   CDS_pept        290738..291265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01273"
FT                   /db_xref="GOA:Q2JPK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK9"
FT                   /protein_id="ABD01273.1"
FT                   /translation="MTLETFFTQLNANGLAIALLLFATPWVVWVLCDWIPGQWEEPFLL
FT                   SLSIGLGAVTLVLWAGYLAYATNTAGWQAVVKQADMFLLLVPPWTFLSSIWVARQRMPL
FT                   SRVPAFRTLQGIGILAAVYLIFSWLSRRVYLVFFSYMPFSAFLWILAGLLGVAYIGYRI
FT                   IFGDPPKYPPET"
FT   gene            291317..291781
FT                   /locus_tag="CYB_0276"
FT   CDS_pept        291317..291781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0276"
FT                   /product="GUN4 family protein"
FT                   /note="identified by match to protein family HMM PF05419"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01274"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK8"
FT                   /protein_id="ABD01274.1"
FT                   /translation="MVTVPLTSALNIDYRPLQELLSAGAWLEADRLSLQLLCRAAGEGA
FT                   ARRGWLYFSEVSRIPVEDLRTIDRLWRAASGDRFGYSVQRQLWLGVNRNWERLWPLIGW
FT                   KQGYHWTRYPDEFIWDLSAPKGHLPLSNQLRGVRVLEELLTHKAWEEASG"
FT   gene            291858..292559
FT                   /locus_tag="CYB_0277"
FT   CDS_pept        291858..292559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01275"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK7"
FT                   /protein_id="ABD01275.1"
FT                   /translation="MPVDLAQACEQAIGATRLAMQAGYRRLLIEILAPDLKPEVLARPF
FT                   LELVQPPALVLFSDAGGAALAQREWGSLPEGIELQSLTSRTQPTPEQSILLVMPAVYSL
FT                   DQVERVCQAVSGGDPSGLASKGRDPKPVVLLNPQLQDAATVGVGLAGRRLRQRFLSTFE
FT                   TSYYLRSLVEGALFRAYPDPWSVWQQEEPGLYSVLKTFIAQPTGEEVAELFRASKGKDP
FT                   WWSWRRWLGSL"
FT   gene            292778..294145
FT                   /gene="thiC"
FT                   /locus_tag="CYB_0278"
FT   CDS_pept        292778..294145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="CYB_0278"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01276"
FT                   /db_xref="GOA:Q2JPK6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPK6"
FT                   /protein_id="ABD01276.1"
FT                   /translation="MRSEWVARRRGQANVTQMHFARQGVITEEMEYVAQRENLPPELIR
FT                   SEVARGRMIIPANINHTNLEPMCIGIASRCKVNANIGASPTSSGLAEELEKLKLAIKYG
FT                   ADTVMDLSTGGGDLDEIRTAIIQASPVPIGTVPIYQALESVHGKVEKLSAEDILHVIEK
FT                   QAQQGVDYMTIHAGILIEYLPLVRHRLTGIVSRGGGILARWMLAHHKQNPLYTHFRDII
FT                   EIFKKYDVSFSLGDSLRPGCLHDASDEAQLAELKTLGQLTRMAWEHDVQVMVEGPGHVP
FT                   MDQIEFNVRKQMEECDEAPFYVLGPLVTDIAAGYDHISSAIGAALAGWYGAAMLCYVTP
FT                   KEHLGLPNAEDVRNGLIAYKIAAHAADIARHRPGARDRDDEMSRARYNFDWNRQFELSL
FT                   DPERAREYHDETLPADIYKTAEFCSMCGPKFCPMQTKMDAEALSELEQFLAAQPTG"
FT   gene            294356..294742
FT                   /locus_tag="CYB_0279"
FT   CDS_pept        294356..294742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0279"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01277"
FT                   /db_xref="GOA:Q2JPK5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK5"
FT                   /protein_id="ABD01277.1"
FT                   /translation="MALRQLGHVAIRVEDIPKAVEFYQKLGMVNVWQDPDWAYMKAGED
FT                   GLALLGPGYRAAGPHFGFVFDSIEELQQEHQRLKSQGILVGEIHSHRDGTASFYGKDPD
FT                   GNLFEFLYEPAGTFDQAKAAQATA"
FT   gene            complement(295074..295370)
FT                   /locus_tag="CYB_0280"
FT   CDS_pept        complement(295074..295370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0280"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01278"
FT                   /db_xref="GOA:Q2JPK4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK4"
FT                   /protein_id="ABD01278.1"
FT                   /translation="MATIRFVNENREIFVAEGANLRLKALENQIDLYKMMAKLLNCGGN
FT                   GQCGTCVVEIVEGSENLSPRTEAENRKLKRKPDSYRLACQTKVLGDVSVKTKP"
FT   gene            295732..297264
FT                   /gene="psbB"
FT                   /locus_tag="CYB_0281"
FT   CDS_pept        295732..297264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="CYB_0281"
FT                   /product="photosystem II P680 chlorophyll A apoprotein"
FT                   /note="identified by match to protein family HMM PF00421"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01279"
FT                   /db_xref="GOA:Q2JPK3"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK3"
FT                   /protein_id="ABD01279.1"
FT                   /translation="MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYETAIF
FT                   DPSDPVLNPMWRQGMFVMPFMVRLGVVNSWGGWNIYGESVANAGFWTFEGVATAHIVLS
FT                   GLLFLAACWHWVYWDLELFRDPRTGEPALDLPKIFGIHLLLAGILCFGFGAFHLTGVFG
FT                   PGMWVSDPYATTGHVQPVAPEWGPAGFNPYNAGGVVAHHIAAGIVGIIAGLFHITVRPP
FT                   QRLYRALRMGNIETVLSSSIAAVFFAGFVVAGTMWYGSATTPVELFGPTRYQWDSGYFN
FT                   QEINRRVNAAMEAGMTRSEAYNSLPKSLLFYDYVGNSPAKGGLFRAGPMNKGDGIAIEW
FT                   LGYPVFRDREGRELTVQRMPNFFETFPVILRDADGVVRADIPFRRAESRYSFEQVGVTV
FT                   EFYGGKLDGQVFTDPATVKKYARQAQLGQLFEFDRETPKADGTFHTSPRGWFTFAHAVF
FT                   ALLFFFGHIWHGARTLFRDVFAGIDPNMSEEMVEFGVFQKVGDPTTRKVQEA"
FT   gene            297371..297469
FT                   /gene="psbT"
FT                   /locus_tag="CYB_0282"
FT   CDS_pept        297371..297469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="CYB_0282"
FT                   /product="photosystem II reaction center protein PsbT"
FT                   /note="identified by match to protein family HMM PF01405"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01280"
FT                   /db_xref="GOA:Q2JPK2"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPK2"
FT                   /protein_id="ABD01280.1"
FT                   /translation="MEAITYTFILFLTLGLLFFAVAFRETPRITKK"
FT   gene            297869..298279
FT                   /locus_tag="CYB_0283"
FT   CDS_pept        297869..298279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0283"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01281"
FT                   /db_xref="GOA:Q2JPK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPK1"
FT                   /protein_id="ABD01281.1"
FT                   /translation="MATVLLVEDDPINARVFEKVLRRRGGFEVFHSQDVEQILKLAQGH
FT                   EVDVILLDVSLSQSTFRGEAVDGIRIAQLLKADPKSRSIPIILVTAHAMRGDREAFLAQ
FT                   SGADGYIAKPVVDHEEMVNQVRQVLSQGPRQG"
FT   gene            complement(298297..298974)
FT                   /gene="purQ"
FT                   /locus_tag="CYB_0284"
FT   CDS_pept        complement(298297..298974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="CYB_0284"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01282"
FT                   /db_xref="GOA:Q2JPK0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPK0"
FT                   /protein_id="ABD01282.1"
FT                   /translation="MAGVRFGVVVFPGSNCDRDVAWVTRGLLGCPTRLIWHRETDLSEL
FT                   DVVVLPGGFSYGDYLRCGAIARFAPVMGSLKEHAARGGYVLGICNGFQILTEAGLLPGA
FT                   LVRNANLHFICDRVGIRVERQDLPWTSAYPQGSTLTLPIAHGEGRYTCDPDTLKQLQDR
FT                   GQIVFRYAPVAPNGSVDNIAGICDPSGRILGLMPHPERAADPDLPGQDGIPFWQSILRS
FT                   FAA"
FT   gene            complement(299090..299347)
FT                   /gene="purS"
FT                   /locus_tag="CYB_0285"
FT   CDS_pept        complement(299090..299347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="CYB_0285"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01283"
FT                   /db_xref="GOA:Q2JPJ9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ9"
FT                   /protein_id="ABD01283.1"
FT                   /translation="MQFQAQIQIHLRPSVLDPAGAAVQSSLHQLGHTQVQQVRIGKHIQ
FT                   LQLEAPDAETAHRQVDELCHQLLANPVIETYQIQVAAIGG"
FT   gene            299410..300183
FT                   /locus_tag="CYB_0286"
FT   CDS_pept        299410..300183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0286"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01284"
FT                   /db_xref="GOA:Q2JPJ8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ8"
FT                   /protein_id="ABD01284.1"
FT                   /translation="MDASRVVAIAHNVFRETIRDRILYLVMVFAVAMLGATVLIPQVAN
FT                   QAHNKIIADLGLAAIHFFGLIVAIFVGTGLVNKEIERRTVYVLIAKPMSRAEFIVGKHL
FT                   GLSALLSVLVLLMTVVFLLSLLLVQAPIPLLAILWATVFTFLELVLIVAAALLFGVFTS
FT                   SILATLYTIALFLMGHASRALLQLSKLVKDAGFGKLFEVIYLILPDLERLNLRDAAVYG
FT                   QVPPPAELLGDALYGLVYTLLLLILAVLVFARREF"
FT   gene            300200..300928
FT                   /gene="comB"
FT                   /locus_tag="CYB_0287"
FT   CDS_pept        300200..300928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="CYB_0287"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /note="identified by match to protein family HMM PF04029;
FT                   match to protein family HMM TIGR00298"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01285"
FT                   /db_xref="GOA:Q2JPJ7"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPJ7"
FT                   /protein_id="ABD01285.1"
FT                   /translation="MRFFHFYTPEQVPSSGIPECAVAIDVLRATTTIATALAAGAEAVQ
FT                   VFAHLQQLQEASQNWPASQRLLAGERGGKAVAGFDLGNSPLDYTPDRVRDKRIFLSTTN
FT                   GTRSLQRLEGIPVVITAALVNLGAVVDFLRRGSFAEVWLVGSGWEGAFSLEDTACAGAI
FT                   LHRLGCSLNQLGNDETLAALALYQTWQDDLLGLLRRSSHGQRLLGLGPENDQDLAYCAD
FT                   LDRLSVVPRQVQPGVLASGG"
FT   gene            complement(301065..301349)
FT                   /locus_tag="CYB_0288"
FT   CDS_pept        complement(301065..301349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ6"
FT                   /protein_id="ABD01286.1"
FT                   /translation="MHYERLINMVLRAYGQSSRHGLDQETLTLYSEGPYTLYKLTSHFD
FT                   RRSIFVLAQNQRDMFVSGDAFNNKLIPGEWQAWLHQKALGIAPDTAQAG"
FT   gene            301582..302688
FT                   /gene="argC"
FT                   /locus_tag="CYB_0289"
FT   CDS_pept        301582..302688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="CYB_0289"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by similarity to SP:P23715; match to
FT                   protein family HMM PF01118; match to protein family HMM
FT                   PF01408; match to protein family HMM PF02774; match to
FT                   protein family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01287"
FT                   /db_xref="GOA:Q2JPJ5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ5"
FT                   /protein_id="ABD01287.1"
FT                   /translation="MANMAPRPPHPTEPVRIGIVGASGYGGVQLVRLLSEHPGVQITYL
FT                   AGQDSAGKRYGDLYPQLAQAVDLTVQPVEVDRIAANSDVVFLSLPNGLAAELAPPLLAK
FT                   GCKVLDLSADYRFRNLATYQSWYRMGQTDPNWPSPAYRQANEQAVYGLPELYREAIAQA
FT                   QLVGCPGCYPTASLLAVAPLLRQGLVELDSLIFDAKSGVSGAGRTPKVGSLFAEVDGSL
FT                   AAYGVAQHRHTPEIEQACTDLTHTPITVQFTPHLVPMVRGIHVTLYATLRDPGFVGEDL
FT                   LTIYNAFYRQSPWVKVLPRGVYPQTKWVSGTNTCMIGVEVDSRTNRVIVLSVIDNLMKG
FT                   QAGQAVQCLNLMMGWPETLGLPRLAFYP"
FT   gene            302622..304169
FT                   /locus_tag="CYB_0290"
FT   CDS_pept        302622..304169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01288"
FT                   /db_xref="GOA:Q2JHP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP7"
FT                   /protein_id="ABD01288.1"
FT                   /translation="MSQPDDGMAGNVGFASAGVLPLAIMPVIPLKRILSMSEPLNPPFH
FT                   SEPQNASPSSKVASDAVNGAAEGLNWEELWRQLEAGWQDLPRRSEETVQQTLARLQLEW
FT                   GGLCREARDRLQSALEQSRTAGSPEPVHRELQALLPLLNPCQWEVVIGSLRRAADRAWV
FT                   ASLLYHGLQEAAYPEAESHGIPSWARTLTSDQRSALEAMSARAYGNSRLPLVMDKSGQI
FT                   QVKASAALLAALIAIEIGSVGSAGALSLLGTPELRKLLNAEGKLRRTGLKQGRTALTEE
FT                   EWQTLRRWLDPKGSPPDWYLNLTQVGIQTTQVGDYAARRLREFFQSEWIKLVIPPLYHL
FT                   VIDAVRLLTGEVFLSVGTTLESALESAEAGRRLELVLQALPQARNIPRPNQIQAAIPAV
FT                   VEAAEKLLRPLLARQLMTVADIFDPPIRNESLNELGRQLNLWNPFQFLLTWSTAGWLEA
FT                   LLDQISELQQTYPEMPLWESYRQGLETAVQAPRVMDQAEALRLTAKSLDPKLDPLED"
FT   gene            complement(304330..304479)
FT                   /locus_tag="CYB_0291"
FT   CDS_pept        complement(304330..304479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01289"
FT                   /db_xref="GOA:Q2JHP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP6"
FT                   /protein_id="ABD01289.1"
FT                   /translation="MMLHVGFYFFLYLGIPAWILPVTSLTRMFLFDTPLAYGGGQLVAW
FT                   MEFS"
FT   gene            304468..305910
FT                   /gene="murD"
FT                   /locus_tag="CYB_0292"
FT   CDS_pept        304468..305910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="CYB_0292"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by similarity to SP:Q03522; match to
FT                   protein family HMM PF02875; match to protein family HMM
FT                   TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01290"
FT                   /db_xref="GOA:Q2JHP5"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JHP5"
FT                   /protein_id="ABD01290.1"
FT                   /translation="MQHQVLGLGIAGLAAARLLRAQGYEVLVWDEQDSPLLRQRQAELN
FT                   QEGIPVRLGQPFQLAEGVKQVVVSPGIAWDHPLLQAVRQQGIPVVGEAELAWIYLDHLP
FT                   WVGITGTNGKSTTTALVAEMFKAAGLQGIPCGNIGLPLSQVALATLQGKLKPDWIVAEL
FT                   SSYQLEASSRLMSSTPGGPPRIGVWTTFTPDHLERHGTLERYASFKARLLDRAQWRVLN
FT                   GEDPYLCRRRQDWEKTYWISLAAPQLCCDQDPTATLDLRENRLYIQGEMVAELEDFAER
FT                   CPGQHNLQNLLLAAAAARLAGLPNVAIQKAIRSFAGMPHRLERVAQIQVGATPIRFVND
FT                   SKATNYEAGWVALNALSPPIILIAGGRAKQGDPGAWLRLIRAKVARVLLMGESAPVLAE
FT                   ALQGIHYTDVELVPTLDVAVERAFAAACSLSRQAQRLGKPAQPITVLLSPACASFDQYS
FT                   SFEHRGNHFRACCQALQGSLEC"
FT   gene            305819..306979
FT                   /locus_tag="CYB_0293"
FT   CDS_pept        305819..306979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0293"
FT                   /product="putative cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01291"
FT                   /db_xref="GOA:Q2JHP4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP4"
FT                   /protein_id="ABD01291.1"
FT                   /translation="MPVLTSTPALNTVATISEPAAKPFRDPWNAEARWLRWLTLIWLVL
FT                   GLMMLFSASYPVAQRITGDGLYFFKRQLLWAGLGLGCFWALVQIPLRRWFPWAGILCLL
FT                   GVGLVWATQVPGLGVSRLEASRWLDLKVIPVIQPSELLKPLLVLQGSWVFGRWFHHPLW
FT                   FRVLWAGIFAFALLGILAQPNLGTTAICGLTLWVMAWTAGIPAFTLLATAGLGILAAVV
FT                   SILSKDYQRRRILAFLDPWGNAQGDGYQLVQSLLAIGSGGLWGKGYGLSQQKLFYLPIQ
FT                   YTDFIFSVYAEEFGLAGSLFFLGLLTFYTLLGWRVMGRCRELTIRLVACGCLMFLVGQS
FT                   LMNIGVVTGILPTTGVPLPLFSHGGSSILAGLITAGLLVRAAREAG"
FT   gene            306991..307113
FT                   /locus_tag="CYB_0294"
FT   CDS_pept        306991..307113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01292"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP3"
FT                   /protein_id="ABD01292.1"
FT                   /translation="MLPTQQRDPFTQAANPEGQGSLLDWLVSALERLLMQQNQS"
FT   gene            complement(307128..307346)
FT                   /locus_tag="CYB_0295"
FT   CDS_pept        complement(307128..307346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01293"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ4"
FT                   /protein_id="ABD01293.1"
FT                   /translation="MNPLSAVKMFNKFNPSDKPSKGNWAGRTFSAAAGASVAAGVCIAH
FT                   GQPAYVSLLVACCATVFTLVLDEMGWI"
FT   gene            complement(307437..308048)
FT                   /locus_tag="CYB_0296"
FT   CDS_pept        complement(307437..308048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AF1888"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ3"
FT                   /protein_id="ABD01294.1"
FT                   /translation="MRAPQPASAFGEVVEADTTTFVAQCFEPERLTFPPMPALGSWTRS
FT                   QDEETGNLIYGVVCYAAIAPIDTVHRARALGLSPQELREQQPQIFAMLRTDFRAAIVGF
FT                   VSGGRVYQYLPPRPPQIHQPVYLCSDTEVREFCRSFEFLRTLLRVNGIPTDELVAAVIR
FT                   QTYRILNRDRNWLLQAGRQLSSLLRDDYEHLSAILRKIEA"
FT   gene            308380..308559
FT                   /locus_tag="CYB_0297"
FT   CDS_pept        308380..308559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01295"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ2"
FT                   /protein_id="ABD01295.1"
FT                   /translation="MNAQQRGQIIASEWMIDSQNPVHSISRLKRRATYSDVTLWWLVVQ
FT                   LNLMEQNSIHTDHR"
FT   gene            complement(308751..310337)
FT                   /locus_tag="CYB_0298"
FT   CDS_pept        complement(308751..310337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0298"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   subunit 4 family"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01296"
FT                   /db_xref="GOA:Q2JPJ1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPJ1"
FT                   /protein_id="ABD01296.1"
FT                   /translation="MSNPLEFPWLSVLVLLPLLAAFGIPLIPQSRWVRWYALAVGAFDL
FT                   GLMAYVFARHYDLQDFSLQLAERYAWVPQIGFHWSLAVDGLSLPLVLLSGLITTLSIVA
FT                   AWNLSHKPRLFFFLLLLMYGAQVGVFLAQDMLLFFLMWEIELVPVYLLISIWGGPKRQY
FT                   AATKFILYTAAASIFILVGSLAMAFYGEGFSLEMAELSAKSYPLALELLAYAALLIAFG
FT                   VKLPIFPLHTWLPDAHSEASAPISMILAGVLLKMGGYGLIRMNVGMLSEAHVYFAPVLA
FT                   VLGVVNIIYGALAAFGQNHLKRRLAYSSIAHMGFVLIGISAFTELGINGAVLQMISHGL
FT                   IAAVLFFLTGITYERTHTLALDKLGGLAKQMPKAFALFTAGSLASLALPGMSGFVGELT
FT                   VFLGLTTSDAYAPTFKAGIALLAAVGIILTPIYLLSMLRQVFYGAQDPGLVLEDYLGDV
FT                   RPREMAVALCLLLPILGIGFYPRLATQTYDVTTVAVAAQLRSVLATEIVQRPFFPSPVQ
FT                   SAQVAALPLED"
FT   gene            complement(310591..311592)
FT                   /locus_tag="CYB_0299"
FT   CDS_pept        complement(310591..311592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0299"
FT                   /product="dehydrogenase E1 component, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00676"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01297"
FT                   /db_xref="GOA:Q2JPJ0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPJ0"
FT                   /protein_id="ABD01297.1"
FT                   /translation="MVQELTSRSTTARISAEEARLLYEDMVLGRLFEDKCAEMYYKGKM
FT                   FGFVHLYNGQEAVSTGVIKALKPTDYVCSTYRDHVHALSTGIPPRAVMAELFGKATGCS
FT                   KGRGGSMHLFSAEHNFLGGYAFVAEGIPVATGAAFSAKYRGTDQVTACFFGDGACNNGQ
FT                   FYECLNMAALWKLPIIYVVENNFWAIGMAHERATSDTDIYRKGPAFGMPGYQVDGMDVL
FT                   AVREAAQQAIARARAGEGPTLLECITYRFRGHSLADPDELRSPEEKEFWRQRDPIKQLE
FT                   RYALEHNLMTEADFQAIHAEVSAVIEDAVLFALESPEPTLDELHRFVFAEDE"
FT   gene            311919..312731
FT                   /gene="cdsA"
FT                   /locus_tag="CYB_0300"
FT   CDS_pept        311919..312731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="CYB_0300"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01298"
FT                   /db_xref="GOA:Q2JPI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI9"
FT                   /protein_id="ABD01298.1"
FT                   /translation="MGARWVSGFAAVLFALAVTLLGGWYFTAAIGLIIFLAQLEFFRLV
FT                   QAKGNAPAMRTTMFSSQVLVILQQVRPEWTSPAFIVAGSIICFYLLFKPKVATIADIAT
FT                   SILGLFYCALLPSFWIRVRALSFAQGLGEGLWITLLAIGCVIAADVGAYLCGRAFGRTK
FT                   LSILSPKKTVEGAVAGIAASMTLAVVGAYYLGWPWSWLSGGILGFLIGLTSLLGDLTES
FT                   LMKRDAGVKDSGDLIPGHGGILDRGDSYVFTGPLVFYFMEWLNAYSGL"
FT   gene            313555..316293
FT                   /gene="valS"
FT                   /locus_tag="CYB_0301"
FT   CDS_pept        313555..316293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="CYB_0301"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01299"
FT                   /db_xref="GOA:Q2JPI8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI8"
FT                   /protein_id="ABD01299.1"
FT                   /translation="MTAAISSVNLPSQYNPFETEPKWQRFWEEKGFYVADPKAPGEAFS
FT                   MVLPPPNVTGNLHMGHAFAFTLPDVVTRYKRMRGYNVLWLPGTDHASIAVHTILENQLR
FT                   QEGKTRFDLGREAFLERAWAWKEQSQGAIKSQLRRLGLSLDWTRDRFTLDEGLSRAVTE
FT                   AFVRLYEAGLIYRGEYLVNWCPATQSAVSDIELDDKEVKGHLWHFRYPLAEDPSQYLVV
FT                   ATTRPETMLGDTAVAVNPQDERYCHLIGQFIRLPIKNRLIPIIADEYVDPSFGSGCVKI
FT                   TPAHDPNDFEIGKRHQLPFINILNKDGTLNENGDPFTGLDRFVAREKVVQWFAEHGLLE
FT                   KVEDYTHTVPHSDRGGVPIEPLLSIQWFCDVSGMGARCLEEEYQRNSPRFIPERWTKVY
FT                   TGWLEKLRPWCISRQLWWGHQIPAWYPVLNGQLLEDPQAFVVARNGEEALLKAREKFGP
FT                   EVERVEQDPDVLDTWFSSALWPFSTLGWPEETEDFKRYYPNSLMSTGFDIIFFWVARMA
FT                   MMGSQFTGQIPFKDVYINGLVRDEHGAKMSKTKGNGIDPLELLDKYGTDALRYALVKEV
FT                   VGAGQDIRLAYDRKTGESASVEAARNFANKIWNASRFVLMNLEGQTPAQLGSPAPEALE
FT                   LADRWILSRLHSTATQVIAELEAYGLGEGARLLYSLIWDDFCDWYIELVKPRLRGEDLA
FT                   SKRAAQKVLATVLETILKLLHPWMPHITEEIWQLLTQANQTTSISVQPYPTPDPSWIDP
FT                   QLEREFGLVIQTITSLRNLRAEAGLKPHQTIRALLLTTDPAEQRILTAAQAYIWDLVKA
FT                   EALEITGSLATEPKQVAAAVVGTVQVLMPLAGLVDVEALRAKLQKDLAKLEKEAQGIRA
FT                   RLENPNFLNRANPEVVQASQEQLAELEAQMRLLGSRLEKLG"
FT   gene            316540..316863
FT                   /locus_tag="CYB_0302"
FT   CDS_pept        316540..316863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0302"
FT                   /product="putative RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01300"
FT                   /db_xref="GOA:Q2JPI7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI7"
FT                   /protein_id="ABD01300.1"
FT                   /translation="MSIYVGNLSFKVTEADLTAVFAEYGSVKRVQIPTDRETGRIRGFG
FT                   FVEMSSEAEEQAAIAALDGAEWMGRDLKVNKARPREERPTSGFRSGNANSGGERRRSFQ
FT                   SRY"
FT   gene            complement(316903..317091)
FT                   /locus_tag="CYB_0303"
FT   CDS_pept        complement(316903..317091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI6"
FT                   /protein_id="ABD01301.1"
FT                   /translation="MARGIPELAVTQAKRFIFLSQGARKNLKSKLIGIPHQLLCWNNGS
FT                   RLEKQLDPGAALQNKLN"
FT   gene            complement(317061..319277)
FT                   /locus_tag="CYB_0304"
FT   CDS_pept        complement(317061..319277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0304"
FT                   /product="CobN/magnesium chelatase domain protein"
FT                   /note="identified by match to protein family HMM PF02514"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01302"
FT                   /db_xref="GOA:Q2JPI5"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI5"
FT                   /protein_id="ABD01302.1"
FT                   /translation="MHRIAALPGGWDPSQSGVIFLEQDPAPIVILSAADTDLTALSAAL
FT                   RLLPGDFPAVRAANLLQLQQPLSLDDYAERVLRRAQVVLLRLLGGRAYWSYGLEVAKQV
FT                   AAEEGSTLIVIPGDDRPDWDLVSHSTVPLAVADRVWRYWLEGGAENVAACLLLLAREFL
FT                   GGQYSAPDPQGLPRLGIYQPPVASPTDPQAPKVGILLYRAHVLAGNIEPVDQLAKALVE
FT                   RGLQPLCLYTYSLQDPDLPQAIRDHFGSQIDLLLNTTSFSLARLDSHQPDVSLWQELDV
FT                   PVLQVILSSGSRQSWEDSTRGLGARDLAMNVALPEVDGRIISRAVSFKAVQQRDPHLQT
FT                   EVVAYAAVPDRVEFVADLAANWVKLRRTPANQRRLALILANYPSRDGRLANGVGLDTPA
FT                   SCVEILKVLAESSYRVGPLPQTGDELIRWLTQGQTYDPLGSLRPARQWLSAALYREWFA
FT                   RLPEPIQTDLVRQWGDPPSRDIPVVGLQLGQVFVGIQPPRGYDRDPSLNYHAPDLVPPH
FT                   EYLAFYLWLRQVFAVQAVVHVGKHGNLEWLPGKGSALSATCYPEMALGPLPHFYPFIVN
FT                   DPGEGSQAKRRAQAVIIDHLTPPLTRAELYGPLADLERLMDEYVQAQQLDPSRCPLIRA
FT                   QIQELVRAEHLDQQFNLEKEEDWNRLDGYLCELKESQIRDGLHIFGRIPAGEQLVDLVV
FT                   ALARYPGHGQLGITQAIARDWGWDWDPLTADLTDPWPEGSPNSP"
FT   gene            complement(319265..319612)
FT                   /locus_tag="CYB_0305"
FT   CDS_pept        complement(319265..319612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI4"
FT                   /protein_id="ABD01303.1"
FT                   /translation="MKKRVGRVVFASALTFFASSILLRAYGSHSIEWARQFGTPANEVA
FT                   DSIAVDRASGAEHFRASGAEHFGQGNAWVAGTTTGALPDQLSAGSWGASVLQVQSLSLS
FT                   FLPLGERPCTE"
FT   gene            complement(319737..321023)
FT                   /locus_tag="CYB_0306"
FT   CDS_pept        complement(319737..321023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0306"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to GB:AAN50474.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01304"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI3"
FT                   /protein_id="ABD01304.1"
FT                   /translation="MNRKRPLERVVSLGLAFASSALLGACGEDPAPWLRQFGTPSSDEA
FT                   HSIAVDERGNAWVVGVTHGTLPKQAGAGGGDAFVRKYNAQGKELWTRQFGTSSLDEALA
FT                   VAVDRWGNAWVAGVTYRTFPHQVSAGGKEAFVRRYNPQGRELWTRRFGSGELDGVTALA
FT                   VNAEGNVWVAGDAVRGSGTESLAPSGQSRGKSFVHKYDSNGNLLWTRELELHRRAGALA
FT                   ADEEGNVWVVGSIQESLPGQSVASAGRSPRAGGFVRKYDPEGNQLWLRQFSGGRGDGAF
FT                   SIAVGEMGNVWIAGFIQEAPTGQAGEYSVLVQQYDAYGNQLWNRQFPGKRRERVLAIAV
FT                   DGIGNIWVAGHTQGTPAGQLPSDAFVCLYDVNGNELWSHQFGTPDFEWIGSLASDRRGN
FT                   LWVAGVTWGAFPDQPRAGMKDAFVLKYAR"
FT   gene            complement(321184..321381)
FT                   /locus_tag="CYB_0307"
FT   CDS_pept        complement(321184..321381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01305"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI2"
FT                   /protein_id="ABD01305.1"
FT                   /translation="MPGDAIVKCGQWRQAVRGSGTESFRVSGTESLHFRLFQAFVQAAL
FT                   RFSPRLAGLLPNPEPVPQVA"
FT   gene            complement(321228..321743)
FT                   /locus_tag="CYB_0308"
FT   CDS_pept        complement(321228..321743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0308"
FT                   /product="glutamine amidotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01306"
FT                   /db_xref="GOA:Q2JPI1"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI1"
FT                   /protein_id="ABD01306.1"
FT                   /translation="MNRTSPFSNRPLIGVTTRNRNDEGDFVAPGRYVDAIRAAGGIPVL
FT                   FPPGESEPQVLLSWVDGLVLTGVGDLCPSTFRGSGTESFGEDPQHPQVRYVNAERDRFE
FT                   VALAQAVLAQGIPVLGICRGMQLLNVVSGGKLFAVAGRSPFASAGRSPCTSVCFKPLCR
FT                   QHCVFPRA"
FT   gene            complement(321911..322975)
FT                   /locus_tag="CYB_0309"
FT   CDS_pept        complement(321911..322975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0309"
FT                   /product="carbohydrate uptake ABC transporter-2 (CUT2)
FT                   family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01307"
FT                   /db_xref="GOA:Q2JPI0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPI0"
FT                   /protein_id="ABD01307.1"
FT                   /translation="MAGIAESGRSWVSLERTWVIQGLAWLAALLFVAGVILLAGASPLQ
FT                   VAASMWQGAFGTEAQFGRVLATLAPLVLCCCGLVFTFVAGLYNLGIEGQMVVGAIAATF
FT                   LVRLEAGWLPPPLAITLALLAGILGGAGWGLLAGILNVWGRVNEIFAGLGLNFVAQGWV
FT                   LYLIFGPWKRPGVASMSGTEVLDPRLWLPTWGRSEASPVALLLALLALALTVLVVGNTR
FT                   FGLQLRAVGKNPVAAFRLGIPATRRLLMAFACCGGLAGLAGALQVLALFHRLIPNISSN
FT                   LGFLALLVVMLAGFNPLLILPIAFFFSSLNIGSLQLPLSLQLESSLAGVIQGSLVLFVL
FT                   LAQGISRRYFLGKG"
FT   gene            complement(323019..324797)
FT                   /locus_tag="CYB_0310"
FT   CDS_pept        complement(323019..324797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0310"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.109"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01308"
FT                   /db_xref="GOA:Q2JPH9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH9"
FT                   /protein_id="ABD01308.1"
FT                   /translation="MRPFGNPNRLGSSPSRRSLPGSSSFVQFRRDPHLVPFWGLSLLVM
FT                   GLAVPLFVLSGADPSLAGCDESFYAQMARELLRGGHWLGPTFLGEPFFEKPPLLTWSVA
FT                   LSFALYGVNEWAARLPGILAALLSIPLVGWIGWFFLPMRAAFLGMAVLPLCYLWVQQGR
FT                   LVGQDVPLTFLELLGILGLVNGIRGHRVWFWLTGVAFGLGLLMKSAMILLPGAALIPYL
FT                   VQQRRRWMGSAPFWLALGLGLGIFGLWLGPAMQVYGPQVLTTLVGKVWDLGQEPFHADA
FT                   TGWYYFWHIPVHGFPWTVLALVGGFLLVRQQPGSTLLIWSFPLLLLLLLQLYPTKTPYY
FT                   TVQLYPWLALLAGVALDQALAMRGRVSGADRVSGTESLHLKPRLAQVISWGLAAVGLLL
FT                   LGLGVAVRLGVDGLELLQSHAWPLVAMGLLYLLLPGIWSWWRVLRCAGELWVGILLLAG
FT                   ILAMITIVLRPDFGNFSPAFAQMDWNQMLPPSVRAIRTESSTESGETVVDIGRSGLPDV
FT                   CQAQAIAFYTPNPGRWVDDQALRRGEHGDYLWVSPVQAEQVEIRDLGLQPLAEVEGWQL
FT                   VRRLDPLLEQGSGEPL"
FT   gene            complement(325156..326931)
FT                   /locus_tag="CYB_0311"
FT   CDS_pept        complement(325156..326931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01309"
FT                   /db_xref="GOA:Q2JPH8"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH8"
FT                   /protein_id="ABD01309.1"
FT                   /translation="MVGAGLLWAWGGHRWIQSGLNLVRAGSTQDTEALQEFVTTLAQVL
FT                   SGVLGFTLSVVAIVVQLSADRFTPKVTELFLREKVNFYLFFFLILANVVSLWSSAALSL
FT                   YVRVGGVEQQRLGLLIGLNLLLGTASFLVLIPYFRFVFHFLQPASIIHRIEQQVRQAVL
FT                   GSLASRRSGSDSGSKRGYFSRCSLQLRPRHDNVVQQQRCAGIQGAVGIATEQHSPMGEC
FT                   SPAHQRCLSALDEIKSIATSALRQQEGSILLEALDSLKSLWVFYAAHKAQLPPAWFLFT
FT                   PALRRDPDFASVDRGLLGRIEAEGSWLELKILRQYQALFAEGLNGMRQASTLVAIHSRE
FT                   LGIRALEAQQLTVAGWVIKFFNTYLRAVINARDIRSGYNLLKQYRLLAEAALQHRQSAL
FT                   VLQIVGYFRYYSLIAYKAGLFFLSETFGFDLGMLAQSSCALGSETTEAIVQALLRLDQD
FT                   PESEQQETTLRGIRKTQVRLAAYFLSRGREDWARLIYQDMQHEPLARLQSIHQELLSTA
FT                   AEFWEFTDRGENFYYLEPALWPYADRVSGTESFRVSGTESLQFFSWFQGLTLPADKLKS
FT                   MTLVNNKLNYTENNV"
FT   gene            complement(327028..328524)
FT                   /gene="ftsY"
FT                   /locus_tag="CYB_0312"
FT   CDS_pept        complement(327028..328524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="CYB_0312"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01310"
FT                   /db_xref="GOA:Q2JPH7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH7"
FT                   /protein_id="ABD01310.1"
FT                   /translation="MAFDWFRRRYTDSTDSSGEAEPSPPAPEPAEISPEDYLAFAKAAY
FT                   ANLKARTAAQAPPATQDSVPPAPAEGIPAESVQPQPPASTEDSGPLAQAEPREPVQSST
FT                   PTQEPASPESPPVQPAAAPSFFDLAPRAAERLQALQASAVDEPKPEPVTPAVAPSPETG
FT                   PEELVFDEGFRWSAEILAAQGRKPEEISVEEISWLQKLRRGLGKTRLNLINQLKALVGR
FT                   GPLDQKAVEEIEALLLQADVGIDATEQIIQALQKRMREEVVPPEEAVKYLKQQMRQMLT
FT                   VGNPTFAPQRDTLNIWLIVGVNGAGKTTTIGKIAHVARKSGYRCLIAAADTFRAAAVEQ
FT                   LKVWAERAGVEVIANPSPNADPAAVVFDAITAAKARGTELLLVDTAGRLQNKKNLMDEL
FT                   AKIRRIVDKKAPEAKVESLLVLDATQGQNGLRQAEVFAEAAKLSGVILTKLDSTAKGGI
FT                   ALAITQQMNLPIRFIGAGEGLEDLRPFSSYEFVEALLSEY"
FT   gene            complement(328628..329455)
FT                   /locus_tag="CYB_0313"
FT   CDS_pept        complement(328628..329455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01311"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH6"
FT                   /protein_id="ABD01311.1"
FT                   /translation="MEILAVLLGLLAGLGGGAGYLADQTARQLLLDQLDRAEVLEVRIQ
FT                   SQPNYRLLNGQADRLLIAGRGLYRAPFPRIELLELETDPVAIDPSFFQGAPLRLARPLQ
FT                   AAVRVLVREEDLNAALNKPEVLRQFQDIRADLPFGGAGREARRFDLRQPRVEFLDPSRI
FT                   QLSALLVEKDGGTEQKDSVPLTRAVEVVFNTGIRVEEGRSLKLENPEFVIGSVRVPDEI
FT                   SAAFLGGLNEVLDLQELEEIGILMRVLSLEIEPDQLQVIGFVRVEGLERTSSR"
FT   gene            complement(329524..329991)
FT                   /locus_tag="CYB_0314"
FT   CDS_pept        complement(329524..329991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC08132.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH5"
FT                   /protein_id="ABD01312.1"
FT                   /translation="MAVPNGHSGTLPEQEASSMGKDALPLTQTGNALNLAPLPADGASA
FT                   AAQMPVLLGEKSGPPVFPSPVKFSEIEIDHRPVGASTLKVVDYYADGRPVAAATLKVVD
FT                   TWGEGRPTVASGAKFIHDPALNRPIMADGLKIAKTFMGNRPIEASPLKVLR"
FT   gene            complement(330804..331757)
FT                   /locus_tag="CYB_0315"
FT   CDS_pept        complement(330804..331757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0315"
FT                   /product="peptidase, M48B family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01313"
FT                   /db_xref="GOA:Q2JPH4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH4"
FT                   /protein_id="ABD01313.1"
FT                   /translation="MLKPRHTLRLLAPAGQDPLLSKGWSSRAVRPVAIALLSILAASGM
FT                   GSPAHAQDLGRLLIHGLQWLQVSQLNDAQEVSLGRQIDRQLKARGQLRLSSDPYWVERV
FT                   NRIGQRVAAHSERPHLPYTFQVVEDPDINAFATLGGFVYITTGALAAADNDDQIAAVLA
FT                   HEVAHIGERHGLQQLQQAATAQFGAQLLGLNDSTLAALALELGVRRPQSRENEFIADEK
FT                   GLGAAYRAGFDPQGMPQFLAKLQSRGSVPEFLRTHPPVSERIARLNQLIIQHGMVSPAG
FT                   QTVPLHGSGGSIWPSGSPEQTQRTEIEILPLLPVLP"
FT   gene            331930..332664
FT                   /gene="minC"
FT                   /locus_tag="CYB_0316"
FT   CDS_pept        331930..332664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="CYB_0316"
FT                   /product="septum site-determining protein MinC"
FT                   /note="identified by match to protein family HMM PF03775;
FT                   match to protein family HMM TIGR01222"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01314"
FT                   /db_xref="GOA:Q2JPH3"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH3"
FT                   /protein_id="ABD01314.1"
FT                   /translation="MTGSPTWNPEISSSPDSWATGSVYFRSDAQGIHLHLPSTLPWEEL
FT                   WENLVWQLRSRKPYWAGVAPLTLWSQQRELDMPTLQLLAALLSQHGLQLWRVQTRSRST
FT                   AIAAATLGYSVEQSSLLEAVPLAPPDTTPLYLRSTVRSGMSVRHRGSVFLLGDLNPGGE
FT                   IIAGGDVWVWGRLRGLVHAGADGDKGAVILALQLEPTQLRIADQVARPPEGGSLPNTPE
FT                   VVYLQEDVICVASLQDFLRRGV"
FT   gene            332661..333467
FT                   /gene="minD"
FT                   /locus_tag="CYB_0317"
FT   CDS_pept        332661..333467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="CYB_0317"
FT                   /product="septum site-determining protein MinD"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM TIGR01968"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01315"
FT                   /db_xref="GOA:Q2JPH2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH2"
FT                   /protein_id="ABD01315.1"
FT                   /translation="MSRVIVITSGKGGVGKTTVTANLGTALARLGRSVVVVDADFGLRN
FT                   LDLLLGLENRVVYTALEVIAGECRLEQALVKDKRTPNLSLLPAAQTRNKTSVHPDQMRQ
FT                   LIEKLASSHDYVLIDCPAGIEQGFRNAIAGANEAIIITTPEVAAVRDADRVVGLLEAAQ
FT                   ISSTQLIVNRLRPDMVAAGQMMSVEDVVEVLAIPLVGIIPEDREVIVSTNKGEPLVLSA
FT                   NPTLAAQAIQRIARRLEGETVDFPKMASLGESFWERAKRFLNQKVL"
FT   gene            333559..333861
FT                   /gene="minE"
FT                   /locus_tag="CYB_0318"
FT   CDS_pept        333559..333861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="CYB_0318"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="identified by match to protein family HMM PF03776;
FT                   match to protein family HMM TIGR01215"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01316"
FT                   /db_xref="GOA:Q2JPH1"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPH1"
FT                   /protein_id="ABD01316.1"
FT                   /translation="MLLDFLDQLFSRHSGNSRQQAKQRLKLILAHDRADLTPAALESMR
FT                   LEILGVVSRYVELDSEGMQFHLATEGGTTALIANLPIRRVKPLETGLSRSEGEKA"
FT   gene            334259..336613
FT                   /locus_tag="CYB_0320"
FT   CDS_pept        334259..336613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0320"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01317"
FT                   /db_xref="GOA:Q2JPH0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPH0"
FT                   /protein_id="ABD01317.1"
FT                   /translation="MQDSFELTILFTLALVAGIAAQVLANFVKVPSIVFLLLFGLLLGP
FT                   DGLGWVHPQVMGSGLEALVSLAVALILFEGGLNLRLQRLNPVSDSLRNLVLLGSLLTLV
FT                   GGAAAAHYLGEFPWRLAFLFGSLVVVTGPTVINPILKRVRVDSAVSTLLEGEGVLIDPI
FT                   GAILAVVVLQVVLSGHPSFLMALEQLSSRLAIGSAVGALGGWLMGSFLLWSRQFLTEEL
FT                   RNSVVMAGALGVFALAQSLRSEAGLMAVVMAGLVVRQKAAIAERGVRQFHGQLVVLAIS
FT                   VIFILLTATLSLKAVFALGWGSLATVLCLMLVIRPLSVWLCTWRSDLNWRQKLFVAWLA
FT                   PRGIVAASVASLFAILLTERGITGGDALKALVFLTISVTVTVQGLTAAWVARWLGLDQG
FT                   SSTIIIGDHPLTNQLAQLMRSLNQTVEVIPLVSGSSKNGHGSYKAPHPTDGKDSIPPSR
FT                   KSSTSLSGTPKRRPADGLPPQLHSSDGNGTHKSAPSQEVGKPEAIPGSLQEAVLNESAL
FT                   LKADIDHAETLLILTLDPQVNWAIAELMVKLSVSATIWTVLLPDMPISEGIRTLQPSFP
FT                   QLQRWAGYLEANRAELRSITLPTLADLGLPLPLSLRDASANAASTLPEAVRSNRADVLT
FT                   AQESFPTAVRSAFSAPALPNPFLAQMGLEDPTLERLRDQFAYRIKADLCLPLLLVRPQR
FT                   LRSGSSRPGRLFYLPEPDIWRRGDRIYYLERVSSPVDAGVLSAKEPDSQEWDPSAAVHT
FT                   RVRDSGAEHNSGIESLLPPQYVEGVKLHFDL"
FT   gene            complement(336591..336959)
FT                   /locus_tag="CYB_0319"
FT   CDS_pept        complement(336591..336959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AF1055; match to
FT                   protein family HMM PF03674"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01318"
FT                   /db_xref="GOA:Q2JPG9"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG9"
FT                   /protein_id="ABD01318.1"
FT                   /translation="MQPTTVVFVYGSLLRGGQYHSLLQGAEFLGTDSLNHIDLYSLGPY
FT                   PMAVRGRNRLYGECYRIPLSLLPRLDELEDHPRVYERQWVQLDSGTFAWVYLGRPEQVQ
FT                   GCSLIPSGRWLVRDQSGA"
FT   gene            complement(337002..337604)
FT                   /locus_tag="CYB_0321"
FT   CDS_pept        complement(337002..337604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8YZG8; match to
FT                   protein family HMM PF02660; match to protein family HMM
FT                   TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01319"
FT                   /db_xref="GOA:Q2JPG8"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPG8"
FT                   /protein_id="ABD01319.1"
FT                   /translation="MLTALLAVLGGYLLGSIPTGYWVGRWWGGIDIRQQGSGSTGATNV
FT                   LRTLGKGPALLVLLVDAAKGAAAVALGSALGSAWWVVLAALFAVIGHSRSCWLGFRGGK
FT                   SVATSLGILLAMAWPVALTTFGVWLLGLALTRIVSFSSLLAAVAAPVVMWATAQPLPYL
FT                   LFALAGGVYVIGAHRRNIERLLAGSEPRIGQKWTQSP"
FT   gene            complement(337816..339744)
FT                   /gene="gyrB"
FT                   /locus_tag="CYB_0322"
FT   CDS_pept        complement(337816..339744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CYB_0322"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01320"
FT                   /db_xref="GOA:Q2JPG7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG7"
FT                   /protein_id="ABD01320.1"
FT                   /translation="MTENYGAEQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEVVDN
FT                   SVDEALAGYCNDIQISLHPDGSVSVLDNGRGIPVDIHPKTGQSALVTVLTVLHAGGKFG
FT                   GGGYKVSGGLHGVGVSVVNALSEWVEVTVWREGKVYFQRFERGAVVGSLKSEPQPKGSN
FT                   RRGTEVRFKPDGLIFPEREFDYAVLAARFRELAYLNAGLKITFSDLRRDPPHCETYQYA
FT                   GGIKEYVAFINHEKTPIHSDIIYIQGERDGVEVEVALQWCSDVYTDTLIGFANNIRTNE
FT                   GGTHLEGLKTSLTLTINSQARKLNKLKDSDSNLAGENVREGLTAIVSVKVPNPEFEGQT
FT                   KTKLGNTEVRGIVQTLVSEALTEYLEFNPNVARGIVDKAIQSFNAAEAARRARELVRRK
FT                   SALESSTLPGKLADCSCRDPAESEVYLVEGDSAGGSAKQGRDRQFQAVLPLRGKILNIE
FT                   KADPAKIYKNAEIQAMITALGLGVKGDEFDPSQLRYHRIILMTDADVDGSHIRTLLLTF
FT                   FYRYQKALLEQGYVYIACPPLYKIEWGRNNVRYCYSDAEKDQILRGLPANAKYTIQRFK
FT                   GLGEMMPEQLWETTMNPATRTLKQITIEDAVEADRIFTILMGDAVGPRREFIEAHSAHL
FT                   DLAALDI"
FT   gene            complement(339946..340485)
FT                   /gene="rimM"
FT                   /locus_tag="CYB_0323"
FT   CDS_pept        complement(339946..340485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="CYB_0323"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01321"
FT                   /db_xref="GOA:Q2JPG6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPG6"
FT                   /protein_id="ABD01321.1"
FT                   /translation="MMARDPDWLLVGQVVAAHGLRGWLRVRCWSDFPERFTEPGPRWLQ
FT                   RDTDPEPLLHPLIEGQFFPAKGLYLVRLEGIPNRTVAETWVGARLLVPASHRLPLQPEE
FT                   YHYRDLIGLAVYHQGELLGQVSGILAAGQDVLEITTSDHRQVLIPFVKALVPVVDLEKG
FT                   ALHVQPPPGLVESFLG"
FT   gene            complement(340498..341463)
FT                   /locus_tag="CYB_0324"
FT   CDS_pept        complement(340498..341463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0324"
FT                   /product="HflC/HflK family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01322"
FT                   /db_xref="GOA:Q2JPG5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG5"
FT                   /protein_id="ABD01322.1"
FT                   /translation="MPGILAAIALIFVGYLFNSVKIISQGYEALVERLGRFHRKLTPGL
FT                   HFILPPIDRIVFQETIREKVLDVPPQQCITSDNVSLMADAVVYWRITDMIKARYAVEDV
FT                   QRALVNLVLTALRAEIGRMDLDQTFSSRAEINARLLTELDEATDPWGIKITRVEVRDIQ
FT                   PSKTVQDSMEKQMAAEREKRAAILKSEGEQQASINQAAGAAKAQLLRAEAEKRERLLLA
FT                   EGTAEAIKTIAATLQENPEAANALQYLMAQNYIDMGFKVGSSPSAKVIFMDPNSIPGTL
FT                   QGLLSMVDVAKGGEGSRAAASQKLRTPASFPTEVDFPRLD"
FT   gene            341670..342692
FT                   /locus_tag="CYB_0325"
FT   CDS_pept        341670..342692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0325"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01323"
FT                   /db_xref="GOA:Q2JPG4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG4"
FT                   /protein_id="ABD01323.1"
FT                   /translation="MKLSSRNLEVALNKIYDVIVAGGGAGGLSAAIYLARYGLSCLVVE
FT                   KGRGRSFWMQDLRNYLGLPPTTPGRELLRQGTEHALSLGVDYLRGFVEDATDEGDLFAV
FT                   KVKVGKMNSLYPVFRSKYLIAATGIMDELPQLSDMQNVYDYAGYSLHVCMICDGYEMRD
FT                   QKSVLIVNSEDRINTAFVLNWFTPYISVLTHGLCSVGPDMRKKLADHGYPLYESPIRRF
FT                   LGENHQLQGVELEDGTYIEATTGLVAMGARYHNAYLKGIPGLKWQGENLLTDEWCRTDH
FT                   PRLFALGDLKQGLNQVSIAVADGTLAATAIWRDIRRASPARKWEERLLSAPRSPAGPSG
FT                   "
FT   gene            342764..343864
FT                   /locus_tag="CYB_0326"
FT   CDS_pept        342764..343864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0326"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01324"
FT                   /db_xref="GOA:Q2JPG3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG3"
FT                   /protein_id="ABD01324.1"
FT                   /translation="MHSLKALKALIFCLAFLLVGLIYYCTVEAQPLFELNLTATSEYNL
FT                   ILPIESIRVVRGANPQDLLIYLSAPSAAWIHQEEVNGHYLIDIPYGVITRTTTVEIASD
FT                   LPYRLSWGNQNEQTGRLLITPAPPRVEVFLQHSWIPDPDFLDPAENTQPLQLPLEEMLG
FT                   PLLEVPPRSAFLTIDDGPWPQSTPRLLQVLDDLQIPATFFVIGTHVSRFPELAQLIQAH
FT                   HHTIANHTFTHDYQRLYGSNELFYAEVDQTTQLLKTLNLDPQLVVRPPGGFRLDSALRR
FT                   SLEQAGYRVLYWNMSPEDAYAGQSAAQLLERVRAQLPAIQASDQPLVLLLHDRWPHTAE
FT                   ALPDIVAAIEGAGYRFLPWPAFRDPV"
FT   gene            344054..345457
FT                   /gene="leuC"
FT                   /locus_tag="CYB_0327"
FT   CDS_pept        344054..345457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="CYB_0327"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P30127; match to
FT                   protein family HMM PF00330; match to protein family HMM
FT                   TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01325"
FT                   /db_xref="GOA:Q2JPG2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPG2"
FT                   /protein_id="ABD01325.1"
FT                   /translation="MSERTLFDKVWDAHTVRILPSGQTQLFIGLHLIHEVTSPQAFAML
FT                   RERHLPVLFPERTVATVDHIIPTDNRARPFADPLAEEMIQELERNCRQYGIRFYNSGSG
FT                   RQGIVHVIAPEQGLTLPGMTIACGDSHTSTHGAFGAIAFGIGTSQVRDVLATQTLALSK
FT                   LKVRRIEIHGKLGPGVYAKDVILHIIRKLGVKGGVGYAYEYGGSAIEAMSMEERMTLCN
FT                   MSIEGGARCGYVNPDAVTFEYLRGREFAPQGSDWEEAVAWWKSLASDGNARYDDVVVFQ
FT                   AADIAPTVTWGITPGQGIGVDERIPAPEDLPESERELAKEAYAYMDLQPGDPIVGTPVD
FT                   VCFIGSCTNGRLSDLREAAKIAKGRRVAPGVKAFVVPGSERVKQEAEQEGLREIFEAAG
FT                   FEWRDPGCSMCLAMNPDRLVGRQISASSSNRNFKGRQGSPSGRTLLMSPAMVAAAAVSG
FT                   KVVDVRTLL"
FT   gene            complement(345476..345549)
FT                   /locus_tag="CYB_0328"
FT   tRNA            complement(345476..345549)
FT                   /locus_tag="CYB_0328"
FT                   /product="tRNA-Met"
FT   gene            complement(345731..346924)
FT                   /locus_tag="CYB_0329"
FT   CDS_pept        complement(345731..346924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0329"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01326"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP2"
FT                   /protein_id="ABD01326.1"
FT                   /translation="MTQVLTVPCKLKVSQSQAAKLDATMDAFVQALNWVNQNTPEKVVN
FT                   AVKLQSLCYYQIRARFGLSSNLAQQVCRRLAGARKVARQKNRPVKAFKRGFATYDARIF
FT                   SFREKDWTVSLTTVGGRERFELAIGRYQREQLAGSNPKSATLVKRKDGSYSIQICVETE
FT                   PSPPQGTDRVLGVDLGRTDIAHTSEGDNWNGQQLNKVRDHHSRLRAALQRKASKGTRSS
FT                   RRRCRELLQRLSGKERRFQAWVNHRISKAIVSRAKTTNSAIALEDLTGIRERVNQQPRS
FT                   KAERRRTNNWAFYQLRMFVVYKAAIAGVPVVLAPPAYTSQTCHRCLHIHPDPTQSYRSG
FT                   KKFKCGHCGWEGDADLNGANVIALLGAAVNQPRGSWLACQLQGYRKLALYCEAVRVG"
FT   gene            complement(346995..347858)
FT                   /locus_tag="CYB_0330"
FT   CDS_pept        complement(346995..347858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0330"
FT                   /product="xanthine dehydrogenase accessory factor,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01327"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP1"
FT                   /protein_id="ABD01327.1"
FT                   /translation="MLSRGPLVVATVVRTQGSVPHQAGAKLAVGSDGTLLGTIGGGAAE
FT                   AEVIARAQTLLQTAVPVGDGDGESSPAGMQVSLDLNSPPLGVCGGRMHIWLQRWQGSLA
FT                   QTLVAQILQALTQGPRAWLITPLDPQGFPYLRLGDSNVEHFASLPSRPQLLAGSWVEPL
FT                   LPSPTLLIVGAGHCGLSLAQIAHLAGFRIWVQDDRPDWVTPQRFPVAERLCSEPFAQLI
FT                   PHLHRIPQLYIALVTRSYSLDCQILRAIYHSGLTPHYLGMIGSRKRVQTVLRTLAQEGI
FT                   PETAVS"
FT   gene            complement(347947..349098)
FT                   /locus_tag="CYB_0331"
FT   CDS_pept        complement(347947..349098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0331"
FT                   /product="carboxylesterase, beta-lactamase family"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01328"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHP0"
FT                   /protein_id="ABD01328.1"
FT                   /translation="MGWDPALLEGLLNSAIPHLFPAAQVVIRHKGRCIYSRAAGHLDPE
FT                   TRRQPTTSATRFDLASLTKLYTATACMALVEAGALLLDQPVSLLLPEFQGSRPIAPYED
FT                   PLQPGKWIAVEPESLGQLVATEQVTVRQLLAHTAGLPAWRPLFRQPDAESARHMALHTF
FT                   LAYRPGSRRVYSDLGLILLGLALERLSGTPLDQILHARILRPLGLSQTQFYPGDPFDPS
FT                   SVSGSCAPTELCPWRKRRLQGQVHDENAARLGGIAGHAGLFATAEEVAAFGESFLTGSL
FT                   LQPQTVREMTREQLPQQGDAHRCHERRGLGFALRSPDPLASSSPFSPSAFGHTGFTGTS
FT                   LWIDPERELVVTLLTNAVYHSRQENGFQAFRVAFHQAILEGLS"
FT   gene            349223..350188
FT                   /locus_tag="CYB_0332"
FT   CDS_pept        349223..350188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0332"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to SP:P52693; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01329"
FT                   /db_xref="GOA:Q2JPG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG1"
FT                   /protein_id="ABD01329.1"
FT                   /translation="MRLELLQAFLNVVETGSFLAAARLSGLTQSAISRQIQALEEAVGA
FT                   PLLHRKSPVALTVAGERLLPHARRICQEWQRAQESIREWLQGQQTELCIAGIHSLIAHQ
FT                   LPPVLQQFCREYPEVQLRVTALGSDRALKVLRDGLVDVALVMENPLMTRGAELVVEPLY
FT                   SEPIQVLMPATHPLSRYERIPWKVLAEYPQAVFKDGYAMRSLVGSHLARQGLPLKAALE
FT                   LNTLDAFRGVVRQGQLIALLPESALVDCCADPDLQVRPTEPPLLRRQVVMVTTSDRYRI
FT                   PPIRRFLQLAAQLIRQSEVEPASGTDPHFPQPSAGLLSVL"
FT   gene            350302..351342
FT                   /locus_tag="CYB_0333"
FT   CDS_pept        350302..351342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0333"
FT                   /product="glycosyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF02885"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01330"
FT                   /db_xref="GOA:Q2JPG0"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPG0"
FT                   /protein_id="ABD01330.1"
FT                   /translation="MSQEFRELLKKIGSGTHTHQDLSRAEAASAARMLLRGEATPAQIG
FT                   AFLIAHRIKRPTAEELAGMLDAYAEDGPLLPQRDLPHPLIIFGHPYDGRSRTAPLGVLV
FT                   ALLLAAAGSAVLLHGSGFCPTKYGLPLEAVWRSLGVDWRGLSLERVGQLLEQTGLGFLY
FT                   LPTCFPQAQALMDYRDQIGKRPPLATLELVWTPYQGPFHLVAGYVHPPTEATMLELFAL
FT                   REIRQFTTVKGLEGSCDLPRERAAILNQGGKRLLLKARDCHLAGPEIPFSGEKELLQQM
FT                   QQVLSGDPCELTPAVLWNGGSYLWLLGHAPSLPEGIQQAEDLLRSGRVMEKLKQLIRVI
FT                   DLIHLR"
FT   gene            complement(351715..352995)
FT                   /locus_tag="CYB_0334"
FT   CDS_pept        complement(351715..352995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0334"
FT                   /product="Rho termination factor, N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF07498"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01331"
FT                   /db_xref="GOA:Q2JPF9"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF9"
FT                   /protein_id="ABD01331.1"
FT                   /translation="MPQERIPLEEMTIRQLREEAARYQIPKYSRMTKDQLIEAIREAQV
FT                   KAGRPVDAMPEPKGQESVTQTKFRGQEVAGKTDLADVDKGLGDLPEGYGESRIVLLPRD
FT                   PQWAYAYWDVPNEAKESKRREGGQQLALRLYDVTDIDFSYQPAHSMQEYPCDELAREWY
FT                   LPIPVSDRSYIVEIGYRTADGRWLMLARSAAVMVPPVFPSDWFEEHFLTVPFDMALQGR
FT                   TLYQLSEPYKRSATGMGVVDYKGDEPQQGATVDPFLEMVGGFEAMRVAGSLFGSHQMGS
FT                   RQLVPEQAISSFIIPSGVGMMGMAMAEVPAAPWMASGSGLGLFSGASEVLPQRSRKFWL
FT                   VADAELIVYGATEPDATVTIGGRKIQLNPDGTFRFHMAFPDGNIDFPIFAVAADGEQNR
FT                   EIHMTFDRRTLSRRTNTKEEAIEELLP"
FT   gene            353347..354255
FT                   /locus_tag="CYB_0335"
FT   CDS_pept        353347..354255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01332"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF8"
FT                   /protein_id="ABD01332.1"
FT                   /translation="MREDERLPSGPQVLRPRGVGMRWWKYRIQGIRIQVSWAALGILLA
FT                   GPVLPVEAVDAQTLFPPLYRLQGGSPTLPASEATPWRPVTQDSVPLPQTDQADPKVQPA
FT                   QPGHGEVAEGPVFDLDLLRQFGTSPGGSGSGSRQGEVIGPGSGQSGVRGASPGSGVGTG
FT                   QGPGGGTGLEAGSQRREPQVTGLIVDARGLDFLPSQSMRLFDPDGNQVYTPVTLGQDLN
FT                   AAFVGSEGTAAYATSEEQARSLVNRIGERPHRIRAIRTLGYDLVISAEDAFSLRQMNAT
FT                   DGFLDRFAVVVIWDGSQASLP"
FT   gene            354383..355504
FT                   /locus_tag="CYB_0336"
FT   CDS_pept        354383..355504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0336"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01333"
FT                   /db_xref="GOA:Q2JPF7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF7"
FT                   /protein_id="ABD01333.1"
FT                   /translation="MQRFANQPLREHPHLAVFSSSKVGNFVVTIPLLRGLKEKYPGCVL
FT                   DFFGSEITRDFELHCPYIDFSFPLYSRRPDYLEALTAAVRERVTQAGPYDLAINCDEFS
FT                   ELNLVAVTALRPQYIAGAGLTLDFRRKLDPGSDPVQRMLQDDDWNGLEFLQRYKGILTS
FT                   NYIAEIFCRLAYVETDFFRLELPSRDPGFPVPEVLVHITTTRRAKMWPLEYWRQVIQWC
FT                   QGQGLQVGLIGSAPELQRSLYHGGSSEDELLAQTGMVDLRGKTSLMELAGALKRARVCI
FT                   SVDAGPMHIAAAVGCPTIALFGNDADGDGASPVRLWAPRLPHVYLTQTAYKCRVCAENK
FT                   FKNETCLVEGHPCMAHLKPETVIGYLKEILKQT"
FT   gene            355765..356694
FT                   /locus_tag="CYB_0337"
FT   CDS_pept        355765..356694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0337"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01334"
FT                   /db_xref="GOA:Q2JPF6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF6"
FT                   /protein_id="ABD01334.1"
FT                   /translation="MWYRHQLSRFAEWGKIRLWQGVALKLLATACFACLGAIIRLNTPA
FT                   LHPFQIVFLRNLFGFLALSPLVLRAGIQSLHTAKMEFYLLRSAISTVGMLLSFWAASLL
FT                   PLAEATALSFVQLLFAGTMAVWVLGEQMRSSRWLGLGLGFAGALVMLRPGFREFSLGTG
FT                   LALGAAALFAWVTIVLKILSRTESSLTITAYMGLLQTPLSFLAAVWVWTWPSPEQWLWM
FT                   VAMGLLGSIGQVALAQAYKLAEVTMLLPLDFSRLLWASLIGFWVFAEIPDGWTWMGGAL
FT                   ILVGATSGAYGEARLPTMPTQARTGGVG"
FT   gene            complement(356719..357846)
FT                   /locus_tag="CYB_0338"
FT   CDS_pept        complement(356719..357846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0338"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01335"
FT                   /db_xref="GOA:Q2JPF5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF5"
FT                   /protein_id="ABD01335.1"
FT                   /translation="MLSASPCQLDLAIPAPGRLYRGSGILEAVPLAVLGSRVLVIGGER
FT                   SLAVVESPLQRNFARDPALQVHWTTYGVDCSESELARLQALAMAESTTGILGVGGGKAL
FT                   DTAKLVAHRLRIPVVTVPTSAATCAAWSALSNIYSNSGAFQRDVALDQAPAALILDYDL
FT                   IRQAPPRTLVAGIGDALAKWYESSVSSGSSEDALVIGAVQQARVLRDLLLQQSAAALRE
FT                   PGGTAWKQVVDACICLAGIVGGMGGAKCRTVAAHAVHNGLTHLSGHRATLHGEKVAFGI
FT                   LAQLRLEEILQGSQLALAARTQLLEFYRQVGLPLNLRDLKLGHLGSADLLHAAQVACQP
FT                   GSDIHHLPFPVSPEALLVALTTTDLTSSSPVLPRL"
FT   gene            358096..358743
FT                   /pseudo
FT                   /locus_tag="CYB_0339"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error"
FT   gene            complement(358767..360056)
FT                   /locus_tag="CYB_0340"
FT   CDS_pept        complement(358767..360056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0340"
FT                   /product="aminotransferase, classes I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01336"
FT                   /db_xref="GOA:Q2JPF4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF4"
FT                   /protein_id="ABD01336.1"
FT                   /translation="MTQTSSASAPRSTSRPLLQTLFAQRAQAVIPSPFGAEIPGAVPVV
FT                   TSFTFGLADPRLFPKADLARATAEVLAEDGDNALNYGGTFAGLIDVVLQLMRDRGVEAQ
FT                   PENLLIGYGSGQILGLLPQVFVEPGDVVIVEGPTFMGAVSRFAAAGARLISIPVDGEGM
FT                   VVDRLEEVLRDLARQGIRPRFVYTIPTFQNPKGCTLSGPRRQKLVQLAAEYGVVVVEDE
FT                   AYYDLRFAGDPLPSLAALDREGWVLHVGTFSKIVVPGVRVGWACGHPEIIRRLEMFRSE
FT                   GSLGPFLGRVVARYCGEGRLQSHIQLLTRRYREKCQVMLEAIAQYFPPEVKVEAPGGGF
FT                   FVWCELPPFLSASTLLQATRALGVTFLPGTHCFADGQGDHALRLAFSYQPEERIVSGIQ
FT                   TIGEQLYRLIHSCASGAEQQGKELSKSMDP"
FT   gene            complement(360079..361053)
FT                   /locus_tag="CYB_0341"
FT   CDS_pept        complement(360079..361053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0341"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01337"
FT                   /db_xref="GOA:Q2JPF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF3"
FT                   /protein_id="ABD01337.1"
FT                   /translation="MGLLLGQRLRSWGQPAPLQWWRVLPVSSSEGSLTFVQPELPLYHS
FT                   FASVVRSTFADGLLPWLAQGTGISAEGILHIFSAMACLAILLLCWSWGNFWSAGLWGLS
FT                   PWVLTQGLEPGSEILGSLVLLCSCGVGPGSTLRWWGLALACALSYKVWPLALLWAGLWT
FT                   SQQWPRQPLRSRQRLGISGLLLLLLVMGLSWLGRFNLPATSAEVIPHPLSSQGGLAVLA
FT                   TLMLPLGLSLVRLGWPWAERQQALLSLAGLGHVLWVGVLAAVFWDPQVNTLQQSARWGL
FT                   VVLPFLCLSAGGVLAEIPYRSWRRVLGSLLLGSSFLLSWQALA"
FT   gene            complement(361401..362072)
FT                   /locus_tag="CYB_0342"
FT   CDS_pept        complement(361401..362072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF2"
FT                   /protein_id="ABD01338.1"
FT                   /translation="MQRYHRLVRWIPEKRPAGSGRRRWLGVGLSVVLGLVSTPGRVRGA
FT                   EHFVPARGETCLAAPQVWAEALTEQLPLFLNLALSRSRSEFQVVLVGKPEVEMLSPGSP
FT                   ARLRQQELAPVLPDTATASPEAFRLYFTTLERRLVLATPAESSANPLAGRRSETLQLAY
FT                   EAYVLRANPGDPWRLVRLQVTGSGIPIRDVTNGLTAQAIRRWQQSGCPLTGDLELTRPS
FT                   L"
FT   gene            complement(362120..362827)
FT                   /gene="pyrF"
FT                   /locus_tag="CYB_0343"
FT   CDS_pept        complement(362120..362827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="CYB_0343"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01339"
FT                   /db_xref="GOA:Q2JPF1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPF1"
FT                   /protein_id="ABD01339.1"
FT                   /translation="MKGDRLIVALDTPSQEQALEWVDSLPQVLWWKVGLELFTAAGSSI
FT                   LQALKERGKRIFLDLKLHDIPHTVGRATEVAVGYGVDLLTVHAAGGSAMLRSAVAAAQG
FT                   SSCRLLAVTLLTSISPPQVRQELGIEMDPADYVLHLARLAQAQGFTGLVCSPQEVSRLR
FT                   QALGPEVLLVTPGIRLGQAKAGDGDEDQQRICTPDEALRAGADYLVVGRPITASPDPVA
FT                   ALRRFQALWDAAS"
FT   gene            complement(362824..363420)
FT                   /locus_tag="CYB_0344"
FT   CDS_pept        complement(362824..363420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPF0"
FT                   /protein_id="ABD01340.1"
FT                   /translation="MAYSRQCLHRKPLHRRTGGAVSIGESSSSGCRLPGRKLKVAQAGG
FT                   KVKKEPLGRCCMDFEKLLEEWVAAFAQVAEESLASLETALMELAEHLAVPLQETLRQWE
FT                   ALWNLEEEVELEPEPEPFEETLNPSGESFTTSRFFVSPIGFGGVVVYTYVASPPEYIGD
FT                   PTCRYNAHSPELRCAVNPCGPCEGCPHYEPRNEPR"
FT   gene            complement(364017..364817)
FT                   /locus_tag="CYB_0345"
FT   CDS_pept        complement(364017..364817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0345"
FT                   /product="conserved hypothetical protein TIGR00726"
FT                   /note="identified by match to protein family HMM PF02578;
FT                   match to protein family HMM TIGR00726"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01341"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE9"
FT                   /protein_id="ABD01341.1"
FT                   /translation="MSGSALWVWQQAERWRWLECQLLAEWPHAFGSRQGHPHPPSQLAA
FT                   RLQLPPEQAAWGHQVHGCNWVWADGITETFGHKREQDCSVGQEISTRSQADAVIARRQG
FT                   DSAWVCTADCVPILVASREWVAAIHAGWRGTAAGILSKVLQEFLQAGIPAAGIRVAIGP
FT                   SISGSVYQVSEAVAELVLNSLPPGLDARAALLPDPLPGKVRLDLRWVNGAQAQAKGIPP
FT                   EHIAVSPHCTLSQPQDFFSYRRDGSLKDEQGRHCVQWSGIGLRS"
FT   gene            complement(364814..365245)
FT                   /locus_tag="CYB_0346"
FT   CDS_pept        complement(364814..365245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC08662.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01342"
FT                   /db_xref="GOA:Q2JPE8"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE8"
FT                   /protein_id="ABD01342.1"
FT                   /translation="MIRPNSAHLLTPDFRLSLSVLALAVPLFWLSFWAGLGVGLFGLFL
FT                   MVQTSLIGLAFTRTALQVYSGSKRIREFPYSEWQDWQIFWPPLPVLFFFRETKSIHFLP
FT                   MLFNPAELKMCLEERVGHLHAQHRSQGSPPIAGPGSSRR"
FT   gene            365638..366588
FT                   /locus_tag="CYB_0347"
FT   CDS_pept        365638..366588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0347"
FT                   /product="GGDEF/FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01343"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE7"
FT                   /protein_id="ABD01343.1"
FT                   /translation="MLTANPHNSLGLSMPLDPLSQLPEEPTTQIPLEFYERRPQPEATA
FT                   AFLTVLSGANVGMTFPLARGGVLGRSHRADIQLLDHAVSRQHCRLERESEGYVLTDLES
FT                   LNGTYVNGERVSRVLLKDGDRIQVGASTLKFAYYDAAEEAFFLQMATAALYDPLTGLYN
FT                   RRFFLKQLELEIPFALRHRIPLHVLYLDLDGFKQINDRWGHWAGDQTLIQVARRLQAHV
FT                   RQDDLVARLGGDEFALLVRGIPNSQILGLAERLRQAVQTLLVQAGTETISLSCSVGIAS
FT                   LLELGEGTDPQSLLAAADKALYQAKAEGGNRETLL"
FT   gene            complement(366610..366999)
FT                   /gene="gcvH"
FT                   /locus_tag="CYB_0348"
FT   CDS_pept        complement(366610..366999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="CYB_0348"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to protein family HMM PF01597;
FT                   match to protein family HMM TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01344"
FT                   /db_xref="GOA:Q2JPE6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPE6"
FT                   /protein_id="ABD01344.1"
FT                   /translation="MALEYPSHLRYVDTHEYIHVEDDIAVIGITAYAVDQLGDIVFVGL
FT                   PEEGTEIEKGESFGSVESVKAVEDLYAPLSGEVVAVNTAVVESPESLADDPYGDGWLIK
FT                   VRIANPEDLEDTMSAEAYASLVEGS"
FT   gene            complement(367081..367986)
FT                   /locus_tag="CYB_0349"
FT   CDS_pept        complement(367081..367986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0349"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01345"
FT                   /db_xref="GOA:Q2JPE5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE5"
FT                   /protein_id="ABD01345.1"
FT                   /translation="MAEAGIPRLPPEVAAKMGTWQHGYALTNGIQLHYVTQGEGELAIL
FT                   LHGFPEFWYSWRHQIPVLAQRFRVVAPDMRGYNDSDKPDHGYDLDTLTEDIRGLLSHFG
FT                   ARRAVVVAHDWGGAIAWHWAQFFPEEIRKLAVLNSPHPACFRREFLSNLDQLRRSWYLF
FT                   FFQLPWLPEWVLQWDLGDWVRRIFQETSVRKSAFTRHDLKLYQEALSKPKVLTSALNYY
FT                   RQLFNLPTLQNLFLQPMRQILAPTLLIWGEEDFALSRELTEGMDPFFPNGLRKEYIPEC
FT                   GHWAQQEAPQTVNRLLMEFL"
FT   gene            368129..369076
FT                   /locus_tag="CYB_0350"
FT   CDS_pept        368129..369076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0350"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01346"
FT                   /db_xref="GOA:Q2JPE4"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPE4"
FT                   /protein_id="ABD01346.1"
FT                   /translation="MNTSAEGQSPTSPQSVAILGAGAWGSTLAMLAQGQGHRVRVWNRR
FT                   KGLDLAEVLQGSQILISAVSMAGVRPVVEAVRQVGIPPQAILVSATKGLDPLQLLTPTQ
FT                   IWGATFPEQPLVVLSGPNLSAEIRQGLPAAAVVASRDPWAAVQVQYALSSERFRLYTSS
FT                   DPLGVELGGTLKNVIAIAVGVCDGLQLGANARAALVTRGLAEMIRVGSKLGARAETFNG
FT                   LSGLGDLLATCHSRLSRNYRVGYGLGQGQPLSQILAEIEGTAEGVYTAPVVVEIAAQHG
FT                   IQVPITQEVHLLLQGQTTPTAALTRLMERQLTSE"
FT   gene            complement(369161..369268)
FT                   /locus_tag="CYB_0351"
FT   CDS_pept        complement(369161..369268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE3"
FT                   /protein_id="ABD01347.1"
FT                   /translation="MQEQVEELQLQHRETLEKKTPPNRSFWDLPALQKS"
FT   gene            369353..369718
FT                   /locus_tag="CYB_0352"
FT   CDS_pept        369353..369718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0352"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01348"
FT                   /db_xref="GOA:Q2JPE2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE2"
FT                   /protein_id="ABD01348.1"
FT                   /translation="MSKRILVIEDEPSIRTYLQKVLQRAGYDTVAATDGEEGLQMVRTL
FT                   MPDLVLCDVVMPKLNGYGVLDALRWDQSTAHIPFVFLSSKISPEEIEQGLCFGSDAYLT
FT                   KPVDQKRLLKAVAAQLS"
FT   gene            369859..371220
FT                   /locus_tag="CYB_0353"
FT   CDS_pept        369859..371220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0353"
FT                   /product="ISSoc9, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01349"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE1"
FT                   /protein_id="ABD01349.1"
FT                   /translation="MQRLQAFKYELLPNSQQERQMRRFAGSCRFVYNKALALQKERHEQ
FT                   GQKKLGYAGLCQLLTAWRHSADTAWLADAPVHPLQQALQDLERAHSHFFAQRAGFPKFK
FT                   KKGRSDSFRYPDPKQIQLDQANSRIFLPKLGWLRYRNSRDVVGKVKNVTVSKHAGKWFV
FT                   SIQTEQEVNWPIPQGGAVGMDMGIARLATLSDGTFYAPLNSFKRHEARLRKAQQALSRK
FT                   VKFSNNWKKAKARLQRIHSQMANARRDFLHKVSTAISKSQAIVCIEDLRVRNMSKLAAG
FT                   TADAPGKNVRAKSALNKAILDQGWYEFRCMLEYKLAWKGGRLIVVPPQNPSRTCPCCGH
FT                   VSSDNRQTQAWFECVACGYENNADRGSGPEAFRGSGPEAFRGSGPEAFLVGAINILARG
FT                   IQLLRDEGQDTADAAVGMRVDQPPVSARMACGSNCTGGRKQEPAETTAQGAIHA"
FT   gene            complement(371273..371455)
FT                   /locus_tag="CYB_0354"
FT   CDS_pept        complement(371273..371455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPE0"
FT                   /protein_id="ABD01350.1"
FT                   /translation="MYVSSTRFGGYRWDPRGLWGGFRVESGIPAQQSTDVRSQGGGVEG
FT                   FADEAIGSKLSQRGG"
FT   gene            371550..371756
FT                   /locus_tag="CYB_0355"
FT   CDS_pept        371550..371756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01351"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD9"
FT                   /protein_id="ABD01351.1"
FT                   /translation="MQVSEDLTLDYRTYRIAALLSESFSLGALLGVSLKWQNDVSSVNE
FT                   PRPRASHLSLQDIEQRYLTSWQR"
FT   gene            371797..372024
FT                   /locus_tag="CYB_0356"
FT   CDS_pept        371797..372024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD8"
FT                   /protein_id="ABD01352.1"
FT                   /translation="MNTSLDSVTLPSSIQEIVEQVFRSSFLSLGQENRINELLFQRRYS
FT                   EADLELLDCLSLALLNHQIETEKRSAAKAA"
FT   gene            complement(372178..373257)
FT                   /gene="fba"
FT                   /locus_tag="CYB_0357"
FT   CDS_pept        complement(372178..373257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="CYB_0357"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01521"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01353"
FT                   /db_xref="GOA:Q2JPD7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD7"
FT                   /protein_id="ABD01353.1"
FT                   /translation="MALVAMRTLLDHAAEHGYGIPAFNVNNMEQIQAIMQAAHETNSPV
FT                   ILQASRGARKYAGENFLRHLILAAVETYPHIPVAMHQDHGNSPATCYSAIRNGFTSVMM
FT                   DGSLKEDAKTPASYEYNVAVTSEVVKVAHAIGVSVEGELGCLGSLETGRGEAEDGHGAE
FT                   EALSHDQLLTDPDQAVDFVERTQVDALAVAIGTSHGAYKFSRKPTGDILDMERIAEIHR
FT                   RLPNTHLVMHGSSSVPKELIDIINEYGGSIPETYGVPLEEIQRGIQNGVRKVNIDTDNR
FT                   LAITAAVRRALAENPKEFDPRHFLKPSIKEMQKVCAERYIAFGCAGHGTKVPVVTLDEM
FT                   AAKYASGALAAQVKKTVAV"
FT   gene            373633..374226
FT                   /locus_tag="CYB_0358"
FT   CDS_pept        373633..374226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD6"
FT                   /protein_id="ABD01354.1"
FT                   /translation="MQGTGLAMACWATGLQLAAWGIPGQSPDQVAAWVRDNPVLRPRPG
FT                   ETLNINRVEPDGSRFTFLASVAPPGRIINPLDRETIRSERMTFFRPQGLTAEDLFRAIR
FT                   DVYGPEIAADLDQAVEVIRYPSPEALASSPGYTLALAIQGVVLRGNQFMYWLELTQNPD
FT                   GRVQQGQVWVFQEEWLPKVEGELAERFPLQVMTR"
FT   gene            complement(374262..375125)
FT                   /gene="murI"
FT                   /locus_tag="CYB_0359"
FT   CDS_pept        complement(374262..375125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="CYB_0359"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by similarity to SP:P48797; match to
FT                   protein family HMM PF01177; match to protein family HMM
FT                   TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01355"
FT                   /db_xref="GOA:Q2JPD5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD5"
FT                   /protein_id="ABD01355.1"
FT                   /translation="MQWEWKSEPDPSWPIGVFDSGLGGLTVWRALRRRLPQERLIYFGD
FT                   TARLPYGERSPEEILAFVRQILTWMQAQPVKLVVMACNTSSALALDHVRQEFALPVLGL
FT                   ILPGAQAALAQGSRIGVLATVATVKSRAYSRAIQEYSALDPKRFPYPVYCWEQACPEFV
FT                   PLIEAGWLDSPALRQAAERYLQPLLQQGIDTLVYGCTHYPLLDPILKPLLPSSVKRVDP
FT                   GMALVGSLARELSLWGLRRPSTAAQEEPHRFCVSGDPERFAQLATPWLGFRPQVERVEL
FT                   PAFLRP"
FT   gene            complement(375308..377185)
FT                   /locus_tag="CYB_0360"
FT   CDS_pept        complement(375308..377185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0360"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01356"
FT                   /db_xref="GOA:Q2JPD4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD4"
FT                   /protein_id="ABD01356.1"
FT                   /translation="MGSGWKVMPEFGKPGSRQIWGAMLLLSLAGAGLFPPESVQAQAIT
FT                   APGLSRIERWYYDPQQGRLEVNTQGEVRPFLFVLQNPPRVVLDFPNTRFGREPQTQTFA
FT                   GRVTSLQISQLTDTITRFVLYLQPDQPLSLNQLQLLTAGPSRWAVQLTQAGSLSSSPPS
FT                   SVGLLGGSRDPFPPSPPLPTLPPRRPAPTPSPRSGHQILEVSPQAEGFFIRTQGSPSTT
FT                   VRRILDPDRVVVDFLNTTLSPALTQRAYVINRLGVSRLRIGQFEPTVARVVLDVDSSGG
FT                   DWEARYDPQRGGIWIQPAGGAAQASLLPEVSSVNSSGPLATLQSVQLQGNQLIISADGF
FT                   MFYRAGWDPESGGYRINVAPARLPQSMPDPGLPVGGPVERIRFVQEDARTVSILVQPAE
FT                   EFNVFEPNPGQGSRRITLELRPLNAPPPIPQPQTPGPASPSTPQSLNRTVIAIDPGHGG
FT                   RDPGAIGVDGIQEKDIVLSVAHQVQRLLQERGYGVVMTRTDDREVLLQPRVDMAVQANA
FT                   ALLVSIHANALDRSGIHGIETYYLRPDSAELAAILHRSLVRATGAADRGVRRARFFVVR
FT                   ETPVGMPSVLLELGYVTNPTEGRKLATAEYQALLARAIADGIETFLRSR"
FT   gene            377266..378450
FT                   /locus_tag="CYB_0361"
FT   CDS_pept        377266..378450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01357"
FT                   /db_xref="GOA:Q2JPD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD3"
FT                   /protein_id="ABD01357.1"
FT                   /translation="MGRGSPLLLPACSPARYLGMPRPPDLLTLARAGHAQSIVQVVRME
FT                   LLRRRWCARVDFADETLHVHLLGSLYQPALSPQVAAAQLFLILKQLRIPRLDQVEICAF
FT                   RGSRLLWRQSLKLGSRQRWDRFSFDNWAVNAWAYPAAFAVALMVNNIGLLQLLHLPLHI
FT                   WIHEFGHATVAWWSGYRALPLPIGWTSVSSQRDPFVYFGILFLLILLFWSARKERIGWL
FT                   QVLAIFLALLQFYMTWLMPNRTWEMLFVFSGVGGEFYLSTFLMASFYFPLPDRWRWDSL
FT                   RFVVLGIASSNLWRSFWEWHSIRLGLAEVPWGTLLGGQGDARGDMNRLNYDFGWSTDQI
FT                   IQTYTFLGNLCVLFALSLYVLFLLRANDETWLYLRARFILWMNGLISSSSSKPP"
FT   gene            378804..379409
FT                   /gene="cbiT"
FT                   /locus_tag="CYB_0362"
FT   CDS_pept        378804..379409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiT"
FT                   /locus_tag="CYB_0362"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR02469"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01358"
FT                   /db_xref="GOA:Q2JPD2"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD2"
FT                   /protein_id="ABD01358.1"
FT                   /translation="MSAAFSWPYRTPGIPDSAFERIPGIPMSPREVRVLVLSQLRLGEN
FT                   HCLWDIGAGTGTIAIEAAVLCPKARVIAIERDAEVVSLIESNCEKFGLTNVQVIQGTAP
FT                   DCLQHLSPAPDRICIEGGHPLREILEACWSHLSPNGRVVATTNSLDGLYGLSAGLAAVR
FT                   AHHVEVIQSAVNRLEHRGRTQMLLALDPTFVLSGEKMG"
FT   gene            379607..379825
FT                   /locus_tag="CYB_0363"
FT   CDS_pept        379607..379825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01359"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD1"
FT                   /protein_id="ABD01359.1"
FT                   /translation="MDQFQHPFQESREVKLRQLLIRERWPEMLKGCRACIHWDDFKRPE
FT                   CCGDCGIGDRRRQAVAEESPPSKSPGI"
FT   gene            complement(380443..381219)
FT                   /gene="ubiE"
FT                   /locus_tag="CYB_0364"
FT   CDS_pept        complement(380443..381219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CYB_0364"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P27851; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01360"
FT                   /db_xref="GOA:Q2JPD0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPD0"
FT                   /protein_id="ABD01360.1"
FT                   /translation="MPSPTFEQPEEIRALFDRIAPHYDSLNQTLSLGLHQVWKRMAVRW
FT                   SGASSGGYVLDLCCGTGDLALQLARRVGRRGHVVGLDFSPAMLAIARRRSRLFPGYSLE
FT                   WVLGDALALPFPDSSFDAITMGYGLRNVTDIPQALREIRRVLKPGRRAAILDFHRPTGI
FT                   PLCEQFQRWYLNTQVVAQAKTLGLGSEYAYIDPSLDRFPSGEEQRQMALQAGFASAKFY
FT                   PLAWGMMGVLVIEKFRIVSINSINSTSPKGSDSPRL"
FT   gene            381323..381418
FT                   /locus_tag="CYB_0365"
FT   CDS_pept        381323..381418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01361"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC9"
FT                   /protein_id="ABD01361.1"
FT                   /translation="MLRRHWDPTGSHSVAAAGVISQTQGQGSGSG"
FT   gene            381676..381846
FT                   /locus_tag="CYB_0366"
FT   CDS_pept        381676..381846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01362"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC8"
FT                   /protein_id="ABD01362.1"
FT                   /translation="MVWAPAGQELRPADADGELEEMEWRGEELATGPPPIQETIWGWVL
FT                   EWELQPAWVLG"
FT   gene            382541..383098
FT                   /gene="cobU"
FT                   /locus_tag="CYB_0367"
FT   CDS_pept        382541..383098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="CYB_0367"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /EC_number="2.7.1.156"
FT                   /EC_number="2.7.7.62"
FT                   /note="identified by match to protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01363"
FT                   /db_xref="GOA:Q2JPC7"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC7"
FT                   /protein_id="ABD01363.1"
FT                   /translation="MSIVLICGPVRSGKSRLAEGLAAASGLPVIYLATGPKPDPKTDPE
FT                   WAERVQQHRQRRPSSWQTWETGRDLGAELQKLPQPCCALVDSLGGWVAQGLDCPSSEWD
FT                   PLVQSFLATLQSHRGEILLVSEEVGWGVVPAYPLGRRFRDRMGELTQRLAPLADQVFLV
FT                   TAGFALDLTRLGIPVAGKMEQS"
FT   gene            383136..383615
FT                   /locus_tag="CYB_0368"
FT   CDS_pept        383136..383615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01364"
FT                   /db_xref="InterPro:IPR014946"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC6"
FT                   /protein_id="ABD01364.1"
FT                   /translation="MPITLYLPAKAIQTLDLTPGHELVKTLMADPVRAAQQVQCAIDWP
FT                   RSPEDPRELSEIPEVRLWFIRWDTVYPWMPYFLNWRQGELARYAAMMVPHQFNPREGIV
FT                   YNPEALEIFVYQKIFVLMRWFKQQNLGSVSMLRDMALVFGFEIQPEFLALWEAEP"
FT   gene            383612..384154
FT                   /locus_tag="CYB_0370"
FT   CDS_pept        383612..384154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC5"
FT                   /protein_id="ABD01365.1"
FT                   /translation="MKVMVANTWPGIPGATAVADAWQQVVQRPWGRLSVDPTPSEAQLK
FT                   ALWQQISEWAGERDPLLVLPGSVADPIGPGQTWADLAHAWGLSLLLTLQRETALSQAAA
FT                   FAALLRQARARGLGWVLVGSLTETRDPQALEKLDATLIPRLEAQVGMPVLGRMALDGQI
FT                   LWDPDALLLCNAAQPRN"
FT   gene            complement(383936..384202)
FT                   /locus_tag="CYB_0369"
FT   CDS_pept        complement(383936..384202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01366"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC4"
FT                   /protein_id="ABD01366.1"
FT                   /translation="MNVSGTVRAAGISGWRSVPWLGSIAEQQGIWIPKDLPIKSHSPQH
FT                   RHSYLGFQARDQSCIQLFQGLGIPSFGQGSNQHPSQTTGPGLA"
FT   gene            complement(384573..385637)
FT                   /gene="psbA-2"
FT                   /locus_tag="CYB_0371"
FT   CDS_pept        complement(384573..385637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA-2"
FT                   /locus_tag="CYB_0371"
FT                   /product="photosystem II protein D1"
FT                   /note="identified by match to protein family HMM PF00124;
FT                   match to protein family HMM TIGR01151"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01367"
FT                   /db_xref="GOA:Q2JP67"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP67"
FT                   /protein_id="ABD01367.1"
FT                   /translation="MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTAT
FT                   TCFIIAFIGAPPVDIDGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDE
FT                   WLYNGGPYQLIVLHFLIGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPI
FT                   GQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSS
FT                   LIRETSEEESQNLGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVI
FT                   GIWFTALGISIMAFNLNGFNFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFP
FT                   LDLAAVEVAPAVRG"
FT   gene            complement(385745..388288)
FT                   /locus_tag="CYB_0372"
FT   CDS_pept        complement(385745..388288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0372"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03699"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01368"
FT                   /db_xref="GOA:Q2JPC2"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JPC2"
FT                   /protein_id="ABD01368.1"
FT                   /translation="MQRLRRGLFLLLGVGLGILAITGLAAFYVDLAWFAELHALPVLWT
FT                   RVIARWGLGLGAFLFALAVTGSNICSCWRGATLAGAWAIATGLSVFFAGSLSNHWFTLL
FT                   LWLNQGPVGESDPIFNRDLGFFLFSLPFWETLQHWCFNLVLLTLIAVVLIYLVELGLSE
FT                   QRLTLALSLYAQRHLLILGGSLFLIRAWGHWLERYELLYSTRGVVFGAGFADVHATLPA
FT                   TTLMSGVAGLTAVGFWALARQGIRLNLPFLKSWCPSWASSLLAPAILWGAYLGFGLLTT
FT                   QLYPQLVQTFLVTPNELELERPYIEDNIRFTRAGFGLADVEVQPFPEGGALTWEILQQN
FT                   QSTLSNVRLWDADPLLATYRQLQEIRPYYQFPYVNVDRYRIGGELRQVMHAARELDFAQ
FT                   VPPAAQTWVNRRFFYTHGYGLTLSPVNVVTPEGLPDFFLSDIPPRVSPRYPEVASVLRV
FT                   EQPALYYGELTTTDVFVGAEARELDYPAAERYVYSSYRGSGGVPIPHLWQRFLYAWHFG
FT                   DLRILLSRELSSATRFLYRRQIRERIRRVMPFLLYDRDPYLVIQGGKLYWFFDAYTTSS
FT                   RYPYSEHLPGFPFNYIRNSVKAVMDAYNGSIDWYIADPRDPLIQAYARIYPTLFKPLEA
FT                   MPEPLRQHIRYPQDLFRLQAQQFATYHMTDPRLFYNREDQWQIPGQFRNRRRIPMQPQY
FT                   LILTLPRDPQGVANHTPEFVLLSPYAPVNKQNMVAWIAARCDGENYGKLLVYEFSKQRL
FT                   IYGPEQVEARVNQDPLISEQISLWNQHGSRVNLGTLLVIPIETSLLYVQPLYIEAEQGR
FT                   LPQLTRVIAAYEDRVVMEPTLGQALEALFLPRGSR"
FT   gene            complement(388293..389735)
FT                   /locus_tag="CYB_0373"
FT   CDS_pept        complement(388293..389735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC90716.1; match to
FT                   protein family HMM PF04459"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01369"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC1"
FT                   /protein_id="ABD01369.1"
FT                   /translation="MSRASLKPARISAVLPGSLAAEVGIQPGEALVSINGERPRDLIDY
FT                   RFLIAEECVSLEILNSQGIPRTVELEKGIDEDLGLEFETALFDGLIQCANACPFCFIDQ
FT                   QPPEMRATLHLKDDDYRLSFLYGSYLTLTNLPAAEWERIARLRLSPLYVSVHATDPELR
FT                   SRLLKNPRAGLILEQLAWFRQHRLQLHAQVVVCPGWNDGDHLTRTLLDLAAFRRPVDGI
FT                   PTVLSAAVVPVGLTRFRPPGDELVPVDAAKAREVIRQVETLQVGFRQTLGSTFAWLADE
FT                   WYLLAGRELPPAEHYEDYPQLGNGVGSLRLFLSQFEQLKLPPELPSPLKVLWVVGNAVE
FT                   QAFQPVVEQMNRIRGLQLDLLPIASQFWGQTLTVTGLLTGQDILDALKSVENLADYDGL
FT                   LLPQIALKDGERFLDDLTWQEVQAQVGIPVVRVDGGPAGLVQAVQQLEQGYAYGTLCCS
FT                   ATLGRRETAPLTRPRTALSRGS"
FT   gene            complement(389844..390128)
FT                   /locus_tag="CYB_0374"
FT   CDS_pept        complement(389844..390128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB1857"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01370"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPC0"
FT                   /protein_id="ABD01370.1"
FT                   /translation="MSEPSGRLVWNHSTHISGLIPVLERLTRQAGIKTVTPGALSCSRG
FT                   RIPQLQLRVSVPIRGGYKLVARKGSSVQEVFVVTDLSQTELEAAILRCL"
FT   gene            390215..390883
FT                   /locus_tag="CYB_0375"
FT   CDS_pept        390215..390883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0375"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /note="identified by similarity to SP:O06866"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01371"
FT                   /db_xref="GOA:Q2JPB9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB9"
FT                   /protein_id="ABD01371.1"
FT                   /translation="MPEDSPPAVVALILAGGNSRRMGSDKALVLWDGIPLLRRVAQVAA
FT                   ACADAVYILTPWPERYAPVVDPGWHLWRENVHSRDSVAEQHRGPLLAFQEGIRRLQTLA
FT                   APPEWILLLACDLPCLQEQVLGDWRQRLATLPPQTVAALPKSQRGWEPLCGFYRLAQLG
FT                   SLESFLQAGGRSFQGWLSQVPTAILPLTVPDSGTESLERMLTNCNTPADLQLGGNLGRG
FT                   "
FT   gene            390961..393057
FT                   /locus_tag="CYB_0376"
FT   CDS_pept        390961..393057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AE2246"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01372"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB8"
FT                   /protein_id="ABD01372.1"
FT                   /translation="MLTSLYYREIPCPDSAQVLRWLQECIPLPQGSQKVLTPTGLRLQG
FT                   SGAELALFLWSGLNTTYLKVFQWSEQPFPRQARWLGELEQAIQSQFPHRYPQLPQIDLN
FT                   RGSIFDQLEPFYPQTVKYFRRIPNGEFDLQRVYWWEKRWREEVQHCHAAHRPAQPVLFR
FT                   QPGPEPAPVEWDLAIVGGALGAIYGAAMARLGYRVALVERLPFGRMNREWNISRRELQT
FT                   LVDLGLLSAEQMESLILREYTDGFNKFFDGNSPVRAPVLHTPTVLNLAIDAEKLLQLCG
FT                   QILTSCGGAIYERTEFQRAYVGEQGVTLVLKDLPTGEEFRLGSRLVVDAMGTVSPIAQQ
FT                   LYRHRAFDSVCPTVGATIAGGFEPGVWDPQFGDILASHGDISRGRQLIWELFPGPGEDL
FT                   TFYLFHYHQVHPENPGSLLELYEDFFTILPEYRRCDPERLQWKKATFGYIPGRFGQPRH
FT                   PVRGSGAESSEPFDRILLIGDAAAMQSPLSFTGFGSLVRNCPRLCDLLDTALRHDLLRA
FT                   ADLAQIRAYQGNSAVTWLFSRGMMVPTGKVLPPERINATLNSFFGILATEPPEVVDDFI
FT                   KDRAGWLAFNRMAIKAALQNPRLLLWIWEAVGAKGFAQWLPTYLSYTGLALTSALLRGW
FT                   LPNLLRRLQPWLEARYPRLWLRCLQWSYTLTYGVGQPRIQFQLPPTQEKTQDAIPTWVG
FT                   SLQQ"
FT   gene            393663..394001
FT                   /locus_tag="CYB_0377"
FT   CDS_pept        393663..394001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01373"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB7"
FT                   /protein_id="ABD01373.1"
FT                   /translation="MVYTFEIIGIAPALQFFHQQQKLAQRPCGVEYLGTSSCTLDALLG
FT                   SVEEVPARRGWDLDQLVDAVIRFWCSNPDLVSMWRSRFRDAGRDALLVSRVGHIQSLRQ
FT                   EFEWLLKQ"
FT   gene            394086..394427
FT                   /locus_tag="CYB_0378"
FT   CDS_pept        394086..394427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0378"
FT                   /product="histidine triad family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01374"
FT                   /db_xref="GOA:Q2JPB6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB6"
FT                   /protein_id="ABD01374.1"
FT                   /translation="MSDTVFGKIIRREIPAQIVYEDDRALAFKDIAPQAPVHILVVPKE
FT                   PIPGISQAKPEHEALLGHLLLTAQRVAAEAGLNKGYRLVINEGEDGGQTVFHLHIHVLG
FT                   GRGMGWPPG"
FT   gene            394512..395162
FT                   /gene="cobH-2"
FT                   /locus_tag="CYB_0379"
FT   CDS_pept        394512..395162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH-2"
FT                   /locus_tag="CYB_0379"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by similarity to GB:CAA04310.1; match to
FT                   protein family HMM PF02570"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01375"
FT                   /db_xref="GOA:Q2JPB5"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB5"
FT                   /protein_id="ABD01375.1"
FT                   /translation="MEWHVTDAESLMIIDQEVGKHELSPAEYEVVRRVIYATADFEYLN
FT                   LIRFGNEALQAGAAALAARTTIVVDEPMVQVGIAWAVQNTFSNPIYCSSEAITRPQRDK
FT                   TRSAWGLETLAQRYPEAIFVIGQSQTALSTLVQLIRKKEVAPALVIATPAGFVNVVQAK
FT                   QELADSMVPHIRTEGRKGGPAVAAAVLDGLLDLAWHAYIRVSSADYPGKSAVS"
FT   gene            395663..396133
FT                   /locus_tag="CYB_0380"
FT   CDS_pept        395663..396133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01376"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB4"
FT                   /protein_id="ABD01376.1"
FT                   /translation="MRCAIFFCWLAWVFAPGAWAQAEPCPVVVLSPSSQLQLSESSTLA
FT                   STLSTAQKVLHTATALDKAEVIATQHFPEPVSPYQRWRQRYAPSDPLSSGLNSVPYRPA
FT                   QQGSQRIQQGTEGLPLGPATRQGEQLEQIGIRLGEDSPFFLHPSGLVYRQSY"
FT   gene            complement(396252..398000)
FT                   /locus_tag="CYB_0381"
FT   CDS_pept        complement(396252..398000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0381"
FT                   /product="putative diflavin flavoprotein"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF00753; match to protein
FT                   family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01377"
FT                   /db_xref="GOA:Q2JPB3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB3"
FT                   /protein_id="ABD01377.1"
FT                   /translation="MATTAVAPQVAPRLAQPHLTLQTLPIGADTLAIRSQDWDRDRFDI
FT                   EFALENGTTYNSFLIRGEKVALIDTSHEKFRQLYLDCLQGILDPAQIDYLVVSHTEPDH
FT                   SGLVGDLLELAPQMTVVASKVAVQFLEDLVHRPFRRLVVKQGDRLDLGKGHVLEFISAP
FT                   NLHWPDTILTYDHGTQILYTCDVFGMHYCDDFAWDEHPHLLQADFKLYYDCLMGPNARS
FT                   VLSALKRMEALPPIAAIATGHGPLLRHHLSDWVGQYRTWSLEQAKAERLVAVFYLSGYG
FT                   QAETLAQAIARGIQKTGIQVELADLRLVDAHEVRELMSLAAGVVIGMPPQSGPEAATTQ
FT                   VLLKTLLASAHSKQGFGLFESGGEDDESVYLCRNTLQEIGAKEVFAPILLKQPAGEALL
FT                   QLAEEAGTDLGQWLTRDRNIQQMKALDADLDRALGRISNGLYIITARKGQATSAMLASW
FT                   VAQASTDPPGISIAVAKDRAIESFLQVGDTFVLNVLQEGHYQPLMRHFLKRFPPGADRF
FT                   AGIKTYPAANGSPILADALAYLECRVVSRLETSDHWVVYSTLEAGRVSSPEGLTAIHHR
FT                   KVGNHY"
FT   gene            complement(398116..399882)
FT                   /locus_tag="CYB_0382"
FT   CDS_pept        complement(398116..399882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0382"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01378"
FT                   /db_xref="GOA:Q2JPB2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB2"
FT                   /protein_id="ABD01378.1"
FT                   /translation="MPRASTSRHQTDPRFSSAIAPRRFPEQAKGLKPHQQKQLQRLYQL
FT                   RLPPDRLVTVEFAQRLGSLTQDLEGQPISVYLNRRGQVIRVGVGSPFETQIPAWELPRQ
FT                   GAERLSGIRCITTQMGEGGPGQKALTAMALQRLDALITLSVSKSGGHRRRGGAATGFVH
FT                   RAYLAHLLPEGERRWQVSEPLPLGILAEQDLQELVAELEDGFRRQVTARQVDLDQDRAI
FT                   LVGLQESGQSYEDLMDGLAELSRLVESAGGQVLQALWQRREGPNSATVIGSGKVQELAL
FT                   LVQDLGANLVVFDRELTPSQVRTLEEAVGVRVVDRSEVILDIFAQRARTRAGKLQVELA
FT                   QLQYLLPRLAGRGRTMSRLGGGIGTRGPGETQLEMERRAIQRRISKLRQEVEELRRHRQ
FT                   RLRQRREASQIPVVALVGYTNAGKSTLLNALTHAQVYVADQLFATLDPTTRRLELPDQQ
FT                   AVLLTDTVGFLTELPDQLVDAFQATLEEVTEADALLHVVDLSHPNWEGQIEAVETLLDK
FT                   LPLATGPRQLVFNKIDRLDPEWVEDVRLLYPKALFVSATTGQNLDQLHHTLAQFAAVLS
FT                   PNPFDSQEPKDP"
FT   gene            399966..400064
FT                   /locus_tag="CYB_0383"
FT   CDS_pept        399966..400064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01379"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB1"
FT                   /protein_id="ABD01379.1"
FT                   /translation="MANTGPVLRGQQYGDVISNGCNIQTKVIPEQK"
FT   gene            complement(400143..400295)
FT                   /locus_tag="CYB_0384"
FT   CDS_pept        complement(400143..400295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01380"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPB0"
FT                   /protein_id="ABD01380.1"
FT                   /translation="MQQDSGNTERKGSLTAQPIWKLSHRQQAQYRDPSLGRSNTLTSLG
FT                   LTLSR"
FT   gene            complement(400347..400778)
FT                   /locus_tag="CYB_0385"
FT   CDS_pept        complement(400347..400778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC50907.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01381"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA9"
FT                   /protein_id="ABD01381.1"
FT                   /translation="MKIFTIGFTKKSAEQFFNRLKQPGLVRVVDTRLNNTSQLAGFTKK
FT                   RDLEFFLHEICKLGYVHLPELAPTQEILDAYKASGEWSNYERQFLSLMAERRIEDQVDK
FT                   SILDGGCLLCSEATPEHCHRRLVAEYLHRKWGDVEIVHL"
FT   gene            complement(400775..401392)
FT                   /locus_tag="CYB_0386"
FT   CDS_pept        complement(400775..401392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB80706.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01382"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA8"
FT                   /protein_id="ABD01382.1"
FT                   /translation="MKSEIYTIGHSNHEIDFFIDLLRQYNITGIGDVRSRPYSRYVPQY
FT                   SQEKLKSALAAAGIAYVFLGKELGGRSENPSCYDQGRIQYERLANEPAFLEGIDRLIQG
FT                   SSRYRIALMCAEKDPIECHRSLLVARKLFQSGIPVNHILANGSLETHEALESRLLALCK
FT                   LPEGDLFRSREEFIAEAYLIQGRRVAYRDEKMSKSDERSARP"
FT   gene            complement(401389..402072)
FT                   /locus_tag="CYB_0387"
FT   CDS_pept        complement(401389..402072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAB42624.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA7"
FT                   /protein_id="ABD01383.1"
FT                   /translation="MSYVKTIVCFANSRKMAGRCIAGKEWQNGEPGEWVRPVSSRPSHE
FT                   VSEHERYYESGGDPELLDILCVSCDTPQPLPHQRENHVINPKHRWKKVGHLPWEDINSW
FT                   LDNPENLWGTGESSYAGWNNRLSVGRESGVSLYLVPVEHLRLLVGYKAPGYPNSKRRVR
FT                   GEFVYKGVKYCMDVTDPVIERDFLMGEDGQYDIPDPVLCVSLSDPYLGYYYKLIAAVLY
FT                   SGRLI"
FT   gene            complement(402139..403095)
FT                   /locus_tag="CYB_0388"
FT   CDS_pept        complement(402139..403095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0388"
FT                   /product="carbohydrate ABC transporter-2 (CUT2) family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01384"
FT                   /db_xref="GOA:Q2JPA6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA6"
FT                   /protein_id="ABD01384.1"
FT                   /translation="MSALLSLISLISTTSFWVATLRIATPLLFGTLGEVLCERAGVLNL
FT                   GIEGIMTLGAMTGWLVVYQGSGLWWGVAFAATLGAGVGLIHSLLTVRLGVSQHVTGIGI
FT                   TLLTINAAYFVYRMVLPQVTSPPKIVPFSPWPIPGLSSLPFLGETLFTQPPLTYLSLLL
FT                   VPLMAYILYRTPLGLAVRMVGENPQAAASQGIPVYAVRTGAVMVGSALMAVAGAFLTLS
FT                   AFDAFFFNIVNGRGWICIALVVFAAWDPWRALGGALLFAGFDALQLRLQQLWGSRIPYQ
FT                   FFLMLPYLLSIVALILVSRRAKAPRALLIPFRPEERI"
FT   gene            complement(403102..404151)
FT                   /locus_tag="CYB_0389"
FT   CDS_pept        complement(403102..404151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0389"
FT                   /product="carbohydrate ABC transporter-2 (CUT2) family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01385"
FT                   /db_xref="GOA:Q2JPA5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA5"
FT                   /protein_id="ABD01385.1"
FT                   /translation="MRVEPRSTVPLWLILSAPMAAIVLAFLSCSLLILWTGSPVLAAYG
FT                   ALLRGAVGSPFALSETLTRAIPLILTGLAVAVCFRAKLWNIGAEGQFYGGALVASLLGT
FT                   AGLSLPRPWLVLVLLLAGWIAGGLLLWIPAWLKTQFQVDEVVTTLLLNFVILLGISYLL
FT                   EGPLKDPLALGWPQGRALAESALLPRLIPRSRLHAGLIIALLAALGVWGLEQFTVWGLE
FT                   MRAVGANPEAARFLGIPVQGVILYTSLLGGGLAGLAGACELLGLKGYLTLDLSPGFGYT
FT                   GIVVALLAQLHPLGVVGAAVFIAGVYVGADTMGRSLGVPTYLADVIVAAALLWMLVCMG
FT                   LARYRLRWD"
FT   gene            complement(404141..405703)
FT                   /locus_tag="CYB_0390"
FT   CDS_pept        complement(404141..405703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0390"
FT                   /product="carbohydrate uptake ABC transporter 2 (CUT2)
FT                   family, ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01386"
FT                   /db_xref="GOA:Q2JPA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA4"
FT                   /protein_id="ABD01386.1"
FT                   /translation="MTANPSPPSEAPLALKVVGITKRFGALLANDQIDLELRAGEILAI
FT                   LGENGAGKTTLMNILFGHYVPDQGQVWVFGRPLKLGSPAAALAAGIGMVHQHVVLADNL
FT                   SVLDNILLGTQPLWHLWSRRREGRRRIQKLAEELGLAVDPDALVGSLTLGERQRVEILK
FT                   VLYRGARILILDEPTAVLTPPEIEPFFHTLRQMAGRGLGILLISHKLQEVMRISDRVMV
FT                   LRSGRVVMTGKTAEIHPTALAEAMVGQRLAAVVKAPLSPGETVLELQQVSCRVGQQHLE
FT                   QVSLTVRRHEIVGIAGVAGNGQAVLADLVCGVIRPHQGHLHLHGRVLRLISPAEMVRQG
FT                   MARIPEDRHKTGLIGSLSLWENWVIERYRDPEFSRWGILRHRQIYQQAHTWLQTYDVRG
FT                   LQSGDPRQALQMPVQLLSGGNMQKVILSRELCRDPQVIVAHQPTRGLDLGAVAYVHAQL
FT                   LAAARAGAGILLISEDLDELLSLADRVAVLYRGRLSSAVPTQTTTVTALGLRMAGQEVA
FT                   DAC"
FT   gene            complement(405675..406703)
FT                   /locus_tag="CYB_0391"
FT   CDS_pept        complement(405675..406703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0391"
FT                   /product="membrane protein, bmp family"
FT                   /note="identified by match to protein family HMM PF02608;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01387"
FT                   /db_xref="GOA:Q2JPA3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA3"
FT                   /protein_id="ABD01387.1"
FT                   /translation="MARLELSRRDFCLRSGAFVAGLMGSRWLVRDAAVAQGTKLKVAGV
FT                   YTVPIEQQWVSRIHKALMTAQERGDIDYTWSESVSNTDYPRVLRQYAESSVQLLVGEVF
FT                   GVEREAREVAKDYPKVSFLMGSSLKPDPALSNFAVFDNYIHEPSYLTGMVAGGLTRSKI
FT                   IGMVGGYPIPEVNRLMNAFMAGARELQPEVKFLVTFIGSWFDPPKAKEAAFAQIDAGAD
FT                   ILYAERFGVSDAAKERGVLAIGNVIDTQPDYPETVVVSALWHMEPTIDRAIAAVKAGEF
FT                   KAEDYGIYSMMKYGGSSLSDWGTFADKVPAELKAKVMQRQAEILAGSFVVAIDDSEPKS
FT                   TL"
FT   gene            407105..408379
FT                   /gene="codA"
FT                   /locus_tag="CYB_0393"
FT   CDS_pept        407105..408379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="CYB_0393"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="identified by similarity to SP:P25524; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01388"
FT                   /db_xref="GOA:Q2JPA2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA2"
FT                   /protein_id="ABD01388.1"
FT                   /translation="MDLILRRANLPDGRKGIDIGIQGDRIVALESNLQATAPQEIDVTN
FT                   RLVSPPFVDAHFHLDATLTYGIPRVNQSGTLLEGIALWGELKPLLTPEAVIERALTYCD
FT                   WAVARGILAIRAHVDVCDPNLVAVRALLEVKQKVSPYLDLQLVAFPQDGYYRSPGAVQL
FT                   LEKALDLGVEVVGGIPHFERTMAEGAASVRALCEIAAARGLRVDLHCDETDDPLSRHVE
FT                   TLAYETLRLGLQGRVAASHLTSMHSMDNAYVSKLIPLMAEAELGVIANPLVNLVLQGRH
FT                   DTYPKRRGLTRVPELMAAGLTVAFGQDCVMDPWYPLGSGNMLEVAHMAVHAAQMTGYEQ
FT                   MRQCFLAVTENPARILGLEGYGLEPGCYADLVVLQAADAVEAIRLKPACLYVFRRGRLI
FT                   AQTPPVVAQLHLPGRSAQVDFTRQL"
FT   gene            complement(408376..408834)
FT                   /locus_tag="CYB_0392"
FT   CDS_pept        complement(408376..408834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01389"
FT                   /db_xref="GOA:Q2JPA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA1"
FT                   /protein_id="ABD01389.1"
FT                   /translation="MSQVWKPAQWLTQKLRLVCMSFGCVALAALLLGFGAIPLQLKDLH
FT                   LTPCPDTPEYTNLVTSNGNPIPARCLFIEGTVVNRSRNTVLNADVFGRLYDANGNEVLP
FT                   ERTRLGAIEEVPPGESPFSIRISVPVTSPLPLTMEQFKASGFSGTVRR"
FT   gene            complement(408866..409492)
FT                   /locus_tag="CYB_0394"
FT   CDS_pept        complement(408866..409492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0394"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01390"
FT                   /db_xref="GOA:Q2JPA0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JPA0"
FT                   /protein_id="ABD01390.1"
FT                   /translation="MQELPSPELSSSWRPSSLAADPALEKARLRQHFRQLRQGLDRSLI
FT                   SQKVVAHLASCPQLLAAKTILAYVAFGSEVDLGSLFALFPEKQWGIPRCLPRRQMQWHR
FT                   YQPAELVPNCWGLLEPSPGSTVIDPGKADLILVPALACDRWGRRLGYGGGYYDRFLAAL
FT                   PDPSVPKWGILPQACLLEQPLPQDPWDQRLDGIQTEERFYETGIP"
FT   gene            complement(409537..410001)
FT                   /locus_tag="CYB_0395"
FT   CDS_pept        complement(409537..410001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0395"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P25138; match to
FT                   protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01391"
FT                   /db_xref="GOA:Q2JP99"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP99"
FT                   /protein_id="ABD01391.1"
FT                   /translation="MKRVLLLVLGLLWLGVWGGQPAIALSRAKDNPVVSVQSPAKDFIT
FT                   TESGLQYYDIAQGSGPSPQPGQTVVVNYVGKLQDGTIFDSSYKRNQPFVFTYGVGQVIR
FT                   GWEEGLATMRVGGKRYLRIPPELAYGSRGAGGVIPPNATLDFEVELLAIQ"
FT   gene            complement(410061..410741)
FT                   /locus_tag="CYB_0396"
FT   CDS_pept        complement(410061..410741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01392"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP98"
FT                   /protein_id="ABD01392.1"
FT                   /translation="MVIPPGLMLPLIPLEVLLSTKGLMFLLLSAYGGAMWTFLSGAPRV
FT                   HTIIVPDLEQARGFYEKVLKLPEAELPLQYYYGYEQSMVGYSLGSAYFPGDIGLSPRFD
FT                   AKARPTSGPTQLDTPGLWYQLSDNVQLHVIPGSTDPYAGSGSYGNASRPSSSSASAYGT
FT                   VPAAGRSSGVRYRHVSYERESLKALLKRINKQGIRNSIRSEKPFVFWVRDHQGQIIEFA
FT                   ELKG"
FT   gene            410818..412713
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="CYB_0397"
FT   CDS_pept        410818..412713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="CYB_0397"
FT                   /product="cbiG protein/precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF01890; match to protein
FT                   family HMM TIGR01466"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01393"
FT                   /db_xref="GOA:Q2JP97"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP97"
FT                   /protein_id="ABD01393.1"
FT                   /translation="MKLALFAPSPRARRLANSLIPLLGKEVICWSKAEPQGLPSPWQAY
FT                   GDPKDPTAPGSLAEAVAQTWPQVQGCLFILAAGSVVRLIAPLLQDKQRDPAVVVVDEAG
FT                   RWAISLCGGHVGGADALARQVAATLGAQPVLTSASEGLGIPPLDLLGDPYGWRRGAGDW
FT                   NGVAAALTRGEPVAVHQTCGTRLWRQAWPADHPLVASSPPHPVAQIWIGEYLSPPTEIP
FT                   TVHWHPRVLWVGVGCERGTTRAWLEGSLRRLLQAQGLAFEAIAGLATLELKQDEPGLLE
FT                   LAQAYGWPIEFFSAEALAGIPVPHPSEAVRQAVGTPSVAEAAALLAAQIWGRGDRAFER
FT                   PSCVAEGKATLLCPKQVFTSETEGACTLAIARAAQEYSPRSGHLWLIGTGPGDLGQLTL
FT                   AARMALTQADVVVGYQLYLDLVDPLLHPGQIREASPITQELQRAERAIAWAQQGLKVAV
FT                   ISSGDAGIYGMAGLVLECLVRSGWDGIRPSLEVLPGISAFQAAAARLGAPLMHDFCAIS
FT                   LSDLLTPWPVIAKRLQAAAAADFVVALYNPRSRQRVDPFLKALQIFLQARPAHTPVALA
FT                   RNLYRPGETLRLTTLGELDPEEVDMLTLVLIGNSQTFRHGERLITPRGYRLGEPT"
FT   gene            complement(412730..414517)
FT                   /gene="modB"
FT                   /locus_tag="CYB_0398"
FT   CDS_pept        complement(412730..414517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="CYB_0398"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01394"
FT                   /db_xref="GOA:Q2JP96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP96"
FT                   /protein_id="ABD01394.1"
FT                   /translation="MSDYDLSPLWISLRIAGLATGITFGVGTLAAYGMLHYRGRWRSLI
FT                   EALLLAPLVLPPTMVGFLLLLLFGRRTLLGQLLASLNLSVIFTWYAGVITAAVVALPLM
FT                   YRTALGAFQQIDPTLVAAARTLGASRAKIFTRVLIPLALPGILAGVTLSFARALGEFGA
FT                   TLMLAGNIPGRTQTLSMAIFFAVQAGDMRGAAISSALVLGLSLGVMTAVNLWFQRRPWQ
FT                   RPPSRPLQVLTRRDLDFSTPAPRLWVDIDKKLPQFELQAQLSCDGRPLGLLGASGSGKS
FT                   LLLRCIAGIETPDGGRILLNERALFDAEQGIRLPPAQRRVGVIFQNYALFPHLTVAQNI
FT                   AFGIPAGLSEAEKQERIQAQLRLVKLKGWENRYPTELSGGQQQRVALARALASEPEILL
FT                   LDEPFSALDAHLRSQLEQEMGEILAGYKGVTLLVTHNIEEAFRLCGDLAVMEQGRIIAQ
FT                   GDKRQLFEAPPCLSVAQLTGCKNISRAKLLGPQRVLALDWGCELQVQGSPAGEYIAIRA
FT                   HHLTFRPDGKLPNTFPAWLVKWSETPHRLTLFFRLGGPPAHRQDYHLQAEVWRERWREV
FT                   ETWGSPWWLQLDPRHLRVF"
FT   gene            complement(414555..415322)
FT                   /gene="modA"
FT                   /locus_tag="CYB_0399"
FT   CDS_pept        complement(414555..415322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="CYB_0399"
FT                   /product="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01395"
FT                   /db_xref="GOA:Q2JP95"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP95"
FT                   /protein_id="ABD01395.1"
FT                   /translation="MAMKRRTAMLFLGILAALALRWGSAPGLAQSQPILVGAAVSLQPA
FT                   LTEIDRLFTARYPDIKVEYNFANSGSLQQQVEQGAPLDVVFFAAASFMDALAKQNLLVE
FT                   GSRRDLLSNRMALIVPANARTKVQDFADLVAEEIRVLSIGDLQAMPAGRYAQEILTEAG
FT                   VFETLRPKMVFASTVREILTAVEQGNADAGILFTSDAQLSNRVRVVATADPITPIIYPV
FT                   ALVRDTPAGRSYLEFLTSGEAAEVFVKYGFIRL"
FT   gene            complement(415426..415536)
FT                   /locus_tag="CYB_0400"
FT   CDS_pept        complement(415426..415536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP94"
FT                   /protein_id="ABD01396.1"
FT                   /translation="MTKLNKKGSRQMAIQHWFQYYQMLIVASGEEWLPIV"
FT   gene            415575..415784
FT                   /locus_tag="CYB_0401"
FT   CDS_pept        415575..415784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0401"
FT                   /product="molybdenum-pterin binding domain protein"
FT                   /note="identified by match to protein family HMM PF03459;
FT                   match to protein family HMM TIGR00638"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01397"
FT                   /db_xref="GOA:Q2JP93"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP93"
FT                   /protein_id="ABD01397.1"
FT                   /translation="MQISTRNFFKGTVKSFQVGMVNAEIVLEVAPGIEITAIISKHSAE
FT                   RLGIAVGKEAYAAIKASDVVIAVD"
FT   gene            complement(415813..417465)
FT                   /locus_tag="CYB_0402"
FT   CDS_pept        complement(415813..417465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0402"
FT                   /product="transcriptional regulator PatB"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01398"
FT                   /db_xref="GOA:Q2JP92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP92"
FT                   /protein_id="ABD01398.1"
FT                   /translation="MAYQISGNCIGCNACVDSCPTKAIVVQDGEYWINPLLCNDCEGFF
FT                   PEPQCVSLCPGSAPQPYEAMKGRNRTVTARIRSSPPLFLNGHSQAFASSIVVWEACNFL
FT                   SQFQSLNLQKQGDNQVCYQKSVGHNQGSLTLTLCLDGIPQSAPIDVRTACLHLIFAAYA
FT                   AGLDSPWKESFVFTDSQLESYLGWDKRKDLSKMTRLHLFMTWIEQLCRIQVSIDWPDQG
FT                   RVKGFSVPAGPLWRLLKMHRHFQKDEQGCNHLVGLTWAIQPGEWTRYFLNRQGCRQGQA
FT                   FYQYSSLPLSLLQAVMSHWQHHEGAMRLLLWLLFKVRMGRQQRLTVPTLMRVAYGEERL
FT                   QEAYLNLQERKRLVRTFESDLEVLNHYGLKPEFDPLTYPSSIQPLWARLEAVPEDADEA
FT                   LNFWIEDANNGGLLTAAGPRGKWGLLMQARIQRFHLPSDWHRQAVQEARSPTRESGSRQ
FT                   RRRAKSAPVATDSDLPGPPENPKDFPSSKALRGADISAARRQKGISQRELAQRLGRSQS
FT                   WVRDVENGRLQISLNDRQRLIKALYLDPRQQQV"
FT   gene            complement(417808..418065)
FT                   /locus_tag="CYB_0403"
FT   CDS_pept        complement(417808..418065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN9"
FT                   /protein_id="ABD01399.1"
FT                   /translation="MNTCLLHLGSILKAAEELSLVEKPFPKLQHIQLCTGLSPEEIVRA
FT                   LELEPNPLGWHLEPSHNLADESTYWVGGRPCVGLVIERFA"
FT   gene            complement(418165..418542)
FT                   /locus_tag="CYB_0404"
FT   CDS_pept        complement(418165..418542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0404"
FT                   /product="FeoA domain protein"
FT                   /note="identified by match to protein family HMM PF04023"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01400"
FT                   /db_xref="GOA:Q2JHN8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN8"
FT                   /protein_id="ABD01400.1"
FT                   /translation="MDSGKAQMASSKIRDPYMLAPPTVPKISITISPLQLMKVGEEGRI
FT                   YQLRGSEAACAQLQQMGLTPGTYLQVIQRHPEWILLLPSGQLSLPAHLAKPIWVYMDPR
FT                   CALMSTQEPNKKTILNLPRAF"
FT   gene            complement(418571..418870)
FT                   /locus_tag="CYB_0405"
FT   CDS_pept        complement(418571..418870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0405"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR02008"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01401"
FT                   /db_xref="GOA:Q2JHN7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN7"
FT                   /protein_id="ABD01401.1"
FT                   /translation="MATYTVHLVNPKRRLDTYISVDEDSTILEAAEDQDVDLPSSCRSG
FT                   SCSSCVAKVVEGEVDQSEQTFLDEEQIAKGFVLLCVAKPRSNCTIRTHQEAYLF"
FT   gene            complement(418913..419278)
FT                   /gene="nifW"
FT                   /locus_tag="CYB_0406"
FT   CDS_pept        complement(418913..419278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifW"
FT                   /locus_tag="CYB_0406"
FT                   /product="nitrogenase stabilizing/protective protein nifW"
FT                   /note="identified by match to protein family HMM PF03206"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01402"
FT                   /db_xref="GOA:Q2JHN6"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JHN6"
FT                   /protein_id="ABD01402.1"
FT                   /translation="MSWNHNRRWKDFQALVNAEDYFAFFELPYDPRVVNVNRLHILRKF
FT                   AQYLAPLEHFQGSEEEWLEQARQALEKAYQTFLTSTPQQEKLFRVFQDYGCPDPVGGCA
FT                   GCSSSGERGECSPGIPA"
FT   gene            complement(419275..419538)
FT                   /locus_tag="CYB_0407"
FT   CDS_pept        complement(419275..419538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05082"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01403"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN5"
FT                   /protein_id="ABD01403.1"
FT                   /translation="MLNESDVENVVNGLDFEPFEHLSADQLRTEIKRLNSKAGQLKMDL
FT                   HDLAEGLPDGFERLPDLAARTYALFARLHTLRQRLKTLETCR"
FT   gene            complement(419605..420060)
FT                   /locus_tag="CYB_0408"
FT   CDS_pept        complement(419605..420060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AH1985; match to
FT                   protein family HMM PF03270"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01404"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP91"
FT                   /protein_id="ABD01404.1"
FT                   /translation="MTVTPLSPSTSPILQEIVRQMRAADPYGTYRAWSDELLLKPFVVT
FT                   KAQKRQISLEGEVDPGVRSRILIYYRAIAALIEKETGLLAQVVLDLNSEGFGWVLVFSG
FT                   RLLLVVNTLRDAHRFGFDSLEQLSEKATALIDKGIQLARTYPEVGRL"
FT   gene            complement(420063..420482)
FT                   /gene="nifX"
FT                   /locus_tag="CYB_0409"
FT   CDS_pept        complement(420063..420482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifX"
FT                   /locus_tag="CYB_0409"
FT                   /product="nitrogenase cofactor biosynthesis protein NifX"
FT                   /note="identified by match to protein family HMM PF02579;
FT                   match to protein family HMM TIGR02663"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01405"
FT                   /db_xref="GOA:Q2JP90"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP90"
FT                   /protein_id="ABD01405.1"
FT                   /translation="MQVAFTTRDGKHVNAHFGWANQIDLYEVTPEGYRFCKTLTFGGNL
FT                   EADGNEDKLVPKLQALADVTLIYVAAIGSSAAARLINRRITPIKVQSEEESIESLLQRL
FT                   VSTLHNPPPWLRKVLLAERARKAEAPNPSTSPAEV"
FT   gene            complement(420564..421901)
FT                   /gene="nifN"
FT                   /locus_tag="CYB_0410"
FT   CDS_pept        complement(420564..421901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifN"
FT                   /locus_tag="CYB_0410"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /note="identified by match to protein family HMM PF00148;
FT                   match to protein family HMM TIGR01285"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01406"
FT                   /db_xref="GOA:Q2JP89"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP89"
FT                   /protein_id="ABD01406.1"
FT                   /translation="MAQLIQERKPLSVNPLKLSAPLGAALAFLGIKGCLPLFHGSQGCT
FT                   AFAKALLVRHFREAIPMSTTAMSEVDTILGGEENVEAAILTLVEKAQPELIGLLTTGLT
FT                   ETRGDDMPRILRELRRRQPQLQDLPIVLASTPDFKGSLQDGYAIAVNSLVSTLPESPSG
FT                   SVRPAQVTVLCGPALTPADAQEIKEMAEAFGLEPILVPDPAGSLDGHLGTGFRATPDGG
FT                   TTLEQLRQLGRSGLTIAVGESMRPAAQILAQRFGTPYRVFPHLTGLKAVDPFLATLADH
FT                   SQQPVPSRYRRQRSQVQDALLDCHFFFGNQRIALALEADLLWGWVDWLLDMGCQIQAAI
FT                   SPTPDPHLTTLPIEAVRVGDLGDLEELAPGADLLVGNSHVARLGKRLGIPVHRMGIPIF
FT                   DRLGANHLCQVGYRGTLSQLFAVGNLLMEQEEARHPSPPQVSGHGF"
FT   gene            complement(421901..423295)
FT                   /gene="nifE"
FT                   /locus_tag="CYB_0411"
FT   CDS_pept        complement(421901..423295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="CYB_0411"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /note="identified by match to protein family HMM PF00148;
FT                   match to protein family HMM TIGR01283"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01407"
FT                   /db_xref="GOA:Q2JP88"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP88"
FT                   /protein_id="ABD01407.1"
FT                   /translation="MPLISRTKVAELLNETACEHNHKKDGKGKNKVCAEQAKPGGAQGG
FT                   CAFDGASIALVPIADAAHLVHGPIACSGNSWGTRGSLSSGPQLYRVGFTTDLSENEIIF
FT                   GGEEKLFQAILDLQAKYQPAAIFVYLTCVTALIGDDVEAVCQRASRQLGIPVIPVNAPG
FT                   FVGSKNLGNRLAGEALLDYVIGTASPEYTTPRDINLIGEYNIAGELWDVLPLFDELGIR
FT                   ILAKITGDGRYREICTAHRAKLNVLICAKALLNVGRKMQERYGIPYIEASFYGLQEMNH
FT                   CLRAIAQGLKDPELQERTEALIERETRATEAALAPYRQRLAGKRVVLYTGGVKSWSIIS
FT                   AARDLGMQVTATSTRKSTEEDKARIRELLGQDGILLDKGSPQELLKVVERTKADLLIAG
FT                   GRNQYTALKARIPFLDINQERHHAYAGYRGLVNLAREIDAALHSPIWEQLRRPAPWETP
FT                   AEEEVG"
FT   gene            complement(423286..423645)
FT                   /locus_tag="CYB_0412"
FT   CDS_pept        complement(423286..423645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0412"
FT                   /product="putative molybdenum-dependent nitrogenase"
FT                   /note="identified by match to protein family HMM PF06967"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01408"
FT                   /db_xref="InterPro:IPR009717"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP87"
FT                   /protein_id="ABD01408.1"
FT                   /translation="MTYPYPSLPFPRVGNPLGWLGLVLNSIFRSALKWPRRWLNSIEIR
FT                   GSRQARWICRLIPASCPFERDIRLGSRTIHIPALCRINPLYEEIIALRLRAAAYLAEAA
FT                   AQPQPPSSQEIPSCL"
FT   gene            complement(423649..423873)
FT                   /locus_tag="CYB_0413"
FT   CDS_pept        complement(423649..423873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01409"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP86"
FT                   /protein_id="ABD01409.1"
FT                   /translation="MLTPDRAPLLQFLQVELGIPESALTFALKRHGCEQGPLPMILWHY
FT                   GLISLEQLEQIFEWCAPPPLVTNSTHSEV"
FT   gene            complement(423916..424461)
FT                   /gene="dpsA"
FT                   /locus_tag="CYB_0414"
FT   CDS_pept        complement(423916..424461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA"
FT                   /locus_tag="CYB_0414"
FT                   /product="nutrient-stress induced DNA binding protein"
FT                   /note="identified by similarity to SP:Q55024; match to
FT                   protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01410"
FT                   /db_xref="GOA:Q2JP85"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP85"
FT                   /protein_id="ABD01410.1"
FT                   /translation="MTTPSPSTRSFQQVRDNPVHLGREITVPICEGLNLAWASLQGLYL
FT                   QYLKHHLVVEGAEFYSIHQFFNESLQEVQNHAHEVGERLNGLGGIPASSFAKLAELCCF
FT                   SPEGDDALAVRPMLEADLRAEQSLIDLLRRQAALAESVGDRATRHLYEQILLRTEERAF
FT                   HLAHFLAADSLVLGLSPS"
FT   gene            complement(424516..424845)
FT                   /locus_tag="CYB_0415"
FT   CDS_pept        complement(424516..424845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB1982"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01411"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP84"
FT                   /protein_id="ABD01411.1"
FT                   /translation="MRLAPCFPTGELMSPLVSPPPKTAEVLQVPRCDRWRILYRLQELD
FT                   LTCGCTPTGQLWVMIRTPTEALLVHSVLRLFTLNRSGWLNWLDRCWSLQTWDPPERSAG
FT                   GDDHP"
FT   gene            complement(425332..425454)
FT                   /locus_tag="CYB_0416"
FT   CDS_pept        complement(425332..425454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP83"
FT                   /protein_id="ABD01412.1"
FT                   /translation="MAGQIQLFLGVKGLVFQGRGCRILTQRGGGSGCGEDPRNP"
FT   gene            425583..427019
FT                   /gene="nifB"
FT                   /locus_tag="CYB_0417"
FT   CDS_pept        425583..427019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="CYB_0417"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="identified by similarity to SP:P20627; match to
FT                   protein family HMM PF02579; match to protein family HMM
FT                   PF04055; match to protein family HMM TIGR01290"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01413"
FT                   /db_xref="GOA:Q2JP82"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP82"
FT                   /protein_id="ABD01413.1"
FT                   /translation="MPPLSTPPRQGSPFPSACACSSSPRQALPPHLQQRIATHPCYSEA
FT                   AHHHYARMHVAVAPACNIQCNYCNRKFDCANESRPGVVSELLTPAEAAHKVLVIAGKIP
FT                   QLTVVGIAGPGDPLANPKQTFETFARIAEKAPDLKLCLSTNGLMLPDYIDEIKRLNIDH
FT                   VTLTINMVDPEIGAKIYPWIRWRRKRIRGVEAARILHERQMESLDLLREADILCKVNSV
FT                   LIPGINDTHLLEVNRVIQEKGAFLHNIMPLISAPEHGTYFGLIGQRGPTPQELKALQDR
FT                   CSGNMRMMRHCRQCRADAVGLLGEDRSQEFTKERFMQMTPEYDPEKRRQVQASIAQLQA
FT                   QQQAAPTHWTADLPPDSPSILVAVASKGGGLVNRHFGHAREFLIYEVNARGAQFVGHRK
FT                   IPQYCHGGSGEDNNLEQILDLIRDCRAVLVSKIGDCPMKRIREAGIEVVEDYDLIETVA
FT                   LKFYRTWLVNQALDSKSSRS"
FT   gene            427045..427338
FT                   /locus_tag="CYB_0418"
FT   CDS_pept        427045..427338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0418"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01414"
FT                   /db_xref="GOA:Q2JP81"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP81"
FT                   /protein_id="ABD01414.1"
FT                   /translation="MATVTALTKGGLPWIPQFIESLDISRCLGCSRCLKVCGRGVFALR
FT                   ALNEDGEFVDNEEEEESERKVMTILNAALCIGCQACARICPKQCHSHAPQAV"
FT   gene            427382..428572
FT                   /gene="nifS"
FT                   /locus_tag="CYB_0419"
FT   CDS_pept        427382..428572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="CYB_0419"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="identified by similarity to SP:P05341; match to
FT                   protein family HMM PF00266; match to protein family HMM
FT                   PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01415"
FT                   /db_xref="GOA:Q2JP80"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP80"
FT                   /protein_id="ABD01415.1"
FT                   /translation="MIYLDNNATTAVDPLVLEAMLPYLQTFYGNPSSMHSFGGQVGRAL
FT                   NQAREQVAALLGADPTEIVFTSGGTEGNTTAIYAALAAQPQKRHIITTQVEHASVLNVC
FT                   KHLEKQGYRVTYLSVDEQGCLDLLELEAALTGDTALVSCMAANNETGVLFPIEAVGSLA
FT                   RSYGAVVHVDAVQAVGKIPLDLQRLPVDLLTLSGHKLHAPKGIGALYVRRGFRFRSLLL
FT                   GGHQERGRRAGTENVPGIIALGKAAELAQAHLGDPHERLLRDRLEQGLLQRIPDVQVNG
FT                   HPTQRLPNTTNLGFKFVEGEAILFWLNKYGICASSGSACTSGSLEPSHVLRAMGLPYTV
FT                   LHGSIRFSLSRFTQPAEVERVLEVLPGIIEHLRAISPFSHEAEDWLQQQERELARR"
FT   gene            428629..429567
FT                   /gene="nifU"
FT                   /locus_tag="CYB_0420"
FT   CDS_pept        428629..429567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="CYB_0420"
FT                   /product="Fe-S cluster assembly protein NifU"
FT                   /note="identified by similarity to SP:P20628; match to
FT                   protein family HMM PF01106; match to protein family HMM
FT                   PF01592; match to protein family HMM PF04324; match to
FT                   protein family HMM TIGR02000"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01416"
FT                   /db_xref="GOA:Q2JP79"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP79"
FT                   /protein_id="ABD01416.1"
FT                   /translation="MWDYSEKVLELFYHPKNQGAMDPSSEPGVRVVVGEVGSITCGDAL
FT                   RLYLKVDEASERILAASFQTFGCTSAIASSSALTELITGLTLDEALRIDNRQIADYLGG
FT                   LPPAKMHCSVMGQEALEAAIYSYRGLPLPDHTDDDSALVCSCFGVSEQKIRRLIRENRL
FT                   TSAEEVTAYSKAGGGCGSCLAQIEDLIAAVLAETDTIPSEDSRNSKGNSQNQTEPSPAA
FT                   PPPVSATATPPPLTTLQKIARIQAVLEEEVRPLLLADGGDVELYDLEGDQVWVRLKGSC
FT                   TTCPSQQNTLRLLIETRLQEQVWPTLTVHAL"
FT   gene            429845..430723
FT                   /gene="nifH"
FT                   /locus_tag="CYB_0421"
FT   CDS_pept        429845..430723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH"
FT                   /locus_tag="CYB_0421"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by match to protein family HMM PF00142;
FT                   match to protein family HMM TIGR01287"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01417"
FT                   /db_xref="GOA:Q2JP78"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP78"
FT                   /protein_id="ABD01417.1"
FT                   /translation="MRQIAFYGKGGIGKSTTCQNTVAGMAELGQRIMIVGCDPKADSTR
FT                   LMLHCKAQTTVLHLAAERGSVEDVELEEVVLTGYRGVRCVESGGPEPGVGCAGRGIITA
FT                   INFLEENGAYEDLDFVCYDVLGDVVCGGFAMPIREGKAQEIYIVCSGEMMAMYAANNIA
FT                   RGVLKYAYSGGVRLGGLICNSRKVDREIELIEALAEKLNTKMLHFIPRDNVVQHAELRR
FT                   MTVIEYSPDCNQADEYRALAKKIINNTDLRIPTPISMDELEQLLIEFGVLDDDQKIAHL
FT                   IGKTEKELAPV"
FT   gene            430819..432282
FT                   /gene="nifD"
FT                   /locus_tag="CYB_0422"
FT   CDS_pept        430819..432282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD"
FT                   /locus_tag="CYB_0422"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by similarity to SP:Q00239; match to
FT                   protein family HMM PF00148; match to protein family HMM
FT                   TIGR01282; match to protein family HMM TIGR01862"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01418"
FT                   /db_xref="GOA:Q2JP77"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP77"
FT                   /protein_id="ABD01418.1"
FT                   /translation="MTTLKSTLKEETRKIVTEVLETYPEKAQKKRAKHLNVYDEGKADC
FT                   GVKSNIKSIPGVMTTRGCAYAGSKGVVWGPVKDMIHLSHGPVGCGYYSWSGRRNYYVGI
FT                   TGVNTFGTMQFTSDFQERDVVFGGDKKLAKLLVEASELFPLAKGITIQSECPVGLIGDD
FT                   IEAVAKRVSKEIGKPVVPVRCEGFRGVSQSLGHHIANDTVRDWVLPIADKKAKEGSLNF
FT                   EPGPYDVALIGDYNIGGDAWSSRILLEEMGLRVVTQFSGDGTWNEMLLAPRVKLNLIHC
FT                   YRSMNYICRHMEEAYGIPWLEFNFFGPTQIAKSLRAIAQRFDETIQAKAEQVIAKYKPQ
FT                   SEAIIAKYRPRLEGKRVMLMVGGLRPRHVIPAFRELGMEVIATGYEFGHGDDYKRTTQY
FT                   IDDGTLIYDDVSGYEFEEFAKRLKPDLIASGIKEKYVFQKMALPFRQMHSWDYSGPYHG
FT                   YDGFAVFARDMDLALNSPTWDLVKAPWKS"
FT   gene            432348..433883
FT                   /gene="nifK"
FT                   /locus_tag="CYB_0423"
FT   CDS_pept        432348..433883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /locus_tag="CYB_0423"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by match to protein family HMM PF00148;
FT                   match to protein family HMM TIGR01286"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01419"
FT                   /db_xref="GOA:Q2JP76"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP76"
FT                   /protein_id="ABD01419.1"
FT                   /translation="MPQDIQDIKDHARLFQDPEYQALLQCKQTFEDLPSPEEVARVAEW
FT                   TKSWEYREKNFQREALTINPAKACQPLGAIFAAVGFEGTLPFVHGSQGCVAYFRTHLTR
FT                   HFKEPFSAVSTSMTEDAAVFGGLKNLIEGLENAYALYKPKMIAVCTTCMAEVIGDDLGA
FT                   FITTARNEGVISRDFPVPYAHTPSFVGSHITGYDNMLKAILSTLTEPVGRTGSNGYINV
FT                   IPGFDTYMGNLREIKRIFGLFGIPLTLLADNSDYLDSPNDGTFHMYPGGTPLEVAAQCL
FT                   NAEATFSFQRYTTPKTLEFLAEASGRPTLTARPVGIRGTDEFLMQLSQLTGKPIPAELE
FT                   IERGRAVDAFTDSQAWIHGKRVALYGDPDLVMGLLSLLLELGAEPIHVVVTNSNEEFEA
FT                   EARALLASSPYGQGATVWGGKDLWHLRSLMFTEPVDLLIGNSYGKYLWRDTGTPLVRIG
FT                   YPIFDRHHLHRYPTYGYVGALNLLNWIVNTILDEADRRSIIPGKTDISFDLIR"
FT   gene            434137..435324
FT                   /gene="nifV"
FT                   /locus_tag="CYB_0424"
FT   CDS_pept        434137..435324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifV"
FT                   /locus_tag="CYB_0424"
FT                   /product="homocitrate synthase 1"
FT                   /EC_number="2.3.3.14"
FT                   /note="identified by similarity to SP:Q44290; match to
FT                   protein family HMM PF00682; match to protein family HMM
FT                   TIGR02660"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01420"
FT                   /db_xref="GOA:Q2JP75"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP75"
FT                   /protein_id="ABD01420.1"
FT                   /translation="MNSSITINDTTLRDGEQAAGVAFQIPEKISIAALLDAIGVPEIEV
FT                   GIPAMGAVETEAIRAMLSLGLRAHLLGWNRAVPSDILASIRCGLKRIHISVPVSDRQIA
FT                   AKFQGDRPRLLRQLRQCVEMALEQGLWVSVGAEDASRTPLEQVIELAQMAQSWGCRRFR
FT                   YCDTVGVLDPFSTYKQIRRLVRAIDIPVEMHTHDDLGMATANALAGIRAGAQSVNTTVN
FT                   GLGERAGNAPLEEVVMALRCTLGIDVGVDTRRLRELSQQVARASGAPLPPWKAIVGDNA
FT                   FAHESGIHAAGVLRDPQTYEPFPPEAVGSQRRLVLGKHSGRHLLLQILKEQGIPVEQIP
FT                   PGQLEKLLEQVRQHVTHCKHPIPPAELARYCRATLTQWAQHTPEPIPEESHPDVV"
FT   gene            435314..435463
FT                   /locus_tag="CYB_0425"
FT   CDS_pept        435314..435463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP74"
FT                   /protein_id="ABD01421.1"
FT                   /translation="MLSNRLSGKETSKSQAILAAVSRRARQVGRSLTRQELCQVLAEIT
FT                   GGTP"
FT   gene            435460..435723
FT                   /gene="nifZ"
FT                   /locus_tag="CYB_0426"
FT   CDS_pept        435460..435723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifZ"
FT                   /locus_tag="CYB_0426"
FT                   /product="NifZ protein"
FT                   /note="identified by match to protein family HMM PF04319"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01422"
FT                   /db_xref="GOA:Q2JP73"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP73"
FT                   /protein_id="ABD01422.1"
FT                   /translation="MSDELELDRPPQFELGDKVRIRKVIRNDGTFFGQPVGKILAVPGD
FT                   EGYVISIGTFLQRFYVYAVHCLAKGLVVGCRAQELELVEKGL"
FT   gene            435720..435920
FT                   /locus_tag="CYB_0427"
FT   CDS_pept        435720..435920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0427"
FT                   /product="NifT/FixU family protein"
FT                   /note="identified by match to protein family HMM PF06988"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01423"
FT                   /db_xref="GOA:Q2JP72"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP72"
FT                   /protein_id="ABD01423.1"
FT                   /translation="MKVILHESAYGHLMVYVPKKDLEESVVATRSEAGETIFTLSNGWE
FT                   LSIPELPEPLSLPKTVEAKRL"
FT   gene            436073..437302
FT                   /locus_tag="CYB_0428"
FT   CDS_pept        436073..437302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0428"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01424"
FT                   /db_xref="GOA:Q2JP71"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP71"
FT                   /protein_id="ABD01424.1"
FT                   /translation="MGRWLFILQGLLVLLCLGTVYSWSIFRKPLETELGIGASESLLPY
FT                   TVALVFYATLMPITGFVIPRWGSRRVLALGGSLVGLGYGLASFAPSIGWITLCYGVIAG
FT                   SGVGVAYGVPMAVAARWFPDCKGLAVGSTIVGFGLSPLLTAPLANCLIEALGARPTLLI
FT                   LGILFAAVILGIATQLRFPPPDWIPSSPFPRKSTNGPDRSPLTSRRSLPLLRNPSFYGL
FT                   WICYAIGTLIGLSAIGISGPVGEELIGLDPPAAANSVALFAIFNGLSRPLFGWLADRLH
FT                   PHQVTTGSYGLILLACGLMLLPPQGSLLAYWVTFSLLWFCLGGWLAMAPALTLRLFDPE
FT                   RYAQNYGIVFTAYGVGALVGTMIAGQIRDRLGSYSYTFYGMAALAVVGIWVANAFLKEK
FT                   RKLTRQGSHK"
FT   gene            437444..437527
FT                   /locus_tag="CYB_0429"
FT   tRNA            437444..437527
FT                   /locus_tag="CYB_0429"
FT                   /product="tRNA-Leu"
FT   gene            complement(437528..439684)
FT                   /locus_tag="CYB_0430"
FT   CDS_pept        complement(437528..439684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0430"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01425"
FT                   /db_xref="GOA:Q2JP70"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP70"
FT                   /protein_id="ABD01425.1"
FT                   /translation="MALNPALPSHLLSSAFLLEDWEQGHYERVTQVLQQQLEQGSPSPE
FT                   LYWELGAAYLLLGRELEAQLVWQEGLAMLQAGGVAESEAVYHLLRSLQALAESLWEKGH
FT                   WPQAAALYRQLLELGDGQLELSSGQALAAHRIGLTQERSRLWAAAAEWFERACQQDPTA
FT                   AESFWRWGLALMKLGRLREAISPLQEAARLRPEWGDPWVQMGLAWLDLQDPVQAVGCFQ
FT                   AAEARGTGTAQLYSYWAEAEVRLAHPEAAWEKVCRAVAAERNWVQAWCEGSGGESPLRS
FT                   GLEQACRGEGSARIPDFLYSAWRQRWAPEGVAPPADSFSQSTPPTTDFWPVPTQGYLTT
FT                   RQWHQATGEGDYQLLDPGGVLCLKAPPAADPAILQKLRPQRIPLAETFVAQIPRGSVHV
FT                   GHYPRHLYASFASGVLTRRGELLADLSLSLPPPEFLDWDYRPDHLRHHPLLGLPHLPPP
FT                   IPLDGPVALLPLGAVNYFHWMVDILPALDILQRSGALEKDIPILIHGYQRKPFQVQSLA
FT                   ALGIPAERILSFEQLGGSHLQAQNLIVPSAGAPVGCLTPRGLEVLRQLAQPSLSIDPLQ
FT                   PRRIYISRRSARWRRVINEAEVLACLRPWGFVPVQMETLSLPEQIALMQGAEAVIGIHG
FT                   AGLTNLAFCPPGTTVIEILPSNAVLPYFWSIAQVAGLRYFPLVAPVCDPALVALLSSPD
FT                   LDREDAWVRIPDLLNVLEQTGIRG"
FT   gene            439914..442607
FT                   /locus_tag="CYB_0431"
FT   CDS_pept        439914..442607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0431"
FT                   /product="putative phycobilisome 120 kDa linker
FT                   polypeptide, core"
FT                   /note="identified by match to protein family HMM PF00427;
FT                   match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01426"
FT                   /db_xref="GOA:Q2JP69"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP69"
FT                   /protein_id="ABD01426.1"
FT                   /translation="MGINVSAGAVVSNPRLYQTVPVSTISQAEQQDRYLGRTELDRLED
FT                   FFSSGLKRLEIAEVIAANSEIIVSRAANRIFTGGSPMAYLERPEATQDEKEAFKLGTAF
FT                   YVESTGGFIEAIRNIFSASGVEIPPNFRPINISRYGAANMRKSLRDLSWFLRYVTYALV
FT                   AGDPSIIAVNTRGLREIIENACSAEATIVAIQEMKRAAAGYFRKDAEAVAIINQYFDVL
FT                   LSEFIAPAPSDKLRQRNASTADGIPLQGLQLPQIYNLAAEKVPVFAMKPGLSNAEKEEV
FT                   IKAAYRQVFERDIRRAYGLKLSDLESKVKNGEISMKEFIRRLGKSELYRKQFYEPYINS
FT                   RVVELAFRHFLGRAPETREEVQTYFSIISSKGLAGLVDALVDSREYGDYFGEETVPYLR
FT                   KLGVEAQTSANWGAKFDLYNYAAPRRKVPQFITLFARYNRPLPDQHAYGSGNDPLEIQF
FT                   GAIFPKETRSLSARPAPFNKDVKRILIRRGFALTNERTNPRAAGDPGSLGPKVFKLTQT
FT                   PGDRSRRLGVRAGIVGSEVSTQAVIRACYQQVYGYMPYEGQRLTRWEIKLESGEIPVKE
FT                   FIRQLAKSDLFRNKYWSSLYVCKAIEFIHRKLLGRPTYGRQEMNRLFDIASKQGFYAVV
FT                   DAILDGEEYQQVFGEDIVPYERYLTPGGLALRRMRPGSTDMAVTKPIRTDDDIPLFVKL
FT                   GQPRDMPSGELEIQRRAQQGVPKVRQEIPVFKLTSLANKAEVNNLIRAAYRQVFERDMD
FT                   IYNISAELSSAESKLRNGEITVKEFIEALGCSELYRSEFYAPYPNTKVIELGTKHFLGR
FT                   APLNQQEIRKYNQILATQGVKAFVRALLNTQEYRDLFGEDTVPYRRFPTLPAANFPNTQ
FT                   ELYGRLTKQNRELVVPSFSPVGNDRS"
FT   gene            complement(442670..443806)
FT                   /gene="ruvB"
FT                   /locus_tag="CYB_0432"
FT   CDS_pept        complement(442670..443806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="CYB_0432"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01427"
FT                   /db_xref="GOA:Q2JP68"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP68"
FT                   /protein_id="ABD01427.1"
FT                   /translation="MAIISSRDTGQNAEGPKRRQQKSSAWRKEVRELSFAGERGADPSA
FT                   LLQPQAHPGEAQEESLRPRTLAEYIGQTELKEVLSIAIAAARARQEPLDHLLFYGPPGL
FT                   GKTTVAAVLAAEMGSQFYMTTAPALESPRDIAGYLVRLKRGDVLFIDEIHRLPKVTEEL
FT                   LYPAMEDFRLDITIGKGRSARITSLPLERFTLIGATTRIGALTSPLRDRFGHVQRLRFY
FT                   EPHELVQIVLRTARLLNVSTDPEGAAEIARRSRGTPRIANRLFKRVRDYAQVRGDGHIS
FT                   QEVAAAALELFQVDPMGLDWIDRKLLTVLVEQFGGGPVGLETMAAVTGEDPQTIEEVYE
FT                   PYLLQIGYLQRTPRGRVVTPAALRHLGYEAQSPLPLWS"
FT   gene            complement(443947..445011)
FT                   /gene="psbA-3"
FT                   /locus_tag="CYB_0433"
FT   CDS_pept        complement(443947..445011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA-3"
FT                   /locus_tag="CYB_0433"
FT                   /product="photosystem II protein D1"
FT                   /note="identified by match to protein family HMM PF00124;
FT                   match to protein family HMM TIGR01151"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01428"
FT                   /db_xref="GOA:Q2JP67"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP67"
FT                   /protein_id="ABD01428.1"
FT                   /translation="MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTAT
FT                   TCFIIAFIGAPPVDIDGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDE
FT                   WLYNGGPYQLIVLHFLIGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPI
FT                   GQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSS
FT                   LIRETSEEESQNLGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVI
FT                   GIWFTALGISIMAFNLNGFNFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFP
FT                   LDLAAVEVAPAVRG"
FT   gene            445110..445817
FT                   /locus_tag="CYB_0434"
FT   CDS_pept        445110..445817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0434"
FT                   /product="glycoprotease family protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01429"
FT                   /db_xref="GOA:Q2JP66"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP66"
FT                   /protein_id="ABD01429.1"
FT                   /translation="MSLVRWILGIHTTTPVLGLALLPLEPGLGETRSQSWWLDREMAAQ
FT                   LHPCLKVFLAGQAWSQIAGIAVALGPGSFTGSRLGVSVARLLGQQLGIPVFGYSALAVL
FT                   ARQVWQEQGSPPQPLTVAVQMDAKRGERYGGVYRVTEEGVAAEVADRLWEEEAWQATLR
FT                   QWPQALSVNAADFVDSAPVVALAELARADFRAGLRPQWQEVLPLYGRQPPIDLRGLNRT
FT                   PPPQRERSAPSSR"
FT   gene            445854..446411
FT                   /gene="efp"
FT                   /locus_tag="CYB_0435"
FT   CDS_pept        445854..446411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="CYB_0435"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01430"
FT                   /db_xref="GOA:Q2JP65"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP65"
FT                   /protein_id="ABD01430.1"
FT                   /translation="MISSNDLRPGVSVEIDGAPYKVIEFLHVKPGKGAAFVRTKLKNMQ
FT                   TGNVVEKTFRAGETLPAATIEKVEMQYLYAEGNNLVFMDMETYEQAPITAAQIGSAVKY
FT                   LKENMQVSILRWNGQVIDVELPNTVVLEVVETDPGVKGDTATGGTKPAKLETGAEIQVP
FT                   LFIKVGERIRVDTRTDTYLGRE"
FT   gene            446481..446954
FT                   /gene="accB"
FT                   /locus_tag="CYB_0436"
FT   CDS_pept        446481..446954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="CYB_0436"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01431"
FT                   /db_xref="GOA:Q2JP64"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP64"
FT                   /protein_id="ABD01431.1"
FT                   /translation="MDVVNWQEIRLLLAALQESDVTELTLEFKDFRLTLRKGIPTELSS
FT                   TPASPVIVSSAPPPAPAEAPPPPTAPKSTPSHWIDVTSPMVGTFYSAPAPGEPDFVRVG
FT                   QRVNKGQTLCIIEAMKLMNEIEAEAAGVVTEILVSNGQSVEFGQVLMRLDPTA"
FT   gene            447349..448278
FT                   /locus_tag="CYB_0437"
FT   CDS_pept        447349..448278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0437"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01432"
FT                   /db_xref="GOA:Q2JP63"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP63"
FT                   /protein_id="ABD01432.1"
FT                   /translation="MATQRICFAQVSDVHLMPETGCRCWWMSDSPRRQLEAAVAHLNQV
FT                   PDLHFVVFTGDLVDQADPESFQSFQEIVAQLRVPYYLSLGNHDIDTLRRKGRFNRDQFI
FT                   RWCQSQFPLSLAPTGYVDYSLSPLPGIRLIALDASLGRFPLPQGVLRPSQLHWLGEHLQ
FT                   TVPEEWLILLIHQPPFIAPTQMDAVLFRKYRLLSEPASALHALLARHGRVVAVLSGHLH
FT                   VPKVYVRDGIPYLTAPPLVGPVSALRVFELEVNPRRGVLRYHWVKLPALDPSPLWHGLV
FT                   MGIRRDRWGQIPLRAKGSRSLPLPAAAW"
FT   gene            448355..449101
FT                   /gene="cysH"
FT                   /locus_tag="CYB_0438"
FT   CDS_pept        448355..449101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="CYB_0438"
FT                   /product="phosophoadenylyl-sulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="identified by match to protein family HMM PF01507;
FT                   match to protein family HMM TIGR00434"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01433"
FT                   /db_xref="GOA:Q2JP62"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP62"
FT                   /protein_id="ABD01433.1"
FT                   /translation="MTASLSPSSRWELAAQALREQYQPQVASLSERFEPLSASDLLTWA
FT                   VEEFGDGLVLACSFGPEDLVLIDLLTAINPRVRAFFLDTDFHFPETLQLREQVLARYPH
FT                   LQLQIFKPLLTPEEQAAQYGPELYRSNPDLCCNIRKVEPLNRALAGCTTWITGMRREQS
FT                   PTRADIGKVQWDGKRNRLKLNPLADWTNGQVWKYILDHGIPYNPLHDRHYPSIGCLHCT
FT                   APVEPGADPRSGRWKGTSKTECGLHT"
FT   gene            449105..449419
FT                   /locus_tag="CYB_0439"
FT   CDS_pept        449105..449419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0439"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01434"
FT                   /db_xref="GOA:Q2JP61"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP61"
FT                   /protein_id="ABD01434.1"
FT                   /translation="MTASSILEVAQFEITPGSEAAFEAAIAQAFIYLQQTDGYQGHQLQ
FT                   RCLEHPQQYLLLVQWGSLEAHLVNFRQSENFVRWRALIEPYFARPPQVLHYQLLTGSPF
FT                   "
FT   gene            449535..449606
FT                   /locus_tag="CYB_0440"
FT   tRNA            449535..449606
FT                   /locus_tag="CYB_0440"
FT                   /product="tRNA-Val"
FT   gene            complement(449717..450658)
FT                   /locus_tag="CYB_0441"
FT   CDS_pept        complement(449717..450658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0441"
FT                   /product="phosphoribulokinase/uridine kinase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01435"
FT                   /db_xref="GOA:Q2JP60"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP60"
FT                   /protein_id="ABD01435.1"
FT                   /translation="MAQRPIILGIVGDSAAGKTTLTRGIAQVLGEENVTVICTDDYHRY
FT                   DRKQRAELGITALHPDCNYLDIVQQHLTLLRTGQPILKPVYNHSTGTFDPPEYVKPNKY
FT                   VIVEGLLGYFTRGMRDSYDVKVYLAPPEHLRALWKIKRDTRKRGYTEEQVREELKKREP
FT                   DSEAFIRPQRQWADVVVTFYPPQEGSDQDEVLLNARLVLRPTIPHPDFWQILNARDNHL
FT                   SSAIRLDLDRDMGKPVDVLQIDAHATASQVIELERMLCNEIPYLGKFCSLEGNPNIGQL
FT                   IGTTGELLQSYPLALTQLLITYHMLKAAHIYQ"
FT   gene            450944..451711
FT                   /locus_tag="CYB_0442"
FT   CDS_pept        450944..451711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0442"
FT                   /product="pspA/IM30 family protein"
FT                   /note="identified by match to protein family HMM PF04012"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01436"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP59"
FT                   /protein_id="ABD01436.1"
FT                   /translation="MGLFDRVSRIIRSNINALVSSAEDPEKILNQTIQDMSEDHYQMRQ
FT                   AVAQAIAAQKRIERQYEQAQQSVDEWQRRAELALRNNNEALAREALVRKKTFAETAQSL
FT                   KRQLDEQTKQVEILKSNMTKLESKIAEAKTKKDMLIARARAAKASQQINQVIGRVDATS
FT                   AFAAFERMEEKVNSLEAQSAAVAELAVDNLENQFAALEAGGSDVDHELLMLKASIQGQL
FT                   PSGGSKSSGQPSTASESEVDLELENLRKEIDQL"
FT   gene            451961..452425
FT                   /locus_tag="CYB_0443"
FT   CDS_pept        451961..452425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0443"
FT                   /product="pentapeptide repeat family protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01437"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP58"
FT                   /protein_id="ABD01437.1"
FT                   /translation="MTTASIKPLLDAKQLLQAYASGQRDFSGSNLSGAQLSGANLKGII
FT                   LRDADLSGADLREADLSGADLSGADLRGAKLRRVNLIGAKLVKADLRGANLYRAKLLRA
FT                   DLSEAELNRADLRIGADLRGAIITNTHFRGALYDEYTKFPDGFNPTEMGM"
FT   gene            complement(452438..453265)
FT                   /gene="cysQ"
FT                   /locus_tag="CYB_0444"
FT   CDS_pept        complement(452438..453265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="CYB_0444"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01438"
FT                   /db_xref="GOA:Q2JP57"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP57"
FT                   /protein_id="ABD01438.1"
FT                   /translation="MQAQDLAALLPEVCRLAEAAGQAILPFYRQKSLPIQLKADASPLT
FT                   EADLAAHHLILQGLQELTPGIPLLSEESSDIPYAQRQVWRHFWLVDPLDGTREFIEGSG
FT                   QFTVNIALVEVGIPILGVVHAPALGLTYAAAQKLGACKRERTPSCVHEQPIRTCPYAQE
FT                   PLQVVASRSHSNPETEQFLERLRQRCGSLEVKSVGSALKLCLVAEGSAHLYPRFGPTME
FT                   WDTAAAQCIVEQAGGRVTDLVGDPLRYNKPDLHNPPFVAAAEGMAQLWQNLIP"
FT   gene            complement(453281..454042)
FT                   /gene="hisF"
FT                   /locus_tag="CYB_0445"
FT   CDS_pept        complement(453281..454042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="CYB_0445"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01439"
FT                   /db_xref="GOA:Q2JP56"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP56"
FT                   /protein_id="ABD01439.1"
FT                   /translation="MLAKRIIPCLDVAAGRVVKGIQFVQLRDAGDPVELAQAYDQAGAD
FT                   ELVFLDITATHEEREILLEVVRRTAEQVFIPLTVGGGIRDLEGIRQLLRAGADKVSLNS
FT                   AAVRDPDLVAQASRWFGSQCIVVAIDARAKPQGGGWEVYVRGGRQPTGLDAVEWAKSVA
FT                   ERGAGEILLTSMDADGTQAGYDLELTRRVVDAVSVPVIASGGAGACAHIRQALQEAGAE
FT                   AALLASLLHYGQLTIAQIKADLAAHGIPVRF"
FT   gene            complement(454104..455207)
FT                   /locus_tag="CYB_0446"
FT   CDS_pept        complement(454104..455207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01440"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP55"
FT                   /protein_id="ABD01440.1"
FT                   /translation="MSQILTFLGKGGTGRSTLAVAAARAAAQQGRRVLLVGHQAGPGLE
FT                   MLLGGIPLSGEPVTIAANLSVVQLRTTQLLEQFWTAAKELEARYVRTPFFREIYGQELG
FT                   VLPGMDQALALEALRRYDASGQYDCILYDGPGDLTTLRAFGIPEVASWYWRRASQAFLG
FT                   SDLAKTLRPFAEPLLRSVSTVEFSSLEDLPERLGGMTNLLEQGRQAIANPRRVLAHLVT
FT                   TPDPMAVQTARYLWGSAQMVGLTVGGLWVTPLAPGEVSAADFFPLTLRTLPLRQGSDWS
FT                   ALEAAVGGMFAVPDVPPPVAIDEGSRTVKLFIPGFSKAQIELSQSGPELTITAGDQRRN
FT                   LFLPPSLAGRQVTGAKFQEPFLVISFG"
FT   gene            complement(455204..455479)
FT                   /locus_tag="CYB_0447"
FT   CDS_pept        complement(455204..455479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01441"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP54"
FT                   /protein_id="ABD01441.1"
FT                   /translation="MPDYKALAHLLIEPLLSSASLQMDVETTCGGRKVWLRLAFDPKDR
FT                   GRVFGRGGRTLQAIRQVMMAAAQLAGQSLYIDIYGEAGERNREERE"
FT   gene            complement(455532..456011)
FT                   /gene="rpsP"
FT                   /locus_tag="CYB_0448"
FT   CDS_pept        complement(455532..456011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="CYB_0448"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01442"
FT                   /db_xref="GOA:Q2JP53"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP53"
FT                   /protein_id="ABD01442.1"
FT                   /translation="MVKLRLKRYGKKRQPSYRIIAIESKSRREARPLEELGYYNPRTKE
FT                   TVLQTAGLLKWLRCGAQPTETVDSLLKKAGIYEMLKAGEGGVVASIRIPAMAKPEAGIP
FT                   EAAEEAPATESVAEAEVADVPESELSEAATETAAAELSPPEAEVEKPQVEEAVEA"
FT   gene            456261..456707
FT                   /locus_tag="CYB_0449"
FT   CDS_pept        456261..456707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD75898.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01443"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP52"
FT                   /protein_id="ABD01443.1"
FT                   /translation="MINYADLTDEQRQLYLKALIAVARVDGQLDEEETSFFMQIAEGVG
FT                   IEAPLAQTYLADETGAPLDISGIPPMRNAAGALILRDLAAMAVVNSQLVEKEEELIFQI
FT                   GKAMQFSAEEINEFIDWAFMGLQWQLKSASLLERYAQPSPQPSE"
FT   gene            complement(456830..457225)
FT                   /locus_tag="CYB_0450"
FT   CDS_pept        complement(456830..457225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0450"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AE2150; match to
FT                   protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01444"
FT                   /db_xref="GOA:Q2JP51"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP51"
FT                   /protein_id="ABD01444.1"
FT                   /translation="MSDPVPPLRSHSVPPLPSEPDWEEEWELALEKPPLSGRAQPHHHD
FT                   PQSRRKLTNRLARIEGHVRGIRSMIEQDQPCPDVLLQIAAVKGALDRVARLILDDHIRH
FT                   CIRHAIETGNIEVELEELQRALDRFIS"
FT   gene            457349..458311
FT                   /gene="sds"
FT                   /locus_tag="CYB_0451"
FT   CDS_pept        457349..458311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sds"
FT                   /locus_tag="CYB_0451"
FT                   /product="solanesyl diphosphate synthase"
FT                   /note="identified by match to protein family HMM PF00348;
FT                   match to protein family HMM TIGR02749"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01445"
FT                   /db_xref="GOA:Q2JP50"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP50"
FT                   /protein_id="ABD01445.1"
FT                   /translation="MLSPFGPVEADLERLRQNLTRLVSAKHPILAMAAEHLFSAGGKGI
FT                   RPAIVLLIARATTPDGEITPRHWRLAEITEMIHTASLVHDDVIDAADVRRGIDTVNTLF
FT                   DNRIAVLAGDYLFGQAAWYLANLDNLEVVKLLSKVIMDLPEGEVRQSLTRFDPDVSMED
FT                   YLAKSFYKTASLMSGSSKAAGLLSGVSEEVADRLFDFGRDLGIAFQIVDDLLDFTASAE
FT                   TLGKPVGSDLIQGNLTAPVLFALEEFPQMRELILRELSNPQDLKQALEWVYQSEGIPRS
FT                   RQLARDYAQRAAEALYSLPDSAARRALFQMVDYVLERLH"
FT   gene            complement(458340..459143)
FT                   /gene="lepB"
FT                   /locus_tag="CYB_0452"
FT   CDS_pept        complement(458340..459143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="CYB_0452"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01446"
FT                   /db_xref="GOA:Q2JP49"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP49"
FT                   /protein_id="ABD01446.1"
FT                   /translation="MLLPAIRLSGRGLMGGPPILLPWIGCGNLEIVKSCSLASMPSKDP
FT                   TPLPKPQSPSGETPASSGSRSWWQAQRENLLTVVLALLLAFGIRTFVAEARWIPSDSML
FT                   PTLEEGDRLVVEKVSYRFGSPRRGDIIVFNPPAKLNFDGAYIKRVIGLPGDRIRIANGE
FT                   VIINGIPLREDYIYAPPDYSCPGERCPGVPNQGSEFVVPPRSYFVMGDNRNDSQDSHVW
FT                   GFLPEENIIGNTIFRFWPPNRLHFFAPPEYPELLPEAQVLGNTAR"
FT   gene            459188..459544
FT                   /locus_tag="CYB_0453"
FT   CDS_pept        459188..459544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01447"
FT                   /db_xref="GOA:Q2JP48"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP48"
FT                   /protein_id="ABD01447.1"
FT                   /translation="MTISTEERLERVERLVEANSQAIARLTQQQEEVLRRIDRLSGDSE
FT                   KLSERVEKLSGDVEKLSGDVEKLSGDVEKLTFKFDTSQTIGERLERLATSLIAGATISI
FT                   IAGVILVLLREGSR"
FT   gene            complement(459576..460622)
FT                   /locus_tag="CYB_0454"
FT   CDS_pept        complement(459576..460622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0454"
FT                   /product="general secretory pathway protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01448"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP47"
FT                   /protein_id="ABD01448.1"
FT                   /translation="MTDPDASLAVGQHSIVDRARVPALIAQYLPVEICIYYQVVPLALD
FT                   TDSLILGMVDPQDLAALDYVSKMLTYSQISVQPIPLTAQQQQDLIAYYFSHPPDPAEVE
FT                   RLRLQAQANRVTREVPAPVSGPPTQLRPTQPPSVPADESEETVQQLLNSMLRRALDEKA
FT                   EQIFVEPQEGPSCRVRYRQQGILRDLFKDLSESIRAKLITAMKRMMALDPELIGEPQQA
FT                   EVERMYRGEPLVLQLRIIPQRSKSGQTAASREGAILSILRGEALQKYQQGQNNLRVSET
FT                   LALAQQTYQLLQQLQSALSNTVDKLKQYPSPPRSDWPLMTEVLAAIQAQAQMIAIHQQD
FT                   WEKLNSGS"
FT   gene            460791..461510
FT                   /gene="pdxJ"
FT                   /locus_tag="CYB_0455"
FT   CDS_pept        460791..461510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="CYB_0455"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="identified by match to protein family HMM PF03740;
FT                   match to protein family HMM TIGR00559"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01449"
FT                   /db_xref="GOA:Q2JP46"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP46"
FT                   /protein_id="ABD01449.1"
FT                   /translation="MLSLGVNIDHIATLRQARRTVEPDPVAAAVIAELAGADGITVHLR
FT                   EDRRHIQDRDVRLLRQTVRTHLNLEMAATEEMVAIALEVKPDYVTLVPERREEITTEGG
FT                   LDVAGQVSRLRDVVGQLQGSGIPVSLFIDPDPTQIAAAAQVGARWVELHTGRYAEASSA
FT                   AQRQVELDHLEKASQQALQLGLRVNAGHGLTYWNVGPVARIPGMEELNIGHSIISRAVL
FT                   VGLDRAVREMRQAMGLS"
FT   gene            461525..462157
FT                   /locus_tag="CYB_0456"
FT   CDS_pept        461525..462157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC09840.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01450"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP45"
FT                   /protein_id="ABD01450.1"
FT                   /translation="MNSEYYGYENYVLDQAEIERLLDLLPASMRESVKILPASERQTVV
FT                   IKGRRQMPWERQMRLFIKPYEWRQFTPLQRAGLFLHKVGYYSRAVSRQIDFYLAIAALG
FT                   GLSLIFEAVQQDPVGATVSGGLSGLALWQLRRDQTNDRRLLAADAYAVDRLVLRGIPRL
FT                   QAVEALGQALHVEARLEGRSGNDLLDMLRYQNLKRLAQRPAEDIVLS"
FT   gene            462170..463003
FT                   /locus_tag="CYB_0457"
FT   CDS_pept        462170..463003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0457"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by similarity to SP:P06709; match to
FT                   protein family HMM PF03099; match to protein family HMM
FT                   TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01451"
FT                   /db_xref="GOA:Q2JP44"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP44"
FT                   /protein_id="ABD01451.1"
FT                   /translation="MLSPSRLGSQAGRWGRHLLQVAVTDSTNRLLLDWGRRFPQPLPVG
FT                   TVLVSTRQRAGQGQHGRVWHSQPGGLYLSVWLGSPPLHYSLLELTLALGWGIAGRLRQN
FT                   LGIPLRLKWPNDLVVVDEQRPDSLLKLGGILVQSRFGGSGQLLGLVAGVGVNVNNPVPI
FT                   GAITLAQILGSPLHRSLDCTEIAGWVLQGMEQGFHVWLQGGFAPVRSEYEAWMVRPQIQ
FT                   FQWPETSPTILGLAEDGRMRVQTRGERHWQQQPSILTLTPDQVRLSYHMPAGDSL"
FT   gene            463030..463950
FT                   /locus_tag="CYB_0458"
FT   CDS_pept        463030..463950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0458"
FT                   /product="peptidase, M23B family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01452"
FT                   /db_xref="GOA:Q2JP43"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP43"
FT                   /protein_id="ABD01452.1"
FT                   /translation="MLNSVMKLLVMAARLFSPRARRLRFWLKLGLALLWFYPTALLAQT
FT                   QPTPLPPPPVVEPALDTPGAAALLLDGAIPLREGSPATLEAETRTETVMGREIVIEPQK
FT                   NHDRVPHAQPESGVPVVLMERSSGRRIILAPGQEIRIEDPSQPQAPEPGTPTLPELAVG
FT                   EERLLYPLPHPVPITSGFGMRIHPIRGEPEFHAGVDLGASMGTPILASLSGKVVTSGSL
FT                   GGLGITVVLEHAGGRRTRYGHMSEVAVTPGEVVERGSVIGYVGATGAVTGPHLHFELWK
FT                   RAVGQGWVVLDATDDLKVAVAQLPG"
FT   gene            464034..464114
FT                   /locus_tag="CYB_0459"
FT   tRNA            464034..464114
FT                   /locus_tag="CYB_0459"
FT                   /product="tRNA-Leu"
FT   gene            complement(464348..465361)
FT                   /locus_tag="CYB_0460"
FT   CDS_pept        complement(464348..465361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0460"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01453"
FT                   /db_xref="GOA:Q2JP42"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP42"
FT                   /protein_id="ABD01453.1"
FT                   /translation="MQVASRAVGGTAPLAPRLLALVPGGIGDQILFFPTLASLRQRFPE
FT                   AELEVVVEPRAAAAYEVCPSVSRVLTFPFKEQLSLGDLSDLLGRIRERQYDGVLSLGRS
FT                   LGVKLLLWLTGIPKRVGYAPPGPGRPWLTDPVPLKPAQYAAQMYHDLVQGFGIAAPAGL
FT                   PQIRLKKADLEWAEQERKRLLGDAAQDYVLLHPGASQLSQEKGIQKIYPSANWVKVIKG
FT                   FREQRPELPLVLVVGPEDEQLAEGFLAQLPELPVSRPVRLGQLAALIGGATLLLCADSA
FT                   PMHLAVAVQTPLVALFGPTDPLRLLPSEGPFRAVKGADGKVESIAPEQILQVIFPA"
FT   gene            465556..466713
FT                   /locus_tag="CYB_0461"
FT   CDS_pept        465556..466713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0461"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01454"
FT                   /db_xref="GOA:Q2JP41"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP41"
FT                   /protein_id="ABD01454.1"
FT                   /translation="MTEEPIPLLDLTGQYRALAGLLQPQVEALLASGQYIGGAAVQRFE
FT                   EQFAQFLGGGSLEAVGCNSGTDALVLALQALGIQAGDEVLTSAFSFFASAAAISRVGAR
FT                   PVFVDVDPCTFNLDPQLLERSISCRTKAVVVVHLFGQAANMTQILAIARRHGLAVVEDC
FT                   AQAVGACWGGRPVGTWGEVGCFSFFPSKNLGAAGDGGAVVTRDPQLARRVRALREHGQT
FT                   RPYHHEHLGLNSRLDALQAVILSVKLPHLREWNWRRQGIAECYHRLLQGIPGLMLPQVG
FT                   VGGNSVWHQYTVRVVGSEPLDSRRRDDLQQGLKERGIGSRVYYPLPLPLQPVYRGLGYR
FT                   RGDLPNAELCAAQVLSLPCFPELTTCQQERVAAAIAEILSEKTCP"
FT   gene            466819..468018
FT                   /locus_tag="CYB_0462"
FT   CDS_pept        466819..468018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD78920.1; match to
FT                   protein family HMM PF01882"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01455"
FT                   /db_xref="GOA:Q2JP40"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP40"
FT                   /protein_id="ABD01455.1"
FT                   /translation="MLWKLSRKLVPLLQQTGSLGIFSSEQESRRQVRFLRRFRFTRIGG
FT                   RFVGIALLVSIAAFNTGNNPLYLLLGMLLSLILISGTLSDITLKDLEVSRQLPSRIFAG
FT                   QPVLVGLTLVNRKRRLPSFSLQVSERIEGLRREDWPSSYVLRVDPGAKVDTFYQQTFSR
FT                   RGAWQLQGFEVATSFPFELFRKAVAIRDPQTVIVFPRLAPVQGLALWDQLSSGNQLRPQ
FT                   PGREGDYLSLRPYRPQDDVRSVHWKISAKRDQLIVRELERPRAQAITLCFENRWQPQKE
FT                   RPEIHRDKLERAVERCAGILFYLMREGYPVALVTLQERTPFGSDLAHQDHLLTVLARLT
FT                   FVGDPQLSPPLEREPDPSVKFDLTPQDRCVLLAHPDQDGKSAPAHLIHTGSLLQFIPIE
FT                   "
FT   gene            complement(468123..469082)
FT                   /locus_tag="CYB_0463"
FT   CDS_pept        complement(468123..469082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0463"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01456"
FT                   /db_xref="GOA:Q2JP39"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP39"
FT                   /protein_id="ABD01456.1"
FT                   /translation="MGKKLGLALGSGGARGWAHIGVIRALERAGISVDYIAGTSIGAFV
FT                   GAIYAAGELDELEDFVRDLNWKMILSLFDVVFPTCGLLDGNKIYELLTEHLQELCIEEA
FT                   GIPFCCVATDLITGQEVLLRSGKMADAVRASISIPGIFTPFYYEGRYLGDGGIVNPVPV
FT                   RVVREMGADVVIAVNLNHVDPADVESQLEETEVEETLQRRQRLNAEGEVIEEETNFITR
FT                   IRKRYQSLQQGIQEKISQWFPDEPSGPNIFDVIGKTLNVMEQIVTRSVLAEHPPDLPLQ
FT                   PKLSQYGIFDFHQADPIIQEGYRQMRRAIPELRQKLEQ"
FT   gene            complement(469147..469785)
FT                   /locus_tag="CYB_0464"
FT   CDS_pept        complement(469147..469785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0464"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01457"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP38"
FT                   /protein_id="ABD01457.1"
FT                   /translation="MSLRLYLLRHGETPYSRSGSFCGALDPDLTPEGKQMAEAFAAAYA
FT                   GIPWQALYVSPMRRALATLSPLAEKVGLEMQIREGLREIHYGEWEGKTHAEAQEAYPEA
FT                   YWRWMTEPAWNAPPGGETAVQIANRAMPVVAEIQEKWTGGHVLIVSHKATIRVILCSLL
FT                   GIDLGRYRDRIEVLAASVSVVKFDRYGPLLEILGERSYLPSDLRERAGT"
FT   gene            complement(469831..470799)
FT                   /locus_tag="CYB_0465"
FT   CDS_pept        complement(469831..470799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0465"
FT                   /product="NAD(+)/NADH kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01458"
FT                   /db_xref="GOA:Q2JP37"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP37"
FT                   /protein_id="ABD01458.1"
FT                   /translation="MDLGLVVIAYKEGDRESKAACQRCAEQLRRRGVTVLTAPTGLHHN
FT                   PYPVFLEATSDPIDLAVVLGGDGSVLAAARYLAPHGIPILPIKAGGRLGFLAQSERVLQ
FT                   QDPWDRIQAGDFFLQARMMLQAQIWEQPQLGQGDPLAARGEGKSQGRPVSEVYYALNEI
FT                   CLKPINRERLPAAIMEIEVNGEILDQYHGDGVLVATPTGSTSYTLAANGPILEPTLDAI
FT                   IITPICPLSLSSRPIVISGTARVDIWPLADPEGLTRLWTDGVLAQSVNPGQWVHIQQAP
FT                   TPAKLMILEKELSYFRTLREKLQWAGSRIYIPTTNHRPEGG"
FT   gene            471169..473409
FT                   /locus_tag="CYB_0466"
FT   CDS_pept        471169..473409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0466"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by similarity to SP:P54736; match to
FT                   protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01459"
FT                   /db_xref="GOA:Q2JP36"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP36"
FT                   /protein_id="ABD01459.1"
FT                   /translation="MTADLTNRILGNRYQLIQEIGSGGMGSVFRALDLHNNGQEVAVKI
FT                   LYAPMLLSRGDFQTDLRRRFAEEIRVSTLLGQHPRIVKVLDHGQEGEQAYLVMEYLKGQ
FT                   DLGKLIREKGALPVRQAVRLALQACEGLHFAHTFQAKVEGREIRGVIHRDIKPSNLFIE
FT                   QVFQNGKLIPQLKILDFGVAKTLADHTLSLGTQKGGGFIGTARYASPEQMRGKALDARS
FT                   DIYSFGVVLYEMLTGSMPFQLETDSLHSWIHAHCYESPIEINPKAAPQPIPPPLAAVVM
FT                   DCLKKNPDERPQTMRELGERLLQAYDLTATTQLSSGQASTVILPTGSAKAQRDAPPSSD
FT                   PKPPIQTTRNTGSASGAFEDIRDEDLDLIEDEPVSPPSPGAGIPYYITEREPSSAEASP
FT                   ETPDPSPQSEDETPKTPSTVIPASNALPTVQDPPVARPATPPRTNTPRTRPLPQAAPQT
FT                   VLQPSGSSLKWVLAGGSLGVMALLAAFLLWPRPAVRDTQEQPDRTPTPEPKVEPIRIEP
FT                   IPVKPILGIPTPGSTPTPTPEATPTPTPEVTPAPTPTPTPAPTPTPVPTPTPTPTPTPT
FT                   PAPTPTPTPTPTPTPAPTPTPTPTLTPIPRFTPLVPRTPTPTPTPSPTPTATPAPATPT
FT                   PAAELALSGEWLYEGGSFIWQGSLCKVNVAAGVQETVSIRQEGNQISVSSPSFSERSGQ
FT                   LIGSQLSVSGRIGGSGTPTVAWSGTVSPDGRVIRGRATCGSADFAIKLTRQS"
FT   gene            complement(473993..474109)
FT                   /locus_tag="CYB_0467"
FT   CDS_pept        complement(473993..474109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01460"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP35"
FT                   /protein_id="ABD01460.1"
FT                   /translation="MLLELRRDPCRGFSWAFWPQLRFWQAVEEVEGVQYRLW"
FT   gene            complement(474361..476334)
FT                   /locus_tag="CYB_0468"
FT   CDS_pept        complement(474361..476334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0468"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01461"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP34"
FT                   /protein_id="ABD01461.1"
FT                   /translation="MSDWILTNKLLAGIQAQQAGDLRQAEAIYSEILADFPEHADALHL
FT                   LGTVAQARGDSELAAALIAEAIEQHPEVALYHHNLGVVYESLGQLEEALSCYQQSLKLN
FT                   PHAAGSAFQAGKILVNLRRSEEAIALLNPLLENSDEQTGIPLAQVHLNLAIAYRDQGEH
FT                   AVALDHLEKALALDPQLEQARWFYHLYLPAVYQSEEELNSFRARFVEHLDRLIEETPLE
FT                   TEEQRRTALWASGLGTNHYLQYQGYNDLDLQKKYAQFVQRIVNACYSQWRYLPHQSQPE
FT                   DPIRVGFASASMRACSYSRLSLGWVKYLNANWADGQANFERKFQVFAYHLDPRTDFMTD
FT                   RYRQYADVFRHIPTGLEDAARQILQDQLDILVYLEIGLSPLILQLASLRLAPIQCSTWA
FT                   HPVTSGLSTIDYFLSSDLMEPEDAQEHYSETLIRLPHLGTCFEKPVLPQQKRYREDFGL
FT                   RRNAVVYLACQYLGKYLPQYDYLFAAIAQRVPNAQFVFLALPNAAIARQFRERLTQAFS
FT                   LYGLNVEDHCLILPGLDYQDYLDLNRCADLMLDSYGWSGGITTLEAVAVGLPVITCPGK
FT                   LMRGRHTYAILKRMELDSLIASDLKSYEDLAVKLGSDSEFRYHMAEEVRQRCHLLFEDR
FT                   ECVAALAHFFLTLTKKPDAGRD"
FT   gene            complement(476536..478557)
FT                   /locus_tag="CYB_0469"
FT   CDS_pept        complement(476536..478557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0469"
FT                   /product="methyltransferase, FkbM family"
FT                   /note="identified by match to protein family HMM TIGR01444"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01462"
FT                   /db_xref="GOA:Q2JP33"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP33"
FT                   /protein_id="ABD01462.1"
FT                   /translation="MNPRVLLVWTTPPDYVPPLTLSERQVTLCPKGKVRRQIFDFFSVP
FT                   KSLVECPDKDFDLYEFVQYSDQVEDKEFDLVIVWTSSVDLTSPFNTKKFGCPTVLLAGD
FT                   THHHVLPITHLLTYWATEAFDYIATAYDRQHLHWFAAAGVQRLAWLPFIPACLTSSSWI
FT                   EKKEIRVAFVGNLNFNSYHYRRPKLIMSLKKLGLPLLIKTRVHNPQLIFGSSLISFNCS
FT                   MNGDLNLRNLEVISAGGFLLTDQLSFASGLDELLAPGTYCDTYNSEAQLLEKIRYYLDH
FT                   PQEAIQIARRAYHTFDQHWHPRHRIQNLLDWVFGGELPEPFRYSPRSDVRYFVSTASSA
FT                   WIDTRLGIYEPIQELHRVQERLRVFVGRGCPGVIAADLLDLPRLELYVEEGFGDPCGLL
FT                   QQKGVSERVHEVRGEPSSWPSFDAVVCTAQDLQRLGRPVRANFAFVLAEDHQLLLANAS
FT                   KLTEAAVLTGFDFGKLRLSVRLYPDTVFYERTYLNFPVFLSSQVQTVIDIGAGVGLGSV
FT                   CFRGFCPEAAIHCFEVDPLALHLLQQNALGLGNCFVHPVGLAGQDSCRTCRLWPEDPQA
FT                   EWGVEQVLPFREARAALKELGLEPIDVLRVATGGEEVEVLTSLQEQLKDIKVIYVEFTS
FT                   EQDRKRIDQMLDPSHLLWQGEISQGNYGCLCYLSRAYV"
FT   gene            complement(478587..480641)
FT                   /locus_tag="CYB_0470"
FT   CDS_pept        complement(478587..480641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0470"
FT                   /product="methyltransferase, FkbM family"
FT                   /note="identified by match to protein family HMM TIGR01444"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01463"
FT                   /db_xref="GOA:Q2JP32"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP32"
FT                   /protein_id="ABD01463.1"
FT                   /translation="MQDIKANAPRILLNWPTPPDYIPPPQLSDRQVSLCPKRRAKGFGL
FT                   NFVNLSKELVECPEGDYDLYDFVQQSEQITNKEFDLVIVWTSSFDQSNPLNTRKFKCPT
FT                   LLLAGDTHHWKFPINHLLAYWAAEGFDYVATAYNFQHLHWFAAAGAENLAWLPLISMRT
FT                   VTHDWVEDRENQVVFIGQQGSRHPRRCRLVQAIKNADLPILIKTANRQEAAKWFAHSLI
FT                   SFNCSQNGDLNLRNLEVISAGGFLLTDQLSFASGLDELLAPGTYCDTYNSEAQLLEKIR
FT                   YYLDHPQEAIQIARRAYHTFDQHWHPRHRIQNLLDWVFGGELPEPFRYSPRSDVRYFVS
FT                   TASSAWIDTRLGIYEPIQELHRVQERLRVFVGRGCPGVIAADLLDLPRLELYVEEGFGD
FT                   PCALLQQKGVPERIHEVRGEPSSWPSFDAVVCTVGDLQRLGRPVRANFAFVLAEDHQLL
FT                   LANASKLMEAVLPGFDFGKLRFSVKLYPDTVFYERTYLNFPVFLSSQVQTVIDIGAGVG
FT                   LGSVCFRGFCPEAAIHCFEVDPLALHLLQQNALGLGNCFVHSVGLAGQNSCRTCRLWPE
FT                   DPQAKWGVEQLLPFREARAALKELGLEFIDVLRVATGGDEVEVLANLQPQLRDIKVIYV
FT                   EFTSEQDRKRIDQMLDPSHLLWQEEVSQGNYGCLCYLNRCIFYESSGNL"
FT   gene            480813..480956
FT                   /locus_tag="CYB_0471"
FT   CDS_pept        480813..480956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01464"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP31"
FT                   /protein_id="ABD01464.1"
FT                   /translation="MAPTQDELSYDNGIPMESWRHTCQMDLLISTTHAERGFEAVPSEV
FT                   GG"
FT   gene            481589..482800
FT                   /locus_tag="CYB_0472"
FT   CDS_pept        481589..482800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0472"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01465"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP30"
FT                   /protein_id="ABD01465.1"
FT                   /translation="MTQVLTISCKLKVSPSQAAKLDATLEAFGQALNWVNQNTPEKIVN
FT                   AVKLQSLCYYEIRARFGLSSNLAQQVCRRVAGSRKVAKQKKRPVKEFKSGFVTYDARIF
FT                   SFREKDWTVSLTTVEGRERFELAIGRYQRERLADSNPKSATLVKRKDGSYSIQICVEAE
FT                   PSPPQRTGRVLGVDLGRTDIAHTSDGDNWNGQQLNRVRDRYSRLRAVLQRKASKGTRSS
FT                   RRRCRQLLQRLSGKERRFQTWVNHRISKAIVSRAKATNSAIALEDLTGIRERVNQQPRS
FT                   KTERRRANSWAFYQLRQFLEYKARAAGVSLILVPPAYTSQTCHRCLHIHPEQGKSYRSG
FT                   KSFKCGHCGWEGDADLNGANVIALLGAVVNQPRGSGLFCSLVEQGRLRATESPLRTALA
FT                   VGVG"
FT   gene            482827..483726
FT                   /locus_tag="CYB_0473"
FT   CDS_pept        482827..483726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0473"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01466"
FT                   /db_xref="GOA:Q2JP29"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP29"
FT                   /protein_id="ABD01466.1"
FT                   /translation="MADSALYLVNHCRYGAIAQANLDLMGIDPSFHLQKVLPNLGQGIH
FT                   LLTWDPQHKGLTEQDLAHIQAIGPGSLLAANPVFLTFTQPDPSEPNRFYPCKYIKLDNF
FT                   LPQELNQAILQHAITHQDKFIPSKSYSKSNTEAESLKFRRSLRLDFAYFQEHGSLLREK
FT                   IAAVAPQIFAELGIENFDIQIFEMEMIASHDGCFFTAHTDNSYPQTAFRQVSCVYYFHK
FT                   EPKPYRGGELRIYDTQRQKPHPPILHGAYDEVTPTNNSIVFFSSSCLHEILPVFSPSQA
FT                   FADSRFTINTWLGAKQFT"
FT   gene            483699..484709
FT                   /locus_tag="CYB_0474"
FT   CDS_pept        483699..484709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN4"
FT                   /protein_id="ABD01467.1"
FT                   /translation="MARSQAIHLKACSSTMARVCIITTVRDPGVCLESFIRYHLALGIA
FT                   HIYIFFDDLEDPAIQVALQFSDVTAIPNDEALQVQQALGNVLYPKYGPHVGYEVMARQI
FT                   LNVETAIQLALDQGMDWILHIDGDELFYPGQTTAPNWFDRVSDDIFQVTFLNHEAAPEA
FT                   FEIEDYFREVTLFKRNPAILDPGFYTQFQKISSKSQYFLAYQNGKSAARIYPSLLPNSV
FT                   HSFDIPGDHTLVTSSPSILHYLNCGFQNYYKKYAQPGNFPDYWWRSKSNPIRVPFHLTS
FT                   RDAYCSGDRTRMEALYQEFILYNNPEASQSLMENGILTRICYPSQLLSSLSTSPV"
FT   gene            complement(484805..485320)
FT                   /locus_tag="CYB_0475"
FT   CDS_pept        complement(484805..485320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0475"
FT                   /product="general secretion pathway protein G, putative"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01468"
FT                   /db_xref="GOA:Q2JHN3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN3"
FT                   /protein_id="ABD01468.1"
FT                   /translation="MSAKSRQSLLRAKLAQQILSKAKGFTLIELLVVIVIVGVLSAVAI
FT                   PQFLNQVRRSRTAEAQAALTEVGRASEVYRLDFGVYPDKYVRIKYAGDYTDKYMNDPWR
FT                   APNYQDPVPTERSTTAPHALRWDTTSNGAPYITRSGSKIQCTIGLGAQEAAVTSLDTFV
FT                   GKSCNVFQ"
FT   gene            485683..489318
FT                   /locus_tag="CYB_0476"
FT   CDS_pept        485683..489318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0476"
FT                   /product="methyltransferase, FkbM family"
FT                   /note="identified by match to protein family HMM TIGR01444"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01469"
FT                   /db_xref="GOA:Q2JHN2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN2"
FT                   /protein_id="ABD01469.1"
FT                   /translation="MANEPAFPSEPEAITLSALEQALAAGQLSLAYQLYTPLVRTGILS
FT                   QEKVLDLLLSLASRLENSPTQDPQQRLQACLKLREMAFELDPSRRDNTQVLLMRTLQAQ
FT                   DELAVGFYGQALAEQLASLGEEQTLDITQEPLLTQLLTRLWDDGYLDLFFEVATALQAR
FT                   LLEDQKSGFAALLAQLAHAVDPEQANRYKGLWIIEDLIGDFFQKAACALFQNSTSDGYS
FT                   ILGEALITAAESSQVQENFTLRLSLLSESLEKLIHAAQPERINLVIQKIIDLILSREAD
FT                   LGSLRINDENLLESLTIAKVILFRVCFCWSYLTDDRSLIRRYQQIGGRIFNDCLSLMAS
FT                   QRDFLWSEYWQRNQQDYCRSGRAERKLRVGFLGNCFQRHSVGFLSEATLRNLSRDLLDV
FT                   VYYYYYQGWKNEDMASHDNMYQKFRSHENLHFRFFPGETNPPQVAAQAREDRIDIMVFM
FT                   DSLTSHDASIVAALRAAPIQIGWLGGDAVGLPEFDYFFADPYILPEDAQADYHEKIIRL
FT                   PSYCAVEYLDITPADEVNFKNKLRIGPQDIVFLTAASAYKRTPECIDAHLQILKAVPKG
FT                   ILIVKGSGEIATVIRRYQERAKELDVLDRVRFLAKTGTVEEHRGQLALVDLVLDTFPYT
FT                   GATHTMEALYMGVPVLTLVGRHYYGRMSYSLLKNVGLEDCITWSVEEFIQRGIQLGNDP
FT                   EWINRIKRQIKDSRRWSVIWDPREHARSMEAAFFHILEGKSHETYTFHPNDLYSTPDEW
FT                   NQAGIQLIRSLSADASVSTHQSAWEEALSLWRRGLARDPYHVPCWLNRIHALLVLGDRS
FT                   RAFEDAYALLEFLCTEAQSMQPSQLTDVPIWVESEGSADPGAYTKYSYLYYLAKWMAAH
FT                   VGVVYSPEAMRFWNLAYSINPDDRQAALAVAIELLSQKKIEGLIPVNHILGLDPTHQQA
FT                   SLVKQIAMWEVVPQVKTASSPAQPDLYFDYENCKLFLEPSFSSIVTRVLLAQGEWFEDE
FT                   ISFCKHFLRQGMNVIDVGANVGVYTFLAAHRVGPTGSVIAIEPTASCLQCMRKTISASS
FT                   LEDVVFLIEAAAGDHEGTVQLQEERASVFNSIGDSKQRPEQVSNDGKVVNLITLNSVWR
FT                   SRGEPQIDLIKIDAEGAEEQVVSGGLELLAAGHPIVIFENEHVSKVTGTATAKILEPLG
FT                   YEFYTYNRFLNKLTMVRPQQYPVSALNIIAIHPLDLEKVADMISV"
FT   gene            489323..489457
FT                   /locus_tag="CYB_0477"
FT   CDS_pept        489323..489457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01470"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN1"
FT                   /protein_id="ABD01470.1"
FT                   /translation="MDPNFALLLVLSKELSRAGWFLLYEQVIQLFWGTELAVGVGNRK"
FT   gene            complement(489533..490051)
FT                   /locus_tag="CYB_0478"
FT   CDS_pept        complement(489533..490051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0478"
FT                   /product="purine phosphoribosyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01471"
FT                   /db_xref="GOA:Q2JHN0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHN0"
FT                   /protein_id="ABD01471.1"
FT                   /translation="MHEISITWADYHRKIEELAVKVYESGWEFNQIVCIAKGGLRIGDT
FT                   LARLFDLPLAILSASSYSGPGNRQRGQLTFSRDLAMTTANLGSHVLLVDDLADSGMTLK
FT                   RSVHWLKHHYGFYVEEIRTGVLWYKAASVYQPDYYVDYLPDNPWIHQPFEPYEQMTPQQ
FT                   LMQLLRSSG"
FT   gene            complement(490117..491037)
FT                   /gene="ilvE"
FT                   /locus_tag="CYB_0479"
FT   CDS_pept        complement(490117..491037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="CYB_0479"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by match to protein family HMM PF01063;
FT                   match to protein family HMM TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01472"
FT                   /db_xref="GOA:Q2JHM9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM9"
FT                   /protein_id="ABD01472.1"
FT                   /translation="MPDFLPYAYFQGQIVPFAEAKISIATHALHYGTAAFGGLRGIPDP
FT                   QNPDQVLVFRLDRHCRRLSQSARLLCFDLPAERIEQVIVELIRKNRPSTSFYIRPLVYT
FT                   SDLGISPRLHNIEKDFFVYGLELGDYLSPEGVSCRISSWARQEDRSLPLRGKITGAYIT
FT                   SSLAKTEAAQAGYDEAILMNSQGKVSEASGMNIFIVRNGVLITPSFDQDILEGITRDSV
FT                   LTLARDLGIPTQERPVDKSELLIADEAFLTGTAAKITPIRQIEQYVLPPSRPITEQLRQ
FT                   KLTAITENRDPVYAHWVKVIPLKES"
FT   gene            491706..491966
FT                   /locus_tag="CYB_0480"
FT   CDS_pept        491706..491966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0480"
FT                   /product="peptidase propeptide/YPEB domain protein"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01473"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP28"
FT                   /protein_id="ABD01473.1"
FT                   /translation="MLGILSPASPMLSTGGSRRAAFAQSFALGIPIKEAIRIARSAVPN
FT                   AVIKEVELEREDRRLVWEVKFTNDIEVKIDATTGNIVDIDD"
FT   gene            492232..493674
FT                   /locus_tag="CYB_0481"
FT   CDS_pept        492232..493674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0481"
FT                   /product="putative transporter, HlyC/CorC (HCC) family"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01474"
FT                   /db_xref="GOA:Q2JP27"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP27"
FT                   /protein_id="ABD01474.1"
FT                   /translation="MDDPPLASAATFPNTELSWGDASLSLLWVIGLLVINAFFVAVEFS
FT                   LVSARRSRIVQLASEGNRQAALVQKAQEQLEYALSTTQLGITLASVLLGWIGATQVSPT
FT                   LFLALSRLDWFQGVDPALIRGVAVVLVFSLLTYLQIVVGELIPKTLAILYSEPIALKLA
FT                   WLNRLVSRFLHPFVELLRFSSRCVLRILGVRIPEATSFYSTMTVEELQLLIASSVESGN
FT                   IEAEERELLSNIFEFGETVASEVMIPRTSIDAVPETATVQEVLAEVAESGHSRYPVYGE
FT                   SLDDIRGLIHVKELIGQLAKGSIDLHSPITPFIREAHFEPENKPIAELLPEMRQHHWPM
FT                   VVVVDEFGGTAGLITIQDLVEEIVGKLSDGPDPNTKEPDIQELDENTLLIQAQLDIEEI
FT                   NERCGLNLPLHEDYQTLGGFLIYHMQKIPRAGEKFTYQEMEFQVVRMEGPRVDRVKVAR
FT                   RPGTPANSLPLLPPAQTAKTRP"
FT   gene            complement(493690..495231)
FT                   /locus_tag="CYB_0482"
FT   CDS_pept        complement(493690..495231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0482"
FT                   /product="Orn/Lys/Arg decarboxylase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01041; match to protein
FT                   family HMM PF01053; match to protein family HMM PF01276;
FT                   match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01475"
FT                   /db_xref="GOA:Q2JP26"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP26"
FT                   /protein_id="ABD01475.1"
FT                   /translation="MVLSNLSKTSRCLRSLDRKAQERAPLFEAIRHYCSLDKAPFHTPG
FT                   HKQGRGIPADLRTFLGENVFRADLTELPEVDNLHDPDGVIREAQELAAAAYGADRSWFL
FT                   VNGSTCGVETLVMAVCDPGDKILLPRNCHKSAIAGVILSGAVPAYIEPDFDPELGIAHG
FT                   ITPAGLEGALAEHPDAKGVLVVSPTYYGVCCDLESLAAIAHAHGLPLLVDEAHGPHFGF
FT                   HSELPISALEAGADLVVQSTHKVISGMTQASLLHLQGSRIDPNRVRNVLQLLQSTSPSY
FT                   VLMMSLDVARRQMALEGEALLGQALALADQARARLNRIPGLRCFGPERIGSTPGFFDFD
FT                   RTRLTVTVTELGLFGFDAHDWVNDHFHVQPEMSTLHNVVFIVSIGNTQRDIDRLVESFA
FT                   ALSQHFQGSRPSRAAMEKMQRLAQLPRPCLPPQRLSPREAFFAPIQRVPFQEAVGHICA
FT                   EIISPYPPGIPILVPGEEVTQEAVNYLLLVHEAGGFINGPEDVRLQTLKVVKATA"
FT   gene            495354..495920
FT                   /locus_tag="CYB_0483"
FT   CDS_pept        495354..495920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AE2255"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01476"
FT                   /db_xref="GOA:Q2JP25"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP25"
FT                   /protein_id="ABD01476.1"
FT                   /translation="MFEKLPFPLSTLVLLAGVAATAWGFAHYNDPTLNLIGLFAGIPLL
FT                   LGGVTMKVVELKPVPALAAPSLEVIQARAQQATEIQKQVRADITKYSYGANAHLEDALE
FT                   FLGLRGPLEADLPKVRGYREELRDGRYTLVLLFDSPKVPFQQWQESYQKKMQGFFGRDV
FT                   EVQLGQPQENQVELALVARGGSQAT"
FT   gene            complement(496114..498204)
FT                   /locus_tag="CYB_0484"
FT   CDS_pept        complement(496114..498204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0484"
FT                   /product="type IV pilus secretin PilQ, putative"
FT                   /note="identified by similarity to SP:P34750; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01477"
FT                   /db_xref="GOA:Q2JP24"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP24"
FT                   /protein_id="ABD01477.1"
FT                   /translation="MMNRRVAYGCALGLILSLPPLALESRVNEAAAQQLTSANPQRLSR
FT                   ITDIRLVPNGNRMQLEINTEGGARPQVFFTQQGQSWIGDITNAQLSGSQGRYRQESPLP
FT                   GVRFIEAWQLSNDSVRIEIAGVAAAPQGLLARRSPTQLVFDFEGLPSAPPAPLAAVPPQ
FT                   PSSNPVAPGQPASLNRPQPVAPAPQPAAPAPASQPVAQNPAPPQTTQAAPPAPAVPAAP
FT                   VISQVPPVGQLNQPQLPPGSLPTESPFQGRAVAPPAGDIAVGTILPDPPTVDLGSNARI
FT                   SLTLKDAPVGDVLSLLVRRAGLNVVLNDVPPDLTISLDVQDSPLQETFNFILRLKQLQA
FT                   QRRGQTVFVGQNLPGVTGILVRNYRVNQAVATDLASRLEEVLNAVAPGAQFVVDERTNS
FT                   ITVIGNSRQQDIAAAQIAQLDVRRRQVLISLRAVDIRLDKNESLSVNLGGASGNFALGT
FT                   LGDANFGGRPLNQPAGSSVSSIGPAGPSGSITGIFNTLNRLQQSLALRVQSAIQNGTGK
FT                   ILTDPKVVVADGGSSRISIATSVPVNVETITIPQGENQPPVVTQRLQREDAGVILDVSE
FT                   VRIDDNGFVTLTIQPEISIPVPSQILGGGDFAGILLFNIDRRQLQASQLRLRDGQTFII
FT                   AGLIQDRDIVDVQKVPFLGDLPLLGALFRSQSVNNERNEVVFMLTPYIMDDNVAFGLPP
FT                   NP"
FT   gene            complement(498467..499168)
FT                   /locus_tag="CYB_0485"
FT   CDS_pept        complement(498467..499168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01478"
FT                   /db_xref="GOA:Q2JP23"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP23"
FT                   /protein_id="ABD01478.1"
FT                   /translation="MTGSVEGFPDEQLVVPPAGPPVLLGVELTPIRIGLLIGITGLAAA
FT                   GFLAFTQLRPLIEEVQALEREVANKTTQLQDIKSQIASLQDVPNQVERARVEREQISAL
FT                   LSTPENADTQLLDLNRLVQGQPNSELRSFSPSPLTPASSANPEVPGIIAPAIQVQTTRV
FT                   ALRGPYTELINLMGDIERLRTLFRVSNISLNPVQDTGELDAAFDLIAYIYNKDVPLGTA
FT                   PPPEGQTAPGQ"
FT   gene            complement(499168..499875)
FT                   /gene="pilN"
FT                   /locus_tag="CYB_0486"
FT   CDS_pept        complement(499168..499875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="CYB_0486"
FT                   /product="type 4 fimbrial biogenesis protein PilN"
FT                   /note="identified by match to protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01479"
FT                   /db_xref="GOA:Q2JP22"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP22"
FT                   /protein_id="ABD01479.1"
FT                   /translation="MYTPEINFLKERPDVLTTARTGGGPVVAAEAAEGSQNWIPAIGLG
FT                   VAVAAVAMGAFWYFQDSFSRQRETLRAERARLDSELSTANAELSQLQNANQELQTIRAQ
FT                   TEGFRSFLRSVQPWSAILEELRRKIPGQGVWITNISASGDTVNIQGGALDFPLVNDFLL
FT                   TLLDSNFVTSAVLNSSSRVDGTDVTEPSVTYGITVTIRTLGDPDPEFTRELEQRGAIGL
FT                   VEKIRILRRVEAN"
FT   gene            complement(499936..501054)
FT                   /gene="pilM"
FT                   /locus_tag="CYB_0487"
FT   CDS_pept        complement(499936..501054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="CYB_0487"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="identified by match to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01480"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP21"
FT                   /protein_id="ABD01480.1"
FT                   /translation="MFSFFGGSKTRTMLGVDINPERIAVAQLKKQGNGRYRLAHYHSVD
FT                   MPEGAMVEGRILDPSTVGLILMNLLNENKVPTNLPAATAVPVREAIVRLIRLPADLPAD
FT                   ELRRVVLEQEAELYIPYPRDQADVDYQPLGLDLSQDGIERIEVLLVAIPKEVVDNYLEV
FT                   LQAANLQVRCVELASFSLIRTIRDQLIQYGPQEAVLLSSIGYDSSEISILVNGIPQFTR
FT                   TVNIGTIHMRQVLAQSLNLPLSRTGDLLRTLRLPLINPTDILATGEQPAPSNPGVAAVT
FT                   RVVSDLADELKRSIDFFTSTESSSPVVKVLLAGTGASIGQIDGFLSQSLSVAVELADPF
FT                   GNIVVPDSVELPLEERPAMGVALGLALREDTK"
FT   gene            complement(501274..502899)
FT                   /gene="kaiC"
FT                   /locus_tag="CYB_0488"
FT   CDS_pept        complement(501274..502899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiC"
FT                   /locus_tag="CYB_0488"
FT                   /product="circadian clock protein kinase KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by similarity to SP:Q8GGL1; match to
FT                   protein family HMM PF06745; match to protein family HMM
FT                   TIGR02655"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01481"
FT                   /db_xref="GOA:Q2JP20"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR013503"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP20"
FT                   /protein_id="ABD01481.1"
FT                   /translation="MNQSLGPSEPEKPQDNTAEDSTEPTPDNHRADLSELRGIPKKQTG
FT                   IEGFEDISHGGLPLGRTTLVSGTSGTGKTLFAMQFLYNGIVKYQEPGIFVTFEETPADI
FT                   IRNASSFGWDLQALIDRGQLFILDASPDPEGYEVSGNFDLSALIERIQYAIRKYKAKRV
FT                   SIDSVTAIFQQYDPAGVVRRELFRLTARLKQANVTTVMTTERTDEYGPIARYGVEEFVS
FT                   DNVVILRNILEGEKRRRTIEILKLRGTTHMKGEYPFTITNDGINIFPLGAMQLTQRSSN
FT                   VRVSSGIEKLDEMCGGGFFKDSIILATGATGTGKTSLVSKFLERGCLDGERCILFAYEE
FT                   SRAQLSRNASSWGIDLEEFERQGLLKIICAYPESAGLEDHLQKIKTEMMAFKPSRMAID
FT                   SLSALARGVSQNAFRQFVIGVTGLAKQEEITGFFTNTTDQFMGSHSITESHISTITDTI
FT                   ILLQYVEIRGEMARALNVFKMRGSWHDKGIREYLISNAGIQIRDSFRGYERIISGSPTR
FT                   INVDEKNELSRIVQNVQALEEEGL"
FT   gene            complement(502928..503230)
FT                   /gene="kaiB"
FT                   /locus_tag="CYB_0489"
FT   CDS_pept        complement(502928..503230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB"
FT                   /locus_tag="CYB_0489"
FT                   /product="circadian clock protein KaiB"
FT                   /note="identified by match to protein family HMM PF07689;
FT                   match to protein family HMM TIGR02654"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01482"
FT                   /db_xref="GOA:Q2JP19"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR013474"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP19"
FT                   /protein_id="ABD01482.1"
FT                   /translation="MSTRKAYVLKLYVAGNTPNSLRALSTLQDILEKEFRGVYSLKVID
FT                   VLKNPQLAEEDKILATPTLAKILPPPVRKIIGDLSNREKVLIGLDLLYEELDEEA"
FT   gene            complement(503233..504237)
FT                   /gene="kaiA"
FT                   /locus_tag="CYB_0490"
FT   CDS_pept        complement(503233..504237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiA"
FT                   /locus_tag="CYB_0490"
FT                   /product="circadian clock protein KaiA"
FT                   /note="identified by match to protein family HMM PF07688"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01483"
FT                   /db_xref="GOA:Q2JP18"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011648"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR020844"
FT                   /db_xref="InterPro:IPR020856"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP18"
FT                   /protein_id="ABD01483.1"
FT                   /translation="MLPDTHPLRINLLLDWEPPAGEPLACEDWLPPERFVVECFQDQAT
FT                   FLEALRKQDGHVDCLVLLVDPTRLQELHDLGNQLCAWGLLLPTVLAIVLEESHLQKETP
FT                   ETEGEIPATSSLVKALLKREQFFYHNATLVRPISPQELKGQVRADCTASGSPSVLELLV
FT                   DRAIALFLQMSPTCGLPQGPVHPSDQPYLAYSNQQQRRLAEKLRERLGYAGVYYHRDPE
FT                   LFYRRLPPHEQQALMRRLRNLYQAIVLDYFQSPETVNARIDELVALAFFADIGAAQLLE
FT                   LHMNLMEDFAKQLKLEGRSEEILLDYRLTLIDVMAHLSEMYRRSIPKPAPRDP"
FT   gene            504359..505294
FT                   /locus_tag="CYB_0491"
FT   CDS_pept        504359..505294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0491"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01484"
FT                   /db_xref="GOA:Q2JP17"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP17"
FT                   /protein_id="ABD01484.1"
FT                   /translation="MVPLIIDCDPGQDDAVALLLAMASPEELQLLGITTVAGNVSLDKT
FT                   SRNARQICELAGQPQMGVYAGCPRPLLRPLETAEQVHGKTGIDGADLPEPQMPLGSQHA
FT                   VEYLIETLMAAPEPVTLALLGPMTNLAVALVQQPRIVERIQRLVFMGGSAFEGNVTPAA
FT                   EFNILTDPHAAQIVLSAGIPEVVMLGLHVTQQVLSTPERIERIRALGTRVGQTVANMLT
FT                   FYGKVDVERYGLPGGPLHDPCVIAYLLQPQLFELKPCYVEVETASPLNLGRTVVDRWGS
FT                   SGRLANVQVAFGVDAQGFYHLLTERLGRYR"
FT   gene            505373..505891
FT                   /gene="pgsA"
FT                   /locus_tag="CYB_0492"
FT   CDS_pept        505373..505891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="CYB_0492"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01485"
FT                   /db_xref="GOA:Q2JP16"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP16"
FT                   /protein_id="ABD01485.1"
FT                   /translation="MNLPTAVTLLRLAGIPFVLLGLSLRSPLGERLALWAFLLAAATDW
FT                   LDGHLARRYGLVTDMGKFLDPLVDKLLVLAPLLGLLELGRIPAWGVFLLMGRELAIAGW
FT                   RVNQSQIRGANFWGKAKTVTQILAIALLILGWPGGIPCFWVAVVLTLISGLTYLHTDHP
FT                   HHAQSPGRP"
FT   gene            506211..506717
FT                   /gene="ruvC"
FT                   /locus_tag="CYB_0493"
FT   CDS_pept        506211..506717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="CYB_0493"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="identified by match to protein family HMM PF02075;
FT                   match to protein family HMM TIGR00228"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01486"
FT                   /db_xref="GOA:Q2JP15"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JP15"
FT                   /protein_id="ABD01486.1"
FT                   /translation="MFSVNVSDTPPEQRILGLDPGLGTMGFGCILAGSAGLKPVDYGVI
FT                   STPSQHSMPERLQTLHEDLSQLLRQLRPHQVGLEKLFFYKMGNTIAIAQARGVILLTLA
FT                   QHHLLPVEFTPAQVKQSLTGYGRADKQAVQAAVARELNLPSLPRPDDAADALAIAITVW
FT                   HHRFS"
FT   gene            506813..507466
FT                   /locus_tag="CYB_0494"
FT   CDS_pept        506813..507466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0494"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /note="identified by match to protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01487"
FT                   /db_xref="GOA:Q2JP14"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP14"
FT                   /protein_id="ABD01487.1"
FT                   /translation="MPSSSVDVRELPLFPLPEVVLFPGRPLPLHIFEYRYRMMINTILE
FT                   TDRRFGVLMFNPQTGSPVRVGCCAEVLQVQRLPDDRMDILTLGQQRFRVLDYVREKPFR
FT                   VGLVEWIEDEPTTPSDDLQSWVRQVTTLLQDVVRLSGKLMERDAQLPEQLPTTPIELSY
FT                   WVASHFHGAPQEQQALLEMVSTERRLRREAEILESTRKHLAARTALKDLFTEIS"
FT   gene            complement(507475..507621)
FT                   /locus_tag="CYB_0495"
FT   CDS_pept        complement(507475..507621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP13"
FT                   /protein_id="ABD01488.1"
FT                   /translation="MKNGEGILKKYPTFPGEAFCSAWSSKAKGTLWKGPQEPPEQMGAD
FT                   LTN"
FT   gene            507620..508351
FT                   /locus_tag="CYB_0496"
FT   CDS_pept        507620..508351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2626"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01489"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP12"
FT                   /protein_id="ABD01489.1"
FT                   /translation="MAYARRYLRFPSQILGREMEMLHFGHHGYPLICLPTSNGRFFDVE
FT                   DRGIIASLSHHLEQGYLQAFCVETLDWETLFNRQLDLPQRRERWLLLEQHWVEELIPYA
FT                   KAEAQNEFLVVAGFSLGATHAVNLTCRHPGLVRRCLALGGPYDVAALGSVTGWDPQRAE
FT                   QELYFINPLAYMSNMSRQLWDQLGGRNTELKLLTARHDHCLSDNLRLAEVLSRNDIPHQ
FT                   LEVWEGDHDWPTWQAQIRAFA"
FT   gene            508358..509446
FT                   /locus_tag="CYB_0497"
FT   CDS_pept        508358..509446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01490"
FT                   /db_xref="GOA:Q2JP11"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP11"
FT                   /protein_id="ABD01490.1"
FT                   /translation="MQGIAFERALMIEDYWVGSLHFSEPFGDDTLARLNALPPVQARNG
FT                   QTYKIRAEHVTIHEVNLDYRTKYRLILDRFSYLYPQAIGLFMGFAFRGVYLINNPFSFY
FT                   YYLRNKDAAYMVVKELGISIPKTYILPPKEAPALKAEDFKYHKFFDWQGMAEDLGWPIV
FT                   IKPAEGREAIGVEIAHNMEQLLYFYDRSGSQVMMIQEKVKTPYPWQIRALCIGRKIIPI
FT                   KYIFRKFDASEYLFDPEFLTPEMGQKVINTCRIINRVLGYEMNSVELFIDEQGELQAID
FT                   FNNPVPDGRLKALGEIFYNDYQQALCDLVLDIVREQRPFDFLPPDINRFAHIARRADLT
FT                   REQKFQMALELANRYYEPRDPD"
FT   gene            509676..510863
FT                   /locus_tag="CYB_0498"
FT   CDS_pept        509676..510863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04339"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01491"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP10"
FT                   /protein_id="ABD01491.1"
FT                   /translation="MSTGLKWRWCHDIREIPAGAWHALQTERTSPFLEYEWLHSLESSG
FT                   CASRRTGWLPCHLLVEADGQLVAAAPLYLKSHSQGEFVFDQEWAAVAGQLGERYYPKLI
FT                   GMAPFTPATGYRILVHPEYSEAEVWSLMLAAIDRFCQEKDISVFSLLYVDLDWRTQLES
FT                   DGFTPRITHNYQWHNPGYRSYEDFLSQFNANQRRNIKRERAAMEKSGLELKIYTGEEIT
FT                   PRLLSLMYDFYSNTCAQFWNWSKYLNRRFFESLYPNYRERVVLVAGERNAEIVGMSFCI
FT                   RKGDRLFGRYWGCREEVKFLHFNVCYYEPIALAIREGIRNFDPGAGGSHKIRRGFPATP
FT                   VYSYHRFYSRRLQQVLVPYLNRVNPLMLAELENVNQNEVPFREDVLPSLSALTKE"
FT   gene            510860..510973
FT                   /locus_tag="CYB_0499"
FT   CDS_pept        510860..510973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP09"
FT                   /protein_id="ABD01492.1"
FT                   /translation="MNHFIGWGFQSRKQLAADMLFALLQLFPAMLTPANTT"
FT   gene            511015..512409
FT                   /gene="rumA"
FT                   /locus_tag="CYB_0500"
FT   CDS_pept        511015..512409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="CYB_0500"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01493"
FT                   /db_xref="GOA:Q2JP08"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP08"
FT                   /protein_id="ABD01493.1"
FT                   /translation="MEHPIPSGLPDPVKPGDLLALEVTALTPQGDGIAHTVGLGQGRVV
FT                   FVSQAVPGDQVVAQITEIKRNYLVGRIRSLISPSPQRVRPACIVADKCGGCQWQHVSYA
FT                   QQLATKQQILRDALERIGGLTLPQPVPILGSQQPLRYRNKVTYPMAKPEGQPLRMGYYQ
FT                   RGSHRLVNLNQCPVQDERLDVFLREIKRDLQETGWSVYDESRHQGHLRHLGLRIGRRTR
FT                   EVLLTLVSCSRRLPHLESWAERWMQRYPDLVGVCLNLNSARTNAIFGPETEVIAGRGSL
FT                   REEFAGFSLWIDSTSFFQVNTEQAEAFFTWIADQLNLRGEETILDAYCGIGTLTLLLAQ
FT                   RAKRAMGVEALPEAVAQARYNAQFNGIASAQFFQGTVEQVLPTLPPADIVVLDPPRRGC
FT                   DRQVLETLKLRRPPRIVYISCHPATLARDLQILLAEGSYRLTQWRAADFFPQTGHVEGV
FT                   AFLERV"
FT   gene            512516..513949
FT                   /pseudo
FT                   /locus_tag="CYB_0501"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts which are not the
FT                   result of sequencing error; identified by similarity to
FT                   PIR:AE1887; match to protein family HMM PF07282"
FT   gene            complement(513959..514663)
FT                   /locus_tag="CYB_0502"
FT   CDS_pept        complement(513959..514663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01495"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP06"
FT                   /protein_id="ABD01495.1"
FT                   /translation="MAPVVILPGYLAGASEYEPLRQELEARGYAARVVPLQVRSWFPTL
FT                   GGRPVTPILWALRETIQKTCAEFGVDRVNLVAHSAGGWIARIYLGSVPYGGQVWQGREQ
FT                   VAALISLGSPHTSRERWTKRNLDFVNTHYPGAFWPEVKYVCVAGRVIQGQRLSLGSLWR
FT                   QEHYLAWLAYNSYWLTAGQGELWGDGITPIEAAHLQGAVNLTLPNCYHSGRGGRRWYGS
FT                   PEVVETWAQYLA"
FT   gene            complement(514667..515191)
FT                   /locus_tag="CYB_0503"
FT   CDS_pept        complement(514667..515191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0503"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01496"
FT                   /db_xref="GOA:Q2JP05"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP05"
FT                   /protein_id="ABD01496.1"
FT                   /translation="MSFWKGLFGSAGAATTKEPAQTAGADRRQETVVVRGETILFSLDP
FT                   NLDLYELEELCDAVGWSRRPIHKVRKALQHSFLVVSMWQQRGSYRRLIGFARATSDHAF
FT                   NATIWDVVVHPDFQGRGLGKRLMEKVIHELRARDISNITLFADQGVVSFYERLGFTADP
FT                   EGIKGMFWYPR"
FT   repeat_region   complement(515271..516591)
FT                   /rpt_family="CRISPR"
FT                   /note="GYMB_CRISPR02"
FT   gene            516636..516815
FT                   /locus_tag="CYB_0504"
FT   CDS_pept        516636..516815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01497"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP04"
FT                   /protein_id="ABD01497.1"
FT                   /translation="MRGIRKKVGKKSCGEGVLGLESLVAQGIEGSDERIGLCGFWRIAR
FT                   GGVDTVWVLSWKQG"
FT   gene            516914..518011
FT                   /locus_tag="CYB_0505"
FT   CDS_pept        516914..518011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0505"
FT                   /product="polyamine transporter, periplasmic
FT                   polyamine-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01498"
FT                   /db_xref="GOA:Q2JP03"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP03"
FT                   /protein_id="ABD01498.1"
FT                   /translation="MFSTFHSRRNLMKKWIASATTLLCCVLVLVLFWPHVTSAQRQTLN
FT                   LYIWSEYIDPDILTAFEKATNSRVLVSVYESNEDMVAKLRGGGTSQYDIVVPTDYIVPN
FT                   MLELGLLQPLNKELIPNLSNLGEKFVGLPFDPENTYTAAYQWGTTGIGYRKDRLPENFE
FT                   RSWGLIFDPQQQYGPFVMIDEMRSMIGAAAVYLGFDMNTTVRSELQQIQQLLIDTKRRS
FT                   AGLIGGVGGKNQLVSGTANVAIVYSGDALQAAEENPNIGYFVPREGAHIWLDVMAIPAQ
FT                   APNPELANRFINFILDAEVGAQLSNHNRFATPNAAALPMINPEDRQNPAIYPDEEALAK
FT                   LTYLKVLSGEELRLIDALWTTVKSS"
FT   gene            518074..518244
FT                   /locus_tag="CYB_0506"
FT   CDS_pept        518074..518244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0506"
FT                   /product="CAB/ELIP/HLIP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01499"
FT                   /db_xref="GOA:Q2JP02"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP02"
FT                   /protein_id="ABD01499.1"
FT                   /translation="MSPVDGARTMENQEAKFGFTTFAEKWNGRLAMLGFVIGVATELLT
FT                   GQGILSQIGLM"
FT   gene            complement(518503..523083)
FT                   /locus_tag="CYB_0507"
FT   CDS_pept        complement(518503..523083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0507"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF01590;
FT                   match to protein family HMM PF01627; match to protein
FT                   family HMM PF02518; match to protein family HMM PF05227;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01500"
FT                   /db_xref="GOA:Q2JP01"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP01"
FT                   /protein_id="ABD01500.1"
FT                   /translation="MPKAPLPPNEEQRLAALRQYQILDTAPETAFDEIVRLAAHICGTP
FT                   IALVSLIDEHRQWFKAKFGVDVQETPRDVAFCAHAILSPKEPLVVPDATQDPRFADNPF
FT                   VAQEPHIRFYAGIPLVTPEGQALGTLCVVDYQPRHLTPEQLEQLQALAHQVVAQLELRR
FT                   TLRELAQTPLLPKSGDTKPARKNRFLLKVTAGFGLAALLLGGITYSAQRNASQLPQLTE
FT                   RVAHTLKVIQNLEGLLAETRAAEAGKRGYLLTDNPRYLGEYQDSLEAISTRLRLLQELT
FT                   VDNPLQQERLKRLELLLEQRLRVIQDLIRLREQEGLLATQEALESSEGPRLVEQIADLI
FT                   LVLQQEENRLLQQRSQEFQFAWVRTNLIAFGGLIFTYLVLASVYFLIRRETAEREEAER
FT                   SLKQERDFTNAVIDTAGALVVVMDPEGRILRFNRAAEQLSGYSLAEVKNRLLWDLGLIP
FT                   PEDVPGVKQAFEQLKGNHSLFLNRHENFWRTKQGALRLISWSNTALINAAGEVEFVMGT
FT                   GIDITDRKLAELALKESEERYRDLFENATDLIQSVDAEGHFLYVNRAWKETLGYDEAQV
FT                   YQMTLFDILHPDCREHCQALFQKLLAGEKLERVETAFLTATGETVWLEGNVSCRFEDGV
FT                   MVATRGIFRNITEQKKAAEELERQNRRAQLLANLSLKIRESLDIAEILETAVTEIQALL
FT                   KADRVLVYRFQPDGSGIISNEKTQPGIPSLLGEVIEDPCFQEKYAQLYSQGRVRVVSDV
FT                   ESEGLEPCYLELLQKMQVRANMVVPLFLEQQLWGLLLAHQCSGPRQWQPFEMELLSQLA
FT                   NQIGIALTQAALLERERKRSLELEQARKAAEQAAQAKSSFLATMSHEIRTPMNAVLGMT
FT                   GLLLETPLNAEQRDFVETIRISGDALLTLINDILDFSKLEAGEMELEILDFDLRSCLEE
FT                   VADLFAPTAHAKGLELAVLMPPEVPRYLRGDASRLRQILNNLVSNAIKFTHQGEVVIQA
FT                   EVLQETATHAHLKLSVRDTGIGIPAAAQSKLFQPFSQVDASTTRKYGGTGLGLAICKQL
FT                   TELMGGTISLQSQEGQGSTFSVELTLERQPYVQQLSQPSARIPVDLQGKRLLAVDDNAT
FT                   NRKILRCQATTWGMVVEEAENAYQAMDKLRQAVREGRPFPLAVLDMQMPEVDGETLGRW
FT                   IKADPQLAETQLVMMTSLGLGEHSRRAAEIGFAAYLVKPVKQSRLQEALVMALGKSSGL
FT                   STSLLGMSPVLPQTTPREDRPRQSLRILLAEDNPVNQKVALRQLESLGYKADVVANGQE
FT                   VLDLLQKVSYDLILMDCQMPVMDGYEATRRLRQQERRSGHRTVVIAITANAMQEDRERC
FT                   LQAGMDDYLSKPVLKEDLQRLLNHWSQVIAQSAGGSSNQAASEAASPASPAESRDPSSP
FT                   TQPYPIDSAYLDQVSGGDRGFQRELLQVFIQDCETQLPQLRQAIAGYDAERMRRIAHRL
FT                   KGASSNVGANAFCQVVRELEHLGVALAQQGSQGGHDLEWARALQAPEDLERILADIRQY
FT                   LQDLEE"
FT   gene            523547..523924
FT                   /locus_tag="CYB_0508"
FT   CDS_pept        523547..523924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM38847.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01501"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JP00"
FT                   /protein_id="ABD01501.1"
FT                   /translation="MQKLQDSLVKALSIDGALGVALGDWKTGMCLGYKGTNSPAFPEAN
FT                   LELAIAGNTEVIRAKMRVAESLKLTDKIEEVLILLETQYHLMHLVQHISGLFFYLVLDR
FT                   EKGNLALARIKLGQIEKELAL"
FT   gene            complement(523982..524064)
FT                   /locus_tag="CYB_0509"
FT   tRNA            complement(523982..524064)
FT                   /locus_tag="CYB_0509"
FT                   /product="tRNA-Leu"
FT   gene            524077..524187
FT                   /locus_tag="CYB_0510"
FT   CDS_pept        524077..524187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01502"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ9"
FT                   /protein_id="ABD01502.1"
FT                   /translation="MCPKQGIPVKAGKRDPLPAALSVLSSAAHQMKADQR"
FT   gene            524190..525287
FT                   /gene="tgt"
FT                   /locus_tag="CYB_0511"
FT   CDS_pept        524190..525287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="CYB_0511"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01503"
FT                   /db_xref="GOA:Q2JNZ8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ8"
FT                   /protein_id="ABD01503.1"
FT                   /translation="MADFTFTCEGTCPHTQARAGYFVTPHGGIPTPCFMPVGTLANVKT
FT                   LTPAQLKETGAHIILSNTYHLHLQPGESIIQAAGGLHRFMGWSGPILTDSGGFQVFSLS
FT                   AIRQINEEGVTFRSPLDGRIIHFTPELSIQIQNALGADVIMAFDECPPYPASPEEVEAA
FT                   VRRTTQWLKRCVKAHRRSDQALFGIVQGGVYPELRRRAVEEVCRLDLPGYAIGGVSVGE
FT                   PVEFMHAVVRQTAPLLPADRPRYLMGVGTYAEMRAAVAAGVDLFDCVIPTRYARHGTVI
FT                   SRGKRWNIKNAEHRRSLDPIDPDCPCYTCRHFSRAYLCHLIRAQEILGYTLLSIHNITE
FT                   LMRYTQKMRQAILEGKFHENWDPWS"
FT   gene            525407..526018
FT                   /locus_tag="CYB_0512"
FT   CDS_pept        525407..526018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01504"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ7"
FT                   /protein_id="ABD01504.1"
FT                   /translation="MAIRTLSSVIEQHIAGLPGLIAVLIGRATDGATVAKVTYVSDSQE
FT                   EQALERLGTYAGDLLQANSRLCQTVSPDQEADYLLAGTPALRVVIKAFPKSPYFVLFLT
FT                   RSITDLRAISERIKAILIDGKPLLPPVQDSTMSLAQALMDYAKRYAPDPNFVALRLSLK
FT                   TGLDRNRLEKGTLTRQELRILYKAVADLLGRERLPIAMPV"
FT   gene            526113..527378
FT                   /locus_tag="CYB_0513"
FT   CDS_pept        526113..527378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01505"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ6"
FT                   /protein_id="ABD01505.1"
FT                   /translation="MLEHLHLDRNRKLISLFGEPVIFHCHHYNLFLQQTIEDPDWIDGV
FT                   GILRTAAQEIFYSLLYGAFKALGIQETQERLAVAAQIFSFLGFGRLAFEVTPSGGEVQL
FT                   THSHYAEGWLSKYGEQVSRTRPIDHLAVGYVAAALDATFGELGSYTAEETECMAVTRKD
FT                   HCVIQATRLPRPQLLTPSPGMGKLIEQPLQFPRPTTAVDYDAVNEALWGLPLAGDERGQ
FT                   IRAFNVLLTRMPANYYNRIQYRFLQELKAVQAELMGVGEALIRESGHVCVFYTFGNIME
FT                   SVEWETLVGPMLEKDTDWIHGGYAVASSLGWGRWQALEVVSGQSCRVAIDGNYEANYFL
FT                   ASYPRAEDPACYFAQGAVPAMMNLVYNGNIQQKPVLDQVFYNRLFQRGGLFHGQETKAR
FT                   EKGDPWCEFYAARVSGTESLRM"
FT   gene            527385..527681
FT                   /locus_tag="CYB_0514"
FT   CDS_pept        527385..527681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01506"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ5"
FT                   /protein_id="ABD01506.1"
FT                   /translation="MQVRILRRRECGAGWATDLLLPRCLAWSEVEVLAQEWRAACRCFQ
FT                   GQLVWLDLPSGRITASLRVPRLTLRLHDANAEARILDRLQQLAKSADSKAEES"
FT   gene            complement(527704..528363)
FT                   /locus_tag="CYB_0515"
FT   CDS_pept        complement(527704..528363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0515"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02254; match to protein family HMM PF05368;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01507"
FT                   /db_xref="GOA:Q2JNZ4"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ4"
FT                   /protein_id="ABD01507.1"
FT                   /translation="MQAFVAGATGETGRRIVKELVGRDIPVRALVRSHELAARVLPREA
FT                   EVVVGDVLDPATLETGMEGCTVVLCATGARPSWDPFQPYRVDYEGTKNLVDVAKAKGIQ
FT                   HFVLISSLCVSQLFHPLNLFWLILVWKKRAEEYLQKSGLTYTIVRPGGLKNQDNDDGIV
FT                   LSKADTLFDGSIPRTKVAQVAVESLFQPAAQNRILEIIAKPGVPNRDWSALFAMAG"
FT   gene            528509..531463
FT                   /locus_tag="CYB_0516"
FT   CDS_pept        528509..531463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0516"
FT                   /product="proline dehydrogenase/1-pyrroline-5 carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.2.1.88"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF01619; match to protein
FT                   family HMM TIGR01237"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01508"
FT                   /db_xref="GOA:Q2JNZ3"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="InterPro:IPR041514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ3"
FT                   /protein_id="ABD01508.1"
FT                   /translation="MVAQGAPTAYEAQTQALAQSLLASLWGEKRSLLAQWRDQLRWEDK
FT                   LLAWAMENPHLRTQLFRLIDVLPSLKSKAEVARHLQEYLSDPAVELPGMLKSLLNFADP
FT                   DSLPGQLAATTLTAAVEALARRYIAGETLQQVSKTLEALHRQGMAFTLDLLGEAVITEA
FT                   EAQSYLDRYLQVMEHLAKMVKTWPQPQPVPQVSVKLTAFYSQFDPIDPLGAKAKVGERI
FT                   RILLRRAEALGVGIHFDMEQYRYKSLTLAILQELLLEPEFKSRTDVGLTLQAYLRDSYT
FT                   DLQNLIAWAKERGSPVTVRLVKGAYWDQETILAAQKHWPQPVYNSKSATDANFERMTQL
FT                   LLEHHTHLHAAIASHNVRSQAKAIAIAQALEVPQSAFELQVLYGMADPLAKALVQKGQR
FT                   VRVYCPYGELLPGMAYLIRRLLENTANTSFLRQSVQGYTPEQLLAPPVLEEGSVFPAPS
FT                   LSFAAAPDTDFSQPQQRDPFFQALDEIRPQLGQRVQPWIAGEYRPTQQAMLSLNPADPQ
FT                   QVVAEIGLTEPEQVEQALAAAQASFPSWRRTPVAVRAGILRRVAEQIEAQRAELAAWMV
FT                   LEVGKPIAQADGEISEAIDFCRYYAQQMEALDRGRECNLPGETNHYHYQPRGVAVVIAP
FT                   WNFPLSIPCGMTAAALVAGNCVLLKPAEQSSLIAAKLAEFILKALAEAGIPEGVFQFLP
FT                   GVGEAIGPLLVQDRRVHLIAFTGSQAVGCQILAQAAQLQPGQHHIKRVIAEMGGKNAIL
FT                   IDESADLDQAVKGVVNSAFGYSGQKCSACSRAIVLQSIHDLFLGRLIEAVRSLNVGDPA
FT                   HPSTQVGPVIDAEAQARLQQAIQSAKADARLDLSLPVPEKGYFVGPTVFSQVDPQSELA
FT                   QRELFGPVLAVISAPDFSSALQMANATPYALTGGLYSRTPSHIQQARRDFAVGNLYINR
FT                   EITGALVERQPFGGFKLSGVGSKAGGPDYLLQFLEPRTVTENTQRQGFAPIEGS"
FT   gene            complement(531483..532535)
FT                   /locus_tag="CYB_0517"
FT   CDS_pept        complement(531483..532535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0517"
FT                   /product="CsgG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01509"
FT                   /db_xref="GOA:Q2JNZ2"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ2"
FT                   /protein_id="ABD01509.1"
FT                   /translation="MRNLSSVLLFGIPLVSLGWTGIPVVAQSANPALCQQFPQDIRCTL
FT                   SAPRQVGQAPQPTSRPRIAVLDFDFSSLSNPYSFREASRGVSDLLVDRLVRDGTFSVIE
FT                   RSRLDAILAEQNLGLSGRLDANTAAQVGRILGVDAVILGSVTQFDVSVRRSGGGAPVLT
FT                   PFGSFPLAVGAESVDADANVQLNARLVSTSTAEILAVVEGKGNASQSDSTVTVAGFGGG
FT                   SATSNEEKLLVLASQQAVEQIAQQLAGFAGRLAAQPRSLPTVDALVADVYGNQVILNKG
FT                   SRDGYRVGLILSVERVVREVKDPATGTVLRKLTEPAGQVQLTEVDDSSSVGRILSGAGF
FT                   KVGDVAKPVQ"
FT   gene            complement(532982..534160)
FT                   /locus_tag="CYB_0518"
FT   CDS_pept        complement(532982..534160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0518"
FT                   /product="ISSoc9, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01510"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNZ1"
FT                   /protein_id="ABD01510.1"
FT                   /translation="MQRLQAFKYELLPNSQQERQMRRFAGSCRFVYNKALALQKERHEQ
FT                   GQKKLGYAGLCQLLTAWRHSADTAWLADAPVHPLQQALQDLERAYSHFFAQRAGFPKFK
FT                   KKGRSDSFRYPEPKQIQLDQANSRIFLPKLGWLRYRNSRDVVGKVKSVTVSKHAGKWFV
FT                   SIQTEREVEQPKPKGGVVGIDVGIARLATLSDGTFYAPLNSFKRHEARLRKAQQALSRK
FT                   VQFSNNWKKAKARLQRIHSQMANARRDFLHKVSTAISKSHAMVCIEDLRVRNMSKLAAG
FT                   TADAPGKNVRAKSALNKAILDQGWYEFRCMLEYKLAWKGGRLIVVPPQNPSRTCPCCGH
FT                   VLSDNRQTQAWFECVACGYENNADRGSGPEAFRGSGPEAFLVGAINILARGI"
FT   gene            534374..535513
FT                   /gene="proB"
FT                   /locus_tag="CYB_0519"
FT   CDS_pept        534374..535513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="CYB_0519"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by similarity to SP:P07005; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01472; match to protein family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01511"
FT                   /db_xref="GOA:Q2JNZ0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNZ0"
FT                   /protein_id="ABD01511.1"
FT                   /translation="MATTDVTAMATTDVTVVVKIGTSSLTDTQTGLLRLSVLGPLVEVL
FT                   THLRRQGYAVILVSSGAVGVGCARLGWRQRPTAIAEKQAVAAVGQGRLIRLYDDLFSAL
FT                   NQPIAQVLLTRGDLVERSRYVNANRTFAQLLQMGVIPIVNENDTVAVEELKFGDNDSLS
FT                   ALVASMVQAKWLILLTDVDKLYSADPNRDPSAQPIERVLPGIPLQVKAEAQGKSGWGTG
FT                   GMATKLTAAQIATAAGVTVVITNGKRPEQIPAILAGEAIGTRFDPAPQPASARKRWIAY
FT                   GLIPEGSLTLDEGAVRAVCEQGRSLLPAGITAISGEFEAGAAVRLCDPSGQEVARGLVN
FT                   YSAEELRQIKGKKTAEIPRILGYEGVDTAVHRDNLALLN"
FT   gene            complement(535600..536703)
FT                   /locus_tag="CYB_0520"
FT   CDS_pept        complement(535600..536703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2462"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01512"
FT                   /db_xref="InterPro:IPR037494"
FT                   /db_xref="InterPro:IPR040781"
FT                   /db_xref="InterPro:IPR040858"
FT                   /db_xref="InterPro:IPR041358"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY9"
FT                   /protein_id="ABD01512.1"
FT                   /translation="MSQYLPEPAAVEEDPSLLVERLRRKEGRWLDWAKACQALQRQKMT
FT                   PQAIFEATGFEPIHQNQIIVAAQVYEGIAKAGASPAVLEHFAHKGSDILYELRILSPQD
FT                   RVRVAEFIFSRHLHAADAHEIARAVKNYAQLQQLPEGFTDHPGDAVAYQAWRTAQQTRD
FT                   LQERTRAIGRAFQYVHSDTARRQVEQLLSTIATSSRPQRSVLPKLSVFRLEEDLPRLLP
FT                   VAGSLPLATAAWEGIPPSEPQGPFGWVNSPAEQTWMALPAWPVIQKAGDPVILQVENRL
FT                   LGSLLGLPVPAGEEQDPVLLVVDRAARVWEGAQMAGFFLVDRAGSLAVEWIEDSPSSPL
FT                   LGQVLMAVRPPRVFDEVLAQDPWQLEE"
FT   gene            536702..536800
FT                   /locus_tag="CYB_0521"
FT   CDS_pept        536702..536800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY8"
FT                   /protein_id="ABD01513.1"
FT                   /translation="MLVLQQAGQITTPLVHSPAELAGHLAKLDLQT"
FT   gene            complement(536868..538766)
FT                   /locus_tag="CYB_0522"
FT   CDS_pept        complement(536868..538766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0522"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01514"
FT                   /db_xref="GOA:Q2JNY7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY7"
FT                   /protein_id="ABD01514.1"
FT                   /translation="MLGLAGQGQYGRVFCARPRQGGDLVALKELPAERFPTQNLLRELR
FT                   HLLTLNHPNITRCYALEHAREGRYLVLEYCEGGTLRELIDQVEQGLWLPVKQVLGFVDQ
FT                   ILAGLDHAHRQGVIHCDVKPENILLKPTPQGWQLKLTDFGIARHSQPLPDEISATGSPA
FT                   YMAPERFYGQFSPASDLYAVGIILLELLTGRRPFSGSPGQLMHAHLNQPFVCPEGIPAP
FT                   LREVLEIALRKLPLRRFRTAAQMRSALAVVAQEWQEPASCWVGPRLPRWPPPGVQVWDL
FT                   PDLGSVDTGGMEFLAEQKFCICEDPSGSRSPLLLRVTPQRLEWLELQNLALGSPALARF
FT                   SLDEPIRAVLPLNTFPEALAFSRSSLLHLSPSRIRTLLSFEEDWQATWLAERQELVWAT
FT                   AQELGAVQWQPATSTGTQPFPDSRCYFRWPWQGSLSRLLALSEHLVLLTGVGQQWVEMS
FT                   LLPYPKGHHPTVATGWSLQTGSQPIRYRLPLDPQGGVISLGERLLFAATDEGREGQQGC
FT                   CPYLHSVQVNPLRVRRWFLKGQPVQMAKAPWGVLLLCREGEQSTSLWLYSEKGDPLAQV
FT                   AVPNGSQVLQVGQRGKIWLQVPKAEKSHLSQLWQLDLNCLPVSGQPSQVMLCDPAI"
FT   gene            complement(538941..539405)
FT                   /gene="bcp-1"
FT                   /locus_tag="CYB_0523"
FT   CDS_pept        complement(538941..539405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp-1"
FT                   /locus_tag="CYB_0523"
FT                   /product="bacterioferritin comigratory protein"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by similarity to SP:P23480; match to
FT                   protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01515"
FT                   /db_xref="GOA:Q2JNY6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY6"
FT                   /protein_id="ABD01515.1"
FT                   /translation="MPLAVGDPAPEFTLPDAEGNPISLSQLRGQRVVLYFYPRDNTPGC
FT                   TQEACGFRDAYADYQAHGIAILGVSADDARSHQKFAQKLQLPFPLLVDEGAKVARAYGV
FT                   YGPKKFMGKEYNGIHRTTFVIDPEGKIEAVITKVKVETHAAELLKQLTGS"
FT   gene            complement(539421..539978)
FT                   /gene="infC"
FT                   /locus_tag="CYB_0524"
FT   CDS_pept        complement(539421..539978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="CYB_0524"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by similarity to SP:O33567; match to
FT                   protein family HMM PF00707; match to protein family HMM
FT                   PF05198; match to protein family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01516"
FT                   /db_xref="GOA:Q2JNY5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY5"
FT                   /protein_id="ABD01516.1"
FT                   /translation="MTVERPPDRFPRKQRAELPAINERIRFPKIRLIDTDGTQLGIMSP
FT                   REALRLAEEKDLDLVLVSEKADPPVCRIMDYGKFKFEKEKKEREARKKQHTAEIKEVKF
FT                   RYNIGEHDYNVRLRSAQQFLGDGDKVKATVMFRGREAQHAELGEELLHRLFKDLQEVAE
FT                   MQQPPQKEGRNITMILSPKKSV"
FT   gene            540238..540549
FT                   /locus_tag="CYB_0525"
FT   CDS_pept        540238..540549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01517"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY4"
FT                   /protein_id="ABD01517.1"
FT                   /translation="MGSKVVCRPAGRAEAVQLGLTERELTELAQKSVQLILSPREGDSE
FT                   ALIQYKSSAEFRAGVHLACAAMVLVLAENNERLSQQLQATLQNLSAAVETPSEKAAGS"
FT   gene            540591..541976
FT                   /locus_tag="CYB_0526"
FT   CDS_pept        540591..541976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0526"
FT                   /product="aspartate ammonia-lyase, putative"
FT                   /note="identified by match to protein family HMM PF00206"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01518"
FT                   /db_xref="GOA:Q2JNY3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY3"
FT                   /protein_id="ABD01518.1"
FT                   /translation="MRSERDSMGERQLPQSVYYGIQTARALENFPISGLKPLPEYVEAC
FT                   VLIKKAAAEVNGELGCIPAEVAKAIVQAADEILQGSLRDQFVVDVYQAGAGTSHHMNVN
FT                   EVLANRALEILGEPKGRYERVSPNDHVNYGQSTNDVIPTAIRLAALLRVRRDFLGTLDN
FT                   LVAALEQKAQEFRGILKAGRTHLQDAVPVRLGDSFGAYAAIFAQHRRWIEEASQALCSL
FT                   GLGGSAVGTGLNTHPQYRQKVVQRLAEYTQLPLTPAPHPMAAMQSMAPFVHLSGSLRNL
FT                   AQDGIKLANDLRLMDSGPKTGLKEIQLPPVQPGSSIMPGKYNPVIAEMLNMVCFQVIGL
FT                   DTAITLAAQAGQFELNVMMPLIAYDLLHSLQILNSSLRVFAERCIQGITPKPERCRGYA
FT                   EGTLALVTALNPYIGYLQAAEVAKASLETGQPIRQIVLERNLMTPEQVAEVLDLEAMSQ
FT                   MQS"
FT   gene            542017..542757
FT                   /locus_tag="CYB_0527"
FT   CDS_pept        542017..542757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89549.1; match to
FT                   protein family HMM PF05685"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01519"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY2"
FT                   /protein_id="ABD01519.1"
FT                   /translation="MTIAPYRWPTQHDLPDTDDTPLDNEDQGRQYPLLREPLLLHWSDR
FT                   QDFFVACNMGLYYALPRQVIVPDLFLVLGVPRWRDGTARKSYVVWDEGNILPILILEII
FT                   CNDQGEEKPGQAKFQLYERRLRIPYYVTFELETDELNVYQLQGGHYELLPGSGAGEHPP
FT                   ILLPDLDLSIGRWWGSYEGRERFWVRWYDRAGQLLPTGAELERQRAELERQRAELERQR
FT                   AELERSRAERLAQRLRELGEDPEF"
FT   gene            542837..544225
FT                   /locus_tag="CYB_0528"
FT   CDS_pept        542837..544225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0528"
FT                   /product="sugar transporter, glycoside-pentoside-hexuronide
FT                   (GPH):cation symporter family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01520"
FT                   /db_xref="GOA:Q2JNY1"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY1"
FT                   /protein_id="ABD01520.1"
FT                   /translation="MTRQRLSLWTKLAYGVGDLGTGMTANILIFFLLPFLTNTVGMSAG
FT                   LAGSIYAITRFWDAINDPIIGILSDRTRTRWGRRRPWLLFAALPFGLTFLAQWWIPFPG
FT                   RIGPLFAYYLAVSLLFNTFYSAANIPYASLTAELTQDYDERTQLNQFRFAFSVGGSMVA
FT                   VVTFPLLVNLLPDRAAGHLLAGACFGVISAVPLLICFWGVRERYPSQRDPMPLVQQLRV
FT                   AFSNRPYLFVSGIYLCSWLAFQFTATIIPYFIVFWMGLPEVWISLVVLAVQGIAVLTLF
FT                   GWTQLSTHLDKRTMYLIGAGFWLISQAGLFFLQPGQQGIMIGLALLAGIGVSATAYLGP
FT                   WSMLPDVIDLDELQTGERREGIFYAFMVFLQKVGLALGLFFVGQALDWAGFVPSVAGEA
FT                   LPIQPESALLAIRVAIGPLPGVALIGGILLVWFYPITRQRHQQILMELEERRQQYHPST
FT                   ERSP"
FT   gene            complement(544295..544735)
FT                   /locus_tag="CYB_0529"
FT   CDS_pept        complement(544295..544735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0529"
FT                   /product="ISSoc10, orfA transposase"
FT                   /note="identified by similarity to PIR:AI2478; match to
FT                   protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01521"
FT                   /db_xref="GOA:Q2JNY0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNY0"
FT                   /protein_id="ABD01521.1"
FT                   /translation="MKHDFVSSGRAVSDLKAHLVLTTKYRRKVFTSEMLQRLHEVMYDL
FT                   CQKWGCKLIEFNGEADHVHLLFQYYPQVDLSKLVNNIKSVSSRRMRSEFADYISKIYRK
FT                   NVLWNESYFIASCGGVTVSALSQYIESQGTPASHPDPSAPRR"
FT   gene            544793..546037
FT                   /locus_tag="CYB_0530"
FT   CDS_pept        544793..546037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0530"
FT                   /product="ISSoc10, orfB transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01522"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX9"
FT                   /protein_id="ABD01522.1"
FT                   /translation="MRTAYQYRLRPTPSQVVLMEQWLELLRKQYNYRLAERLNWWEQNR
FT                   CNINACPLICHLPELKDRPDVYSQKRDLVNTKVRFPEYQAIHSQVLQNCIERVHKAFDR
FT                   WLKGDRNGKRAGRPRFKGAGRYRSFTFPQMKQDCIQGKFIHLPKIGAIKLIQHRPLPDG
FT                   FVIKTATITRKADGWYVTLSLQDASVPEFAPEPATLENTIGIDMGLDSFLVTDTGESVP
FT                   VPQYYRRAQKRLERLQRSLSRKQKGSNRRKKALGRVAKAHLKVANQRKDFHYKVAKKLV
FT                   SKGKHIAYEALNTKGIARTRLAKSIYDAGWGQFLQILAVKAERAGLRAIAVDPRGTSQD
FT                   CSQCGQKVPKTIRDRWHSCPHCGLELGRDHNAAINIKYRAVGHPVLKAQETSFTGVTEK
FT                   PALFRFSGAERFASA"
FT   gene            546112..546330
FT                   /pseudo
FT                   /locus_tag="CYB_0531"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error"
FT   gene            complement(546440..546901)
FT                   /locus_tag="CYB_0532"
FT   CDS_pept        complement(546440..546901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX8"
FT                   /protein_id="ABD01523.1"
FT                   /translation="MNPLFPFKLGLSLVLLLGPLAISPAQAQRIVIDGRGIVVEPSTGG
FT                   SVILNPDQPVFSPILPSAVPFSIDEEGKIVSAPGYRCSAATAADNSPIICRSRFNRNDV
FT                   VVYERDGQSNTFFVNADNTVIRPSGSGLRIVPNPEPATPSGSGLRIILD"
FT   gene            complement(547075..547995)
FT                   /gene="chlG"
FT                   /locus_tag="CYB_0533"
FT   CDS_pept        complement(547075..547995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="CYB_0533"
FT                   /product="chlorophyll synthase, ChlG"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01476; match to protein
FT                   family HMM TIGR02056"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01524"
FT                   /db_xref="GOA:Q2JNX7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX7"
FT                   /protein_id="ABD01524.1"
FT                   /translation="MKGAEVESRSIWQLHLQLMKPVTWIPLVWGLIPGAASSGHFTWTW
FT                   ENVALILVGMILAGPLMTGYTQTVNEYYDREIDAINEPYRPIPSGAISLQRVVIQIWVL
FT                   LILGLGLAYALDWYTGHDLPVITCIALAGALIAYIYSAPPLKLKRNGWLGNYALGASYI
FT                   ALPWWTGHALFGELNWTVCILTLIYSLAGLGIAVVNDFKSIEGDRQFGLASLPVMFGAM
FT                   GAAWISALMIDLFQFGMASFLLGAGLKLYAALLVLLIIPQITFQDMYLLRDPLNNDVKY
FT                   QASAQPFLVLGMLVVGLALGRSGLW"
FT   gene            complement(548802..549620)
FT                   /locus_tag="CYB_0534"
FT   CDS_pept        complement(548802..549620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0534"
FT                   /product="phytanoyl-CoA dioxygenase PhyH family protein"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01525"
FT                   /db_xref="GOA:Q2JNX6"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX6"
FT                   /protein_id="ABD01525.1"
FT                   /translation="MRFSPAVRVSGTESLQELQQPDPETVEQAFELFSTEGYLVLPEIF
FT                   PPELIDKLHSSFLATYSRYCTHEHHADALLVGNRRVMVTVRLEGPFNDPLIYAHPLILP
FT                   ILKRILGPELILSGLGAVVSLPGSADQQVHRDLSHLFGDETLDAIIPCYALNLLIPLVE
FT                   VNEENGMTRLWPGSHAVFDAHYTELAQQMPFIDPPLAKGSCLLFDYRLIHLGRANRSPA
FT                   PRPLLYNTYSRAWFRDPINYTQQPPLVIPAQEKERIPAEHQNLFVTAQIV"
FT   gene            complement(549636..551156)
FT                   /gene="trpE"
FT                   /locus_tag="CYB_0535"
FT   CDS_pept        complement(549636..551156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="CYB_0535"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715; match to protein
FT                   family HMM TIGR00564"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01526"
FT                   /db_xref="GOA:Q2JNX5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX5"
FT                   /protein_id="ABD01526.1"
FT                   /translation="MIYPPLKEFLALTKQGNFIPVYQEWVADLETPVSAWYRVCAGQPY
FT                   NFLLESVEGGEQVARYSFLGCDPLWVLEIRGDQALQRYRDGRQEHHQGDPFAILARCLQ
FT                   PYEPVHLPELPSSIGGLFGYWGYELIRWIEPKVPVHPLQPGDPPDAVLMQVDSILLFDQ
FT                   VKRKIWVVAFADTRHHAPEEAYAQACRRVEKLMQQLSAPLSLAHLHLNWKPHLSERTPS
FT                   RWREQIPPSTLSRPAYCQAVERAKDYIRAGDIFQVVLSQRFTVSLAGDPFRLYRSLRLI
FT                   NPSPYMAFLQFGDLCLIGSSPEVMVKLSRVGEDRIATVRPIAGTRPRGTTPLEDRQLEQ
FT                   ELLADPKERAEHVMLVDLARNDLGRVCQLGSVQVDDLMQIERYSHVMHIVSNVVGRLDP
FT                   QYSAWDLLRATFPAGTVTGAPKIRAMQIIHELEGCRRGPYAGAYGYYDFSGQLNTAITI
FT                   RTLLVHQGQVSLQAGAGIVADSDPEREYQECLNKARGMLMAVASLQET"
FT   gene            551297..551845
FT                   /locus_tag="CYB_0536"
FT   CDS_pept        551297..551845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0536"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01527"
FT                   /db_xref="GOA:Q2JNX4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX4"
FT                   /protein_id="ABD01527.1"
FT                   /translation="MQNPSQVIRERLRYQGHKYTFVSQRLRFPNGKEGEREYLIHPGGV
FT                   VAVPVTAAGKFVCIRQYRFAVASYLYEFPAGTVEPGEHPDDTIRRELEEETGLRAHRWD
FT                   PLGQFYLCPGYSSEIMYAYLARELEVLDSPPDKDEDEDITVVEFSASELTEMARLGMDL
FT                   DSKSIACFWRAQLFLAAEK"
FT   gene            552117..552782
FT                   /locus_tag="CYB_0537"
FT   CDS_pept        552117..552782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0537"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX3"
FT                   /protein_id="ABD01528.1"
FT                   /translation="MRKLLYSCGRIAWGVALAATLPVAAVPAYPQPVLPLLPVPSEGGA
FT                   ARGGVVALFNQSIWWDFIRGNRGENLRLFPASLTSPSRQDVVAVFQIQRQPTVEPVVRV
FT                   LSFEHQGGYSFRLLHTAEPIPGRLVEAHLRTDITSSPQPKLVLLTERGGISLLRSVLVL
FT                   EHRPEGLVPLLSVTDLSNASLRVSPQGILVISSPPGASRDLRATLYQWEGDGFVRRDL"
FT   gene            complement(552872..553828)
FT                   /locus_tag="CYB_0538"
FT   CDS_pept        complement(552872..553828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0538"
FT                   /product="peptidase, M23B family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01529"
FT                   /db_xref="GOA:Q2JHM8"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM8"
FT                   /protein_id="ABD01529.1"
FT                   /translation="MSPPLTVTLLIFCCLLYQFVNISPVFPQVSSPSSPQGSRVGVYAQ
FT                   LARAVERQDWLQALQLVDLLQQHTEDPAQRQDLEDYRLELEKYRSAYGDPPPPQWPFLH
FT                   KPFVGEFPVTNLFDHDLPLGERDGNRRFVSGQGQVWIPDPLHPCGKSDGHAGYDWEMPV
FT                   GTPILAAAAGRVTLAREEPEFFCPSLGRLVRGLRVRLLHEPELSEGERTDGRALPRWET
FT                   LYAHLSQIGVQEGQVVAAGAVIGLSGDSGCASGPHLHFEVRRFDNTNSGQPAAVDPYGW
FT                   FGSGLDPWSIHPLGAESLFLWQVGQAPSLGACWQGQR"
FT   gene            553989..555035
FT                   /locus_tag="CYB_0539"
FT   CDS_pept        553989..555035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0539"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to PIR:AH1824; match to
FT                   protein family HMM PF04240"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01530"
FT                   /db_xref="GOA:Q2JHM7"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM7"
FT                   /protein_id="ABD01530.1"
FT                   /translation="MRWFSSSGVLVSLPFQSSVGRSVLPLSGSIWQRLEALALGLHILS
FT                   LLFGLAGLLWVVPHPEWVASLPPIGIQAFSLSMGNGGVAYMVFGALAAALMGSRLLGVR
FT                   RLLMFLIPAVGISLGSELLGTSTGIPFGNYGYLSGLGYKIAGLVPFTIPLSWFYVGLSS
FT                   YLLARVALQTQRHWLIHFEAIMLGALLLTAWDFVLDPAMTRGLIPFWTWFQPGPFFGMP
FT                   LQNFGGWMLTGAAFMTVANLLWGEDQPILDRRQLVGPLVLYVANFAFALLMSLGSGIAA
FT                   PAGLGLLLGLGPALGLWWSAETPSPYRDQPVPPSHPEQDSIPLLQTVEGEAGRDWDTLE
FT                   DPGWVGAK"
FT   gene            555082..556122
FT                   /locus_tag="CYB_0540"
FT   CDS_pept        555082..556122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0540"
FT                   /product="putative low specificity L-threonine aldolase"
FT                   /note="identified by similarity to SP:O50584; match to
FT                   protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01531"
FT                   /db_xref="GOA:Q2JHM6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM6"
FT                   /protein_id="ABD01531.1"
FT                   /translation="MNFCSDNVTGACPEVMEALLALNRGSAMPYGGDECTAQVQRLFAE
FT                   IFEHEVAVFPVATGSAANALALSVLTPPYGAIYCHPEAHINLDECGAPELFTGGAKLVG
FT                   IPGEQGRIDWGNLKAALERAGFGVVHHVQPACLSLTQATEAGTLYSLEQLGSLADLAHH
FT                   FGLKVHMDGARFANALVGLGCTPAEMTWKAGVDVLSFGATKNGAWAAEAVVFFHPDQVG
FT                   DFEFRRKRSGHLVSKMRFLSAQLQAYLQDGVWLRNARHANAMAQRLAQGLGSLPGARLV
FT                   YPTEANEVFIELPEPVLQALEQAGFRFYRWLGEGHHLIRLVTAFNTLPADVERFCQVAQ
FT                   QASRLQ"
FT   gene            complement(556212..556736)
FT                   /gene="lspA"
FT                   /locus_tag="CYB_0541"
FT   CDS_pept        complement(556212..556736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="CYB_0541"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01532"
FT                   /db_xref="GOA:Q2JHM5"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM5"
FT                   /protein_id="ABD01532.1"
FT                   /translation="MKNKGFWLAGILGVILDQATKHWAVERLLPGPEIELWPGVFHLTY
FT                   VENTGAAWSLFEDSAELLKWISLGVALALGLLAIRGGILSRWEQAGYGLVWAGAVGNGI
FT                   DRFVNGYVVDFFNLIWIRFPVFNVADVAINLGVACLLIGLLQDNSKKTGSTSASPRLEK
FT                   KPGRDSTHFKD"
FT   gene            complement(556733..556939)
FT                   /locus_tag="CYB_0542"
FT   CDS_pept        complement(556733..556939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01533"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX2"
FT                   /protein_id="ABD01533.1"
FT                   /translation="MLLLSSQRRPIASEAAHRCWIPPQAQPWIQGSALELLGNEPAEEQ
FT                   HVRMGKVLIGALLPVDVIEAKTT"
FT   gene            556802..556927
FT                   /locus_tag="CYB_0543"
FT   CDS_pept        556802..556927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01534"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX1"
FT                   /protein_id="ABD01534.1"
FT                   /translation="MLLFCRLIAQKLKGGALDPRLGLRRDPTPVSGLRSDWPPLA"
FT   gene            complement(556997..557377)
FT                   /locus_tag="CYB_0544"
FT   CDS_pept        complement(556997..557377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0544"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01535"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNX0"
FT                   /protein_id="ABD01535.1"
FT                   /translation="MALSSLMQGLHLEGSPSIGRSRCNSKETLALVDRRALVRKCNKHF
FT                   ISEIEVSMAVTRAGRAPLVRGSSEGNPAKFMEMASALLNTRTRQGSGKKVQDRSSYGKA
FT                   GNPQEFMQMASELRRSLEQQGR"
FT   gene            complement(557377..558180)
FT                   /locus_tag="CYB_0545"
FT   CDS_pept        complement(557377..558180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0545"
FT                   /product="polyamine/opine/phosphonate uptake ABC
FT                   transporter (POPT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01536"
FT                   /db_xref="GOA:Q2JNW9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW9"
FT                   /protein_id="ABD01536.1"
FT                   /translation="MPIRPFPIGQWLWILFSLGVLLFLHLPLLVIVLYAFSPDEATLRF
FT                   PLPGLTWRWFAVAWGRADIWRALFLSLRVAVLATGVAVVLGSLAAAAVYRSRFFGRETI
FT                   SFLVLLPIALPGIVSGIALRSAIHLLHIPFSFWTIVIGHATFCLVVVYNNVLARFRRMG
FT                   RSQLEASADLGANPLQTFRYILLPELASALLAGSLLAFALSFDEIIVTTFTAGQQQTLP
FT                   IWVFSQLTKPRQRLVISVVALGVIGLTVLPIWLIHHLTQEKTTTR"
FT   gene            558347..558961
FT                   /gene="ruvA"
FT                   /locus_tag="CYB_0546"
FT   CDS_pept        558347..558961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="CYB_0546"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01537"
FT                   /db_xref="GOA:Q2JNW8"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNW8"
FT                   /protein_id="ABD01537.1"
FT                   /translation="MIAFLSGHLVAIEWGERSSLTVEVQGIGYRVKAPGRFLKQLPAVG
FT                   EPVRVFTHLVVRETELVLYGFGSPAERDLFVELIKVSGVGPALGLALLNTFGLPELVQA
FT                   VVTENVRLLSLTPGVGHKTAQRLALELKTKLAHWRQGMGVADQPLAGGPPMPIREEVEM
FT                   ALLALGYSTQEIQAALQALPTHPRPTEDWLRDAITYLSQQP"
FT   gene            558958..559566
FT                   /gene="nadD"
FT                   /locus_tag="CYB_0547"
FT   CDS_pept        558958..559566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="CYB_0547"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01538"
FT                   /db_xref="GOA:Q2JNW7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNW7"
FT                   /protein_id="ABD01538.1"
FT                   /translation="MKHRRIAILGGTFNPVHHGHLIMAEQALWQFDLDQVLWMPAGDPP
FT                   HKPLAPGASKADRLAMVKLAIADHERFACSELEIRRSGRSYTIETLRTLIQEQPNTQWY
FT                   WIIGVDALRDLPQWYQAEELARLCHWIVAPRVDAGDAAQVLQAVAAKLPIQAQILEAPT
FT                   LTLSSTYLRQQIQKGGSIRYLVPPAVEHYIRQHRLYLQP"
FT   gene            559713..560867
FT                   /locus_tag="CYB_0548"
FT   CDS_pept        559713..560867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0548"
FT                   /product="ISSoc8, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01539"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW6"
FT                   /protein_id="ABD01539.1"
FT                   /translation="MSQTISVRCKLIVPQELRQEIDRTLQRFADACNQILDTAKREKCW
FT                   NTAKLHHLVYRPVRAATGLKANHVCQALRRVISNAKAVKQVHRFRPTSLTLDARTFKYR
FT                   ESDQTVGVTLMSGRVWLKLKIGGYQIALLRGQKPTSATLSKTKQGDYYINIAVELDTPP
FT                   TGKTPKVIGVDLGRRDIATASNGRSWSGEHIQAVRDRFSRVRAKVQSKRTRSSRRLLRR
FT                   LSGRERRYQTWLNHNISKTLVRDAQAIGAALAFEDLTGIRDCLNQKSRSKAERRRTNNW
FT                   AFYQLRMFVAYKAAIAGVPVVLVPPAYTSQTCHKCLHIHPERGKSYRNGKSFKCGHCGW
FT                   EGDADHNAAQVISLLGATVNSPEIPKLSCPLGPLGIGIKLAPCT"
FT   gene            complement(561039..561287)
FT                   /gene="psaC"
FT                   /locus_tag="CYB_0549"
FT   CDS_pept        complement(561039..561287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaC"
FT                   /locus_tag="CYB_0549"
FT                   /product="photosystem I iron-sulfur center, subunit VII"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01540"
FT                   /db_xref="GOA:Q2JNW5"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNW5"
FT                   /protein_id="ABD01540.1"
FT                   /translation="MAHSVKIYDTCIGCTQCVRACPTDVLEMVPWKGNNKAGMIAAAPR
FT                   TEDCVGCKRCETACPTDFLSIRVYLGPETTRSMGLAY"
FT   gene            561440..561880
FT                   /locus_tag="CYB_0550"
FT   CDS_pept        561440..561880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01541"
FT                   /db_xref="GOA:Q2JNW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW4"
FT                   /protein_id="ABD01541.1"
FT                   /translation="MGQWEGCWGWARIGLKMTGQGIPNMGRSVQDWRRQTQGNLRRLGP
FT                   ILLEIFEENVPRLRRWDQQLTDWVRSHRWGVDPSLPKVAIYVLGAVVILAIPLLTFVAL
FT                   GAFLTFLGVQIVQKWSQGDPARQTQRRYLRSADADDDDFDLD"
FT   gene            complement(561907..562269)
FT                   /locus_tag="CYB_0551"
FT   CDS_pept        complement(561907..562269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD80267.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01542"
FT                   /db_xref="GOA:Q2JNW3"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW3"
FT                   /protein_id="ABD01542.1"
FT                   /translation="MADSDPKPRSPLSQRRDPSSAEQVRLLTELAAPYRSLRRFIYLAV
FT                   GFSATIGAFVFFFRALAGRDLNTTLPSLALQLGILAGAIGLNRLENRSHQKVIRQVKQR
FT                   LGMQQDSQEPQRSADS"
FT   gene            complement(562273..562914)
FT                   /locus_tag="CYB_0552"
FT   CDS_pept        complement(562273..562914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NS3252"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01543"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW2"
FT                   /protein_id="ABD01543.1"
FT                   /translation="MGIDLRSYVFLDRLQPQYAAYLGTVAYGFLPLPGDTSLWVEISPG
FT                   IEINRVMDIALKATSVRPGLQVVERLYGLLEVHSSNQGDTRTAGRAILAALGVSEQERL
FT                   KPRIISSQIIRNIDPHQTQLINRSRRGQMLLAGQTLYILEVQPAGYAPLAANEAEKSAQ
FT                   INILEVMPFGSFGRVYLGGEERDILAACRAAEAVLAGVSGREPLLLPEEV"
FT   gene            complement(563050..564351)
FT                   /locus_tag="CYB_0553"
FT   CDS_pept        complement(563050..564351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0553"
FT                   /product="putative gamma-glutamyl phosphate reductase"
FT                   /note="identified by similarity to SP:P07004"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01544"
FT                   /db_xref="GOA:Q2JNW1"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW1"
FT                   /protein_id="ABD01544.1"
FT                   /translation="MTDFGSDFDLGTTLRQVRRLLPQMQRLSSQTKRQALLALSRCLLE
FT                   RSDLLLEANTLDLESCREQTVPEWILNGLKLTPERLQRSAQLLTLLAQQPDPIGKLEKG
FT                   HRQENGLFIGRYRVPLGLIALVYEIYPEFALNGIGMCLKAGNGVILASSGPIQKTHQAM
FT                   VNLLAETAYEHGIPEGAIQTLPAQDRTADPQVDSPLLPLLQQTRYLDLVIPCGRPGWVE
FT                   FLLQASKVPTLATHLGYGHIYLDRTAPWPLVKSVLLDPLAQYGSEGIPIYQPLTLWLLI
FT                   HTDWAANHLTALVEDLLGHGIAVQAAAPILEQFPQLQPLGQGFDSTERPHLRLQPIADL
FT                   TEAIAWINKNGCRQSETILTDSQSAAQRFLQEVDAALIHINTSPLSAGRGAGIPTLGAF
FT                   RDLSLGISTQRLHVRGPIDVEALTTVKVVAQGDL"
FT   gene            complement(564489..564941)
FT                   /locus_tag="CYB_0554"
FT   CDS_pept        complement(564489..564941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01545"
FT                   /db_xref="GOA:Q2JNW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNW0"
FT                   /protein_id="ABD01545.1"
FT                   /translation="MAFSSPRKSPRQNSAPRVAQTLEPAKIYPCPCCHQGQLRLITLTE
FT                   AFGCSRCQHIFAITPDRLYIEQLAVSYPYRKMWFWNGYQWVLRRENTLQGSALLGLTLS
FT                   LGIVLAVGFIGAVLFPNQTQLLSWFMILGLLLTLLMVTAILLLRRP"
FT   gene            complement(564999..566426)
FT                   /locus_tag="CYB_0555"
FT   CDS_pept        complement(564999..566426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0555"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01546"
FT                   /db_xref="GOA:Q2JNV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV9"
FT                   /protein_id="ABD01546.1"
FT                   /translation="MARNPQGLRVEIKKEPRPLAGELRRRLPRRNQSAIFTLNDSAMSF
FT                   PLSHLLQRGRQYLAPFLGQILLPSLALTVLQIFMIPFWSEESDYASAFTALSQRDSYWY
FT                   LSIVRRGYQFVGFDKIAYEQSNVAFFPGYPLAVAAISHLVGVDPELGLYLTAQLFCWLM
FT                   WVYLFLLYRRWQIPPLWQILASLLIFFYPTSFYLVVGYSESLFMASLLGFLYWSIHGGR
FT                   PLLMLLAGIHGLVMSATRIVGLPVALLPFLNLLKAGERTQARRWFWTSMAASLALLGGL
FT                   GFFLYCQLRFGRWDLYLEMQRYFTGVKANYQAIFQARTYVLSAERWQSLLSLSAPMKDP
FT                   GLWADALSQLFVSATLGSLLVTGLMDAAGVMAGRSQCWRERLGFHLAAWAMFYIALTGT
FT                   SPLGQRSMSRYCLPVHILQVLALVHWAKHTDFSFIPQRVLGYLGTILKLGYGLLALIFL
FT                   ALNQILTWRYVHHLWVA"
FT   gene            566647..567753
FT                   /locus_tag="CYB_0556"
FT   CDS_pept        566647..567753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0556"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02048"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01547"
FT                   /db_xref="GOA:Q2JNV8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV8"
FT                   /protein_id="ABD01547.1"
FT                   /translation="MYTGTAAGEVVGLSDRICQALPGFVREPDRRNVEYITPPLRRYED
FT                   LLCALLRPRLQLRQFLRRLGPYTLLPGSTLALGGSDHFERSDPGNPYHDYIERTYGTRV
FT                   VTASIHINVGLPGTEAIFRACRLLRAEASLYLALSASSPFLDGRVTGSHSSRWQVFPKT
FT                   PAQVPFFRDHAHYIAWIQEQLALGTMQNVRHLWASVRPNGPERPYHLNRVELRICDLVG
FT                   DPVMVLAITALVEARLWQLLAQPEALDPLRGPFTPTELESLCEANEQAAARESLQSHLV
FT                   DWRTGRERAAQEWIEELLTEAWRIGQPQGLGCFLAPLQTLLHQGNEAQRWLKQVNQGST
FT                   PAQVYQQAIQELAEQDRERQETLCQAVG"
FT   gene            complement(567966..568712)
FT                   /locus_tag="CYB_0557"
FT   CDS_pept        complement(567966..568712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0557"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01548"
FT                   /db_xref="GOA:Q2JNV7"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV7"
FT                   /protein_id="ABD01548.1"
FT                   /translation="MEELPQLNTNPQKQRILLKLATGLGLAIFIFWAAHRLGFFGVIQD
FT                   WLAEALAWIESLGLLGPILFIAIYIVATVLLLPASVLTLGAGAVFGLLAGTVYVLIGAT
FT                   IGANLAFLIGRYLAREQVAKWIEGNAKFAAIDRAVGREGWKIVGLIRLSPAFPFNVLNY
FT                   ALGLTRISFLDNLLGTAGIVPGTFMYVYIGSLAGSLADMEGAELDPQAQTAQWVVRLVG
FT                   LIATIAATVYVTRIARKALQEAVEPA"
FT   gene            complement(568793..569143)
FT                   /locus_tag="CYB_0558"
FT   CDS_pept        complement(568793..569143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0558"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01187"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01549"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV6"
FT                   /protein_id="ABD01549.1"
FT                   /translation="MPLIKLQTSVQPEIAAVEELLKVLSAALSEQLGKSEAYVMTAFEG
FT                   GIPMTFAGSGDPCCYLEIKSIGQFSAQQTRAMSEFFCGTIEARLGIPKKRIYIEFSDAK
FT                   GYLWGWNGTTFG"
FT   gene            569327..569710
FT                   /locus_tag="CYB_0559"
FT   CDS_pept        569327..569710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0559"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01550"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV5"
FT                   /protein_id="ABD01550.1"
FT                   /translation="MQTEAAPAPVGPYSQGVTALGPFLFTAGQVGLDPKTGKLVGEDIV
FT                   SQTRQALLNVQAVLEAGGTTLANVVKTTVFLADMEDFAAMNEVYREFFATDPAPARSCV
FT                   QVARLPLNARVEIEVVACYPQST"
FT   gene            complement(569728..569997)
FT                   /locus_tag="CYB_0560"
FT   CDS_pept        complement(569728..569997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0560"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /note="identified by match to protein family HMM PF01809;
FT                   match to protein family HMM TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01551"
FT                   /db_xref="GOA:Q2JNV4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNV4"
FT                   /protein_id="ABD01551.1"
FT                   /translation="MPERSDPLTRSLIALIRGYQVGISPWLPPACRYYPTCSQYTLEAV
FT                   RRYGALRGGWLGIRRLCRCHPWHPGGYDPVPDLPGSAPTQKPFR"
FT   gene            570229..571530
FT                   /locus_tag="CYB_0561"
FT   CDS_pept        570229..571530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0561"
FT                   /product="transporter, drug:H+ antiporter-1 (12 spanner)
FT                   (DHA1) family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01552"
FT                   /db_xref="GOA:Q2JNV3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV3"
FT                   /protein_id="ABD01552.1"
FT                   /translation="MRVFGQLQPAQRRNLGILFVAGLLFWASLSSLLPTLPLYVRDAGG
FT                   TSQQVGWVMGAFSIGLLAFRPALGRLADGHSRQIVLLIGMGVVGMAPIGYWLSDWIPWV
FT                   ALVRAFHGVSIAAFATAYVTLVVDFAPEEKRGEILGYMSLVNPIGAAIGPALGGFLQEF
FT                   AGYGPSFLFSALLGLVGFLCTQLVREQRREHWGSLPMDGAFWSFLGSPKVRSLAWVMFL
FT                   VGLAFGTQTTFVALLIQEAGAPLNPGLFYTAVAFASFGVRLLTGRASDRYGRGPFISLS
FT                   LVTYALAMGILIVANSSGAFLAAGVAVGCGFGTLIPLISALVADRSEPAERGRLFSLVM
FT                   CGFDLGIGLAGPLLGTLAAGSGYRAMFGYAALLSLASLGSFLFFSNGRPGDSLRFALGL
FT                   GPDSLSGCLEDSRNPTSWSHRVSPLPRRRDPVHR"
FT   gene            571691..572527
FT                   /locus_tag="CYB_0562"
FT   CDS_pept        571691..572527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0562"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="identified by match to protein family HMM TIGR02669"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01553"
FT                   /db_xref="GOA:Q2JNV2"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV2"
FT                   /protein_id="ABD01553.1"
FT                   /translation="MEARHWLALMGSLVVSAFWGWVESVWGVTVRVQLADTTAPLVVGV
FT                   SLPAQLINGRGEVLADLPPMQGFLAQPSPQGVRLHGVVDPVLFIEPQEGGLVAVNGRWY
FT                   SGKVLLTGYNMVMAINYVDLEDYVASVVDAEMGSRFFPEALKAQAVAARSYVLYHRNSR
FT                   GWFDVFSDTRSQVYRGLSQRSAAALEATQATRGVVMVYGGQFVNAMYSASSGGQTVGVS
FT                   GIPYLRSLPDVSPYPKFGHGIGMSQWGAQELARRGWTYRQILAYYYRGVSFARLPE"
FT   gene            572901..573218
FT                   /locus_tag="CYB_0563"
FT   CDS_pept        572901..573218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01554"
FT                   /db_xref="GOA:Q2JNV1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV1"
FT                   /protein_id="ABD01554.1"
FT                   /translation="MGRTLYVSQQDCYLSLDQERLVVKRAGAVLQQAQLPHLDQILIFG
FT                   HAQVTTQLIQSCLERNIPIAYLSHMGYCAGPSSTGRCRPTSSLYNDQIPVYLRTMRRTL
FT                   G"
FT   gene            573326..574858
FT                   /locus_tag="CYB_0564"
FT   CDS_pept        573326..574858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0564"
FT                   /product="helicase, UvrD/REP family"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01555"
FT                   /db_xref="GOA:Q2JNV0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNV0"
FT                   /protein_id="ABD01555.1"
FT                   /translation="MATLTDEQKAVVEAAKTGSHLKVVAFAGAGKTFTLVEVAKALAGK
FT                   RILYLTFSKALAEEAKQKFGSLADVMTNHALAYKETGKLFAEKKRLGGSLFKARRKLAE
FT                   DMPDLDCLLEWGSRDREEALFPVLETVNRFTQSEVETVTAEHIPEILRLKIEAEDERFD
FT                   DFAACLVPLAQRAWELLVDPEASYPVSHDVYLKLYQLSRPQLPYDVILFDEAQDANPAM
FT                   LGILLPQAARRIFVGDPHQQIYAWRGAVNAMERLDGQELPLSQSFRFKEHIADEASELL
FT                   YLFKGETRRVRGNPYPKQDGSTAILSRTNVGALREVLVLLDQGKKVALVNKIEELTDVL
FT                   KAAYDLYRGQKPRHPEFSLFRSWEQLKYLIERFPSIAAQYRPYERLVEEYKDRIPKVCH
FT                   TLSNSLVDEEHAEVVVSTAHRSKGREWDRVTLAEDFTGVTLAQENPTHRCVKLYPEEAN
FT                   LTYVAFTRARDTLVKGAFTEALERQKDLARALKAGKLQLCTPEIEAQARKAD"
FT   gene            complement(575034..575858)
FT                   /gene="menB"
FT                   /locus_tag="CYB_0565"
FT   CDS_pept        complement(575034..575858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="CYB_0565"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM TIGR01929"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01556"
FT                   /db_xref="GOA:Q2JNU9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU9"
FT                   /protein_id="ABD01556.1"
FT                   /translation="MWQTAKLYEDILYEKTDGIAKITINRPHKRNAFRPKTIAELIDAF
FT                   ADVREDPRIGVVLLTGAGPHTDGKYAFCAGGDQSVRGEAGYLDEAGIPRLNVLDLQRII
FT                   RSLPKVVIALVAGYAIGGGHVLHLICDLTIAADNAIFGQTGPRVGSFDGGFGAAYLARV
FT                   VGQKKAREIWFLCRQYTAAQALEMGLVNAVVPVEELEAEGIRWAQEILQHSPLAIRCLK
FT                   AAFNADCDGQVGLQELAGDATLLFYMTEEAAEGKRAFLEKRPPNFRQFPWLP"
FT   gene            complement(575976..577478)
FT                   /gene="cobA/hemD"
FT                   /locus_tag="CYB_0566"
FT   CDS_pept        complement(575976..577478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA/hemD"
FT                   /locus_tag="CYB_0566"
FT                   /product="uroporphyrin-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /EC_number="2.1.1.107"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF02602; match to protein
FT                   family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01557"
FT                   /db_xref="GOA:Q2JNU8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU8"
FT                   /protein_id="ABD01557.1"
FT                   /translation="MGKVYLVGAGLGGRAGLTQGALEILRQAEAIWIDELVDERLLAEL
FT                   PPQAQVWRRSGPGSLQEGIHWLIQRCREGKQVVHLKSGDPLIFGRAREEIQALREAGCP
FT                   FEIWPGLSSALAGPLWAGIPLTDKHLSRVFAVLTAHDLEALPWSALAQLDTLVILMGSR
FT                   QRQHIGARLMESGIPADRPVALIWGAGQAEQQVWVGTLAELQQGESQAKLPGLLVVGEV
FT                   IRLRQDFLPGIPPLPPPAPLAGKTVLVTRSEGQSPAFRELLQAQGARVLEMPTLVIQPP
FT                   TCWDPLDAAIARLGQFNWLLLTSANGVQAFFERLHRQGRDSRALHPVQVAVVGSKTASV
FT                   LAQYGIHPDLMPQEFVAEALLQVWPEPISGQRILFPRVESGGREEVVQGLRQRGAEVVE
FT                   VAAYQSACPAAADPQVLEALKAHQVDILTFASSKTVQHFAHLIRQAGLGPEIWDPPVQI
FT                   AAIGPKTAATCKAAFGRVDIAAQEYTLEGLVEALIQATNRST"
FT   gene            complement(577614..577784)
FT                   /locus_tag="CYB_0567"
FT   CDS_pept        complement(577614..577784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01558"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU7"
FT                   /protein_id="ABD01558.1"
FT                   /translation="MTSRKGRDLAEEGREPAPTASRAAPLAKKRRRGQGSGVTPDIGRD
FT                   PQAATLSVSRK"
FT   gene            577660..578670
FT                   /locus_tag="CYB_0569"
FT   CDS_pept        577660..578670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0569"
FT                   /product="taurine uptake ABC transporter (TauT) family,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01559"
FT                   /db_xref="GOA:Q2JNU6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU6"
FT                   /protein_id="ABD01559.1"
FT                   /translation="MSGVTPEPWPRRRFLASGAALLAVGAGSRPSSARSRPLRLVTNWY
FT                   AQAEHGGFYQALATGIYADYGLQVEIRMGGTAVNVLQLLAGGAADFVLGGSPDALAALQ
FT                   AGIPVLTVAAFFQKDPQCLLAHPGVGIERLEDLRGKPIWVSPGANLTYWPFLRAKFGFT
FT                   DEQKRPYNLSLTPFLLDKSSAQQGYVTSEPFRVRQEGGFDPVVFLLADYGYSPYATTLE
FT                   TTRPFAEQHPEQVRKFVAASIQGWQSYLEDPRPGNRLIRQDNPNMSEALLAYAHQALKD
FT                   YGLLTSGDAATLGIGAMTHQRWQTYFQEMVALGTVEANLDVGQAYTLDFLPGPTA"
FT   gene            complement(578667..579200)
FT                   /locus_tag="CYB_0568"
FT   CDS_pept        complement(578667..579200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0568"
FT                   /product="putative phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01560"
FT                   /db_xref="GOA:Q2JNU5"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU5"
FT                   /protein_id="ABD01560.1"
FT                   /translation="MESRQRRQDPQTLQNLLRAAYQQLLERQPYQHEKTGELEKIEQDF
FT                   LRGRIGIKRLVRQIGGSRLYRQLFFSAGCNTRCVEQGFKHFLGRAPASKEEVAAYHDIL
FT                   VHQGLQAMVNAFIDSEEYRHQFGNDHLPHPRQRLSGHPPLAYLLTNQMHRRHELGMQGS
FT                   PLLHSLAAMEVGIP"
FT   gene            579742..580272
FT                   /locus_tag="CYB_0571"
FT   CDS_pept        579742..580272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0571"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01561"
FT                   /db_xref="GOA:Q2JNU4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU4"
FT                   /protein_id="ABD01561.1"
FT                   /translation="MPAGVFCLPLMWIPSMVKQIRLEPLSRVSEVDTYSNLLSAILSEE
FT                   LQVSRECNGRGLCATCHVYVKEGMESLTPITPREAKTLETITSARSNSRLACQARVVSD
FT                   GVVVELPPGMYVNSLRDIEVLIGRRAEQDLLHPRTGKVLVEQGKIITRSTVKQLENEDF
FT                   RIIGSTLAQTREV"
FT   gene            complement(580213..580347)
FT                   /locus_tag="CYB_0570"
FT   CDS_pept        complement(580213..580347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU3"
FT                   /protein_id="ABD01562.1"
FT                   /translation="MFNSCLIVYKTTPAEPKGSLNIDNPSNFPSLGKCTADDAEIFIF"
FT   gene            580504..581184
FT                   /locus_tag="CYB_0572"
FT   CDS_pept        580504..581184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0572"
FT                   /product="putative bacteriochlorophyll 4-vinyl reductase"
FT                   /note="identified by match to protein family HMM PF02830"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01563"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU2"
FT                   /protein_id="ABD01563.1"
FT                   /translation="MATTSRPDPRPAVTMPVGRDKHAHYSYRDFFRFNRDQGTIIDWNN
FT                   TQNLLLSEDFIVGLQTGLEREVGDASAAVMYTIGRDWGIRDAKHFSEWYEREYGIGVKQ
FT                   SNLLFLLETWWWPFTAQGWGKWEVETESKQKGFLFINLFDSMVARTLGDVGKPVCHLYA
FT                   GLFAGFFTAMTSRELACIEIQCYAMGETYCKFLLGGQERIDAANFWITEGASAREIEQR
FT                   LHQL"
FT   gene            581244..581525
FT                   /locus_tag="CYB_0573"
FT   CDS_pept        581244..581525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01564"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU1"
FT                   /protein_id="ABD01564.1"
FT                   /translation="MVTFNLDTDLDLTQPLAVFLQGLNWDNRPPAKASSAQELPPQSPV
FT                   LFAQSVGQFFAGFNWSGICPRSEPLPEFPAEDPFTLEDFAALFGGALL"
FT   gene            581587..582180
FT                   /locus_tag="CYB_0574"
FT   CDS_pept        581587..582180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01565"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNU0"
FT                   /protein_id="ABD01565.1"
FT                   /translation="MDDLHSWPERIADREGGYLTPDDLQDLIRYSLSFQERLELYQVLQ
FT                   QQELTWIQKVLQQQGPTPVATALPSSNPAREGAEPSLTPAQRLLARQLAFCLRSLGLSL
FT                   LIGDPTPVQQVTLGAMEQYLGLPQALAQLRAVVQGSLPADQQGLLAPYWQELQAVCATS
FT                   QAQFPSPSSSRSEAEVDLPTVPPERALTLAEMFV"
FT   gene            582205..582675
FT                   /locus_tag="CYB_0575"
FT   CDS_pept        582205..582675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0575"
FT                   /product="phycobilisome protein"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01566"
FT                   /db_xref="GOA:Q2JNT9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT9"
FT                   /protein_id="ABD01566.1"
FT                   /translation="MNSRVAELMHQSEGRYLRPDELKTLHAYVEGIPKRVRLYQVLQAK
FT                   EQELLDRVMEKFQPMMPNLIRQHGHLAWERCRRDLSMVWRYCCMAMLLNDEDYLRDKLL
FT                   YWLETILKSFKMRDQCQPAYKLMLDSLTYIFGAEESEMIRPYLLLAKSMLVN"
FT   gene            582864..583553
FT                   /locus_tag="CYB_0576"
FT   CDS_pept        582864..583553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0576"
FT                   /product="V4R domain protein"
FT                   /note="identified by match to protein family HMM PF02830"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01567"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT8"
FT                   /protein_id="ABD01567.1"
FT                   /translation="MISLQEILQDQILPGHCFSPAYYIRPDIHTGLLYSRGGYRLAAFP
FT                   MPLLEALYSGLRYETGQATRVILYNCGRDWGEAFFRRVEDELSGYYQQLLQELPMGIFL
FT                   DALSDLWATHGWGRLELDFSAADHGLVQAGIRNSGFALAARASFNPEEPSARREPAGYL
FT                   EAGMLASLFSLLSGRDLICVQTTCESLGADLNRFLIGTAQRLHHCEEWVRKGLSHDEIL
FT                   DRLTASP"
FT   gene            complement(583591..584298)
FT                   /locus_tag="CYB_0577"
FT   CDS_pept        complement(583591..584298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0577"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01568"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT7"
FT                   /protein_id="ABD01568.1"
FT                   /translation="MTNPASRLLAPLLGGLLSAQMAAPVLAQMGPLPPPPAGEGWRPVN
FT                   PRPLPPGPQPLQPGQPFQLQTTLLLRSGDLIQAVHRSPETLLIAPGETRAVSLSLDTPL
FT                   RDIYGNMVVPAGAVLEGQFQPVSGGTQFVSRALIFNGQSYPLYAQSQVIPLRKDPRHTS
FT                   GEAIVQDALIGAAAGAILGGLFGDRVISTEKVLGGAAAGAVIGNVTAPEVAVIDANANL
FT                   TLTVTQDFQPYLP"
FT   gene            584583..585827
FT                   /locus_tag="CYB_0578"
FT   CDS_pept        584583..585827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0578"
FT                   /product="peptidase, S1C (protease Do) family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01569"
FT                   /db_xref="GOA:Q2JNT6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT6"
FT                   /protein_id="ABD01569.1"
FT                   /translation="MKRSTSMPGQPSPGSEASAQPAQSSFQPFAISTWKSLLSSVLLVL
FT                   LGIGLGAALVGGKGVSAQTTATPPQLNLNFIADVAQKVGPAVVRIDAERTVRAPAPFPE
FT                   EFFSDPFFRDFFGQAIPSIPRQRRQQGTGSGFIISPDGQIITNAHVVEGSDKVTVTLKD
FT                   TRSFDGQVIGSDPVTDIAVVKINAQNLPTVKLGRSETLEPGQWAIAIGNPLGLDNTVTA
FT                   GIISALGRSSGEIRVPDKRVSFIQTDAAINPGNSGGPLLNAQGEVIGVNTAIIQGAQGL
FT                   GFAIPIETAQRVANQLITRGKVDHPYLGIRMLTLTPELKERLNQDPNSRILITVDQGVL
FT                   IGEVIQGSPAERAGLRSGDVILSINGRAVTTADQVQQEVERTEVGSTLELEIERAGRRQ
FT                   KIRAVTGSFPAPSGG"
FT   gene            586180..587103
FT                   /locus_tag="CYB_0579"
FT   CDS_pept        586180..587103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0579"
FT                   /product="quaternary amine uptake ABC transporter (QAT)
FT                   family, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01570"
FT                   /db_xref="GOA:Q2JNT5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT5"
FT                   /protein_id="ABD01570.1"
FT                   /translation="MLKTTRRLALLALSGLAALVLTPHRASGTESLGGLAKPITVGSKD
FT                   FTEQFILGEMYALALEAAGFTVERKLNLGGTPVAHAGLLSGEIDLYPEYTGTGLLTVLK
FT                   LPSSGDPAEVYATVAREYESQFQLIWLDPAPLNNTQALAMTRARAAELGIATISDMVAK
FT                   AGELVMIGPPEFQAREDGLPGIQAVYGNFRLKAYKAVDPGLRYQGLVNGEADVAVAFGT
FT                   DGEIAAFDLVLLEDDKQLFPPYQVAPVVRKDTLEANPGIAAALNALSPLLTDEVMQRLN
FT                   YEVSGNRKEPAEVARTFLVEAGILKK"
FT   gene            587130..588098
FT                   /locus_tag="CYB_0580"
FT   CDS_pept        587130..588098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0580"
FT                   /product="quaternary amine uptake ABC transporter (QAT)
FT                   family, ATP-binding protein"
FT                   /note="identified by similarity to SP:P33360; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01571"
FT                   /db_xref="GOA:Q2JNT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT4"
FT                   /protein_id="ABD01571.1"
FT                   /translation="MSTVEFERVSLRFPHSSQPAVEECSFSVESGQLVVILGPSGCGKT
FT                   TLLKMVNRLLDPTQGQIRLDGRDIRQFPVTALRQRIGYVIQQSGLFPHMTVAQNVAVVP
FT                   RLLGWAKERIRERVDELLSLVNLPPHEYRHRYPAQLSGGQQQRVGLARALAGDPGLLLM
FT                   DEPFGAIDAITRSKLQEEILRLQRQLKKTILFVSHDVEEALRLADRILVMQKGRVVQFD
FT                   TPFRLLTQPATPFVRELLGADDMVRQLSVLRVETAMAGIPHNHKIQEGAMVRPQATLRQ
FT                   ALSLLLRTGAAALTVWEDGRAIGVLTLDHIRSLAMLEGGSA"
FT   gene            588095..588712
FT                   /locus_tag="CYB_0581"
FT   CDS_pept        588095..588712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0581"
FT                   /product="quaternary amine uptake ABC transporter (QAT)
FT                   family, permease protein"
FT                   /note="identified by similarity to GB:AAG43531.1; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01572"
FT                   /db_xref="GOA:Q2JNT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT3"
FT                   /protein_id="ABD01572.1"
FT                   /translation="MSYLLNHPGLMWQLTQEHLAMVGMTLGMAVVLAVPLALLVHHVRW
FT                   LALSVMGILSILYTVPSLALIILLVPWLGLNARSVVVAMVIYTQVILVRHFCVGLRSVE
FT                   PAILEAAKGMGMNLWQRWWQVQVPLMLPIVLAGLRLAAIVAIAIATVGAKFGAGGLGTL
FT                   LFDGIAQAGRYDKIWAGSLAVGSLALLVNTALLSLEWAARRG"
FT   gene            588838..589461
FT                   /locus_tag="CYB_0582"
FT   CDS_pept        588838..589461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0582"
FT                   /product="RNA polymerase sigma factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01573"
FT                   /db_xref="GOA:Q2JNT2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT2"
FT                   /protein_id="ABD01573.1"
FT                   /translation="MRDWSSRADWELMEALKAGQPAALAALYDRYAGLVYGLAFKILGH
FT                   VAEAEDLTQEVFVELWRKVGCDPRTPSESRERRGSLSSFLCILTRSRAIDRLRSQGSHQ
FT                   LLLKRWQTILSADRVSGTESFSKTRFPFEQVSIEERRQAVQAALSQLPENQRQILELLY
FT                   YQGLSQADIARQLGIPLGTVKTRSRQALCKLRGSLRALLGFCSR"
FT   gene            589588..590358
FT                   /locus_tag="CYB_0583"
FT   misc_feature    589588..590358
FT                   /locus_tag="CYB_0583"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            590399..591046
FT                   /locus_tag="CYB_0584"
FT   CDS_pept        590399..591046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0584"
FT                   /product="VanW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01574"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT1"
FT                   /protein_id="ABD01574.1"
FT                   /translation="MGALLALLALWWTDPTPTTLSQYVTSLQERTPSQLHNIRRAVQSL
FT                   DGVYIMPATRSQEQAEVIFSFNQVVGPRSLERGYVPAPVFMVAETLDSVGGGICQVSSS
FT                   LYNAALLAGLEVVERHPHYRQVESVPPGLDATVWYGLADLKLRNPFPWPVRLRVQIRGP
FT                   NLIVSVLGRGSRHALRIPPIRVEGHRLDPQHLQVSVYRGNERLSQDRYVVAP"
FT   gene            complement(592183..593079)
FT                   /locus_tag="CYB_0585"
FT   CDS_pept        complement(592183..593079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0585"
FT                   /product="putative CRISPR-associated protein, APE2256
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR02619"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01575"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNT0"
FT                   /protein_id="ABD01575.1"
FT                   /translation="MQTIIMTVGTSLLTNPDKNLEPQRPWLGQKTIGDPEQALAWMKRT
FT                   DLELISAETNTYLQLDPTSNDALILLHSETPDGLECAQILKLFFEQELGQQQVSLVPLP
FT                   GINYELEGSSLERMAELLKQLAESARGIVTFAATGGFKAQAMIMAVVGSQLGVPVCYIH
FT                   EQYKSLVYLPYLQPQVQPRIPRADLPDSGRDRSQIIQIRSDASHHRPRSWAKVERLLRD
FT                   IPWVDLVRYDPHAYAAPKNSVKASNRKTEDGRHILWIHLHESQDTHLAVRVETTGYTPE
FT                   HLELAATELRQRLGRLL"
FT   gene            complement(593129..593842)
FT                   /locus_tag="CYB_0586"
FT   CDS_pept        complement(593129..593842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0586"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01576"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS9"
FT                   /protein_id="ABD01576.1"
FT                   /translation="MLSDTVDLSPQSWDLAHGIAMTLAKERVDVDELSKCIAYLRSVAH
FT                   HPDAGSRFFRFTGELVRETGLHRSNETPRYYRLIDQTCKKYLQSLQDRPAEMLQILGWA
FT                   ARLARYYKDGGVPIGEIPPPQGSQPNDNSGRKDSVPQGAGNKSQDDRQQQNHQHQQDQA
FT                   QHQARKARFQTGQKLKATITNIKGNEVTFQILDTDTKLTQKEPKRAGSLSVGQEVQVEV
FT                   LGLKEDGRIRKAKLL"
FT   gene            complement(593853..594932)
FT                   /locus_tag="CYB_0587"
FT   CDS_pept        complement(593853..594932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AC1990"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01577"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS8"
FT                   /protein_id="ABD01577.1"
FT                   /translation="MTPQGPRPLPNQAASARSSAGNSSRGGGNPTVSPKPYELIPFPTQ
FT                   PPKLERPAGHAQFHPDRLHGTLFLTLTVQTAVHISTGHLALGSDVGVKGIPVLKTMTTT
FT                   PNGRLKIQGSSLKGAIRAMYEAITNSTLAVMTSRYRNRIPPERHPCRNKEQLCPASRVF
FT                   GALNWQGLVEFRDAIATSAGSGGGSLPPLYRPRPDQCKAYFQKENGRVIGRKFYYTHRN
FT                   ALQDSSRGTPTQQAIQNTVFKTQIHFKNLTPAELGTLLTVLGQDPKHSMLLKVGGGKPV
FT                   GLGSLQVTLDKIERPGNLKDRYSRYDPPEADTLEGKRLQAFVQEQIGAAQGYILPEQLK
FT                   RLAAILSPTALREPPTGVY"
FT   gene            complement(594935..595387)
FT                   /locus_tag="CYB_0588"
FT   CDS_pept        complement(594935..595387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AD1990"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01578"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS7"
FT                   /protein_id="ABD01578.1"
FT                   /translation="MKPAYVASLKIQDGAESSLSQVLSACFSTSEKTYSFLRWPHRVSG
FT                   IQVGIPADPVCPEGQVFSQQGELRWKSTPHGWDLLYLGIQAPPDSFIPLPGEWRWEDHA
FT                   ADLYGSQNRETRFPKPLSHPQDLKVGQRYFRDERTARVHFIALIPR"
FT   gene            complement(595384..596364)
FT                   /locus_tag="CYB_0589"
FT   CDS_pept        complement(595384..596364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0589"
FT                   /product="CRISPR-associated RAMP protein"
FT                   /note="identified by match to protein family HMM PF03787"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01579"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS6"
FT                   /protein_id="ABD01579.1"
FT                   /translation="MHKRYVNHCTLCLTLKPDGPVLIKAGKEGADPTKPDMEFVETYHG
FT                   GGRTVYFPGSSLKGAIRAHAERIVRTVGSDRRPEGGGFKLWASDPLDQKANQWLEKIEE
FT                   PHQVYALSSFTDQMFGNTAIASRVRIEDAYPKPGTPLRLEERNGVAIDRVFGSVAVGLG
FT                   PFSYQVCVEGSFQTKIHLKNFTLAQLGLLGLALRDLDEGWFGIGFAKSRGMGTVRVEYE
FT                   WATVDYPGCLVDEANRQIRLLGSPLTWPQGSLLGAGEFLTPEEAGKYGFPKPDCQAVPV
FT                   GAEPMPLGFGARLTWDQTSEAKVEHLLATAVNSWAKLLQAEAKAV"
FT   gene            complement(596531..597382)
FT                   /locus_tag="CYB_0590"
FT   CDS_pept        complement(596531..597382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0590"
FT                   /product="CRISPR-associated RAMP protein, SSO1426 family"
FT                   /note="identified by match to protein family HMM PF03787;
FT                   match to protein family HMM TIGR02581"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01580"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013411"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS5"
FT                   /protein_id="ABD01580.1"
FT                   /translation="MFDVFKNRLEITGTLTTVTALHIGVGRSTEPIGSDLPVLKDALGR
FT                   PLIPGSSLKGAMRSRLESFLRGINPELARDPGELTSSEQFQIINQIKNDYKGDDAALTQ
FT                   KLIEATDWVSQVFGSPWLAGKVQIRDLPVVPEAWFGQYQERDGVAIDRDTETAADGKLY
FT                   DLQVVPASTPFRFHAVVENAEEWELGLLAIGLHQLETEQIPLGGGRSRGLGVVRLQISA
FT                   IYWFDSEGDPRRLLAYLQELVAGSRQPLSPEQAAALRQDWVEALVAKLTTASQRQSVGP
FT                   RR"
FT   gene            complement(597402..598049)
FT                   /locus_tag="CYB_0591"
FT   CDS_pept        complement(597402..598049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01581"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS4"
FT                   /protein_id="ABD01581.1"
FT                   /translation="MTYSSFTLERAISTFQLRSRIIHGLFAEVPLTECSDYLKITLDRY
FT                   LGLATSVNSEKARSEFIIAPVLGEVKYLCRDQISLFSGKEFNVDPERGLVGLCDYIICL
FT                   SPLQLYIQDPVVIIVEAKKEDLIGGLGQCVAGMVGAQVFNKNSNSQVDSVYGAVTSGTN
FT                   WRFAKLEGDQLFIDDREYFISEIAQILGILLSFIKGSVSLREWQTSAVQALT"
FT   gene            complement(598053..598493)
FT                   /locus_tag="CYB_0592"
FT   CDS_pept        complement(598053..598493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AG1990"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01582"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS3"
FT                   /protein_id="ABD01582.1"
FT                   /translation="MTFATSEITSEQELKIQRQIRLAEDDLVARIQAALDNFRGLNRLE
FT                   EAQYRNLLHVAASTESSEVIKNFLRYQVGRGDKWGRGKDSLAEAIIKDIDNWIHQRAIA
FT                   IAREAGIERASPKVNEIKIDLIRRYLGYGARYLKYKREGGGS"
FT   gene            complement(598490..599722)
FT                   /gene="csx10"
FT                   /locus_tag="CYB_0593"
FT   CDS_pept        complement(598490..599722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csx10"
FT                   /locus_tag="CYB_0593"
FT                   /product="CRISPR-associated RAMP protein, Csx10 family"
FT                   /note="identified by match to protein family HMM PF03787;
FT                   match to protein family HMM TIGR02674"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01583"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS2"
FT                   /protein_id="ABD01583.1"
FT                   /translation="MEAIQLTLTAQSPLAIGRQKPGGSISEAQDYIPGSVIRGALADLM
FT                   LSQTQHRPAEALEGDLAALFTAARPAVFTHAYPGSGSKVLPATAFSSKNNPGFRSEAGK
FT                   TGVFDTLLDRFCSQRLGIPFDPTEPDGSGGRVEPFGGFYSQQESDLGPRYERAAVSKRL
FT                   LTRVGINRRRATAADQILYSLEVMNEGKARPNGHLERSLFSGYIYLRDPKLAETLTRYL
FT                   NAHAHLLRLGGGVSRGLGRVNVTARCLAAPRPSLAQRVEAFNQKLRQRWQQWQVFGDPW
FT                   QPLPPERQYFSIGLQSGAILKERWQRTTVLTPPMLQEEANCEDGSLVLELACSSYAYVS
FT                   GWNAAWGLFKDVELVTTQGSVFLLSTTQLERWIPILAEMEYWGIGERTAEGFGQIEVCS
FT                   PFHHHFWENPL"
FT   gene            complement(599722..600444)
FT                   /locus_tag="CYB_0594"
FT   CDS_pept        complement(599722..600444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0594"
FT                   /product="CRISPR-associated RAMP protein, SSO1426 family"
FT                   /note="identified by match to protein family HMM PF03787"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01584"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS1"
FT                   /protein_id="ABD01584.1"
FT                   /translation="MVRLAELPQAGRTITSIPLRATLASALAVGAGGSSGSLADKPLLK
FT                   DAFGRLIIPGSQLKGRLRHECEKLARGLGWAICRSPDPERMCPQREGSAGNFHRPEYQV
FT                   EGYAGSHCLVCQIFGNPALPARLWVEDLVCEVPPAALEPTLRPGVTLNRRRRTAEDQRL
FT                   YLIETSPAAELTFSGSLQLLPDCPSWGKTLLLAALHHLIALGGSKSAGLGWLHWDPGSL
FT                   QALQPTAADWAFLAQGGS"
FT   gene            complement(600444..602654)
FT                   /gene="crm2-1"
FT                   /locus_tag="CYB_0595"
FT   CDS_pept        complement(600444..602654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crm2-1"
FT                   /locus_tag="CYB_0595"
FT                   /product="CRISPR-associated protein, Crm2 family"
FT                   /note="identified by match to protein family HMM TIGR02577"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01585"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNS0"
FT                   /protein_id="ABD01585.1"
FT                   /translation="MRAAVRADNEAGIPEELRPILAQVRQFQESMAAKTFPRTPAELQS
FT                   RYPELWQQTTRIGLVYGGATKIKSYVFESAKLSEIRGASALLDRINLVDLPAFFGDPEQ
FT                   TYLGWEGLGKESQAELRAYVAEQIRPWLQQHYPALAQALIPELIIYSTGGNLLAFCPAA
FT                   HVDDLCEAIERRYTEETLTANACAVGSAFRLLELRYGLLRDPIERTPWLDWLAQHKTHP
FT                   LVRAYFGDGSEARFQDRKSFNELVGYLAARFNHRRNGNPDPGRPSRAHPAFFETHPYLR
FT                   RDSTDRRPAIAKADLVDQPWLSEATARKALVGRQAKRIETGKQGWFRKFPTWDPGFVES
FT                   WVTRFARFLNSPAGEPYRERYLQPHQGSVQGIGEAQSLREVANASLGSQGFVAYLYADG
FT                   NDMGGYVQQIQTPEAYRQFSRDVSEATEKAVYHALAQHLQAHRLHGLSPDPETGRDRNG
FT                   EWIHPFEILTIGGDDVLVVVPAHKALEIAATFCEQFEQLLLDTSATYAAQSSGKVPHRY
FT                   PAADRKLCRLSASVGVLIASEDTPIYYAEKLTEQLLKSAKSYAKKLKPKDKDCSVATID
FT                   FLSLKSVALVVSSIQDFRREALEIRQNSHTLKLYAGPYTVPEIHGLLRTVQALQEANFP
FT                   RSQLYQIRSFLEKGKRTATLNYLYFRSRLGKKGQPLMEAFERTWCKAKTNDGHLPPWMY
FT                   VEPQVSSSTPTYETIWRDLVDLYAFVQKQPQAEGRPVLAEVE"
FT   gene            603175..604356
FT                   /gene="cas6"
FT                   /locus_tag="CYB_0596"
FT   CDS_pept        603175..604356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas6"
FT                   /locus_tag="CYB_0596"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="identified by match to protein family HMM TIGR01877"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01586"
FT                   /db_xref="GOA:Q2JNR9"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR9"
FT                   /protein_id="ABD01586.1"
FT                   /translation="MLIVAVDWEWAVPMLSFSEPSADREANGKWPTGSELVGITLEVQA
FT                   PRSYLLDPHYAKGLHAWFLSQVQETDPQLSAYLHDGESEKPFTLSRLMGPFREQGGRPL
FT                   IPPHLPFRWWITGLNPPVVEWLRGWCQRLPTWLELRGSPLQILGWQISIPPRTYRQLLE
FT                   QPLSPRSWSLSFVSPTSFRHRGHHLPLPIPRNLFHSYLRRWNDFSGLPIEAEPFLDWVD
FT                   GEVIIQRHRLESVKTTAGRQGSVTGFIGCVQLAVSSRAPELLQQQLQALIHLAPYCGTG
FT                   HKTPFGLGQTRLGWLAEELPASPVPSREEQVAQRIEELSALFLSQRQRQGGSRAEKTAQ
FT                   LWATILARREGGESLQQIAADLEMPYETVKTYAKLARRSLQSGSQDYSSSSLP"
FT   repeat_region   complement(604651..605267)
FT                   /rpt_family="CRISPR"
FT                   /note="GYMB_CRISPR03"
FT   gene            605551..606744
FT                   /locus_tag="CYB_0598"
FT   CDS_pept        605551..606744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0598"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01587"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR8"
FT                   /protein_id="ABD01587.1"
FT                   /translation="MTQVLTVSCKLKVSQSQAAKLDATMEAFGQALNWVNQNTPEKVAN
FT                   AVKLQSLCYREIRARFGLSSNLAQQVCRRLAGARKVARQKNRPVKVFKGGFATYDARIF
FT                   SFREKDWTVSLTTVEGRERFELAIGRYQREQLTGSNPKSATLVKRKDGSYFIQICVEAE
FT                   PSPPQRTGRVLGVDLGRTDIAHTSEGDNWNGQQLNKVRDHYSRLRAVLQRKASKGTRSS
FT                   RRRCRQLLQRLSGKERRFQAWVNHRISKAIVSRAKTTNSAIALEDLTGIRERVNQQPRG
FT                   KTECRRANSWAFYQLRMFVAYKAAIAGVPVVLVSPAYTSQTCHRCLHIHPDPTQSYRSG
FT                   KSFKCGHCGWEGDADLNGANVIALLGAVVNQPRGPGLFCSLVEQNRLRATESPLRTA"
FT   gene            complement(606716..608173)
FT                   /locus_tag="CYB_0597"
FT   CDS_pept        complement(606716..608173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0597"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01588"
FT                   /db_xref="InterPro:IPR023816"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR7"
FT                   /protein_id="ABD01588.1"
FT                   /translation="MSGFELPLTVEVLRWLAGGQLAERLERAVRLWVLLHCLYGENRWP
FT                   DLPETFGYTHIRDRLLSPRHPKQDLAQGIPSPCPDVDCICWKPLRFWLKDPNLLAALKV
FT                   EVPDLEALLSARPFHKTHRTLRKELDYLAAQGWLQQIQANPKRRDNFRCCAPGAHPQLP
FT                   APSSTWTLSGKQLEQIYHILSDVAFVHPDVQVLLDEIWANQRTPSRWRDQHSQRRLFVW
FT                   FEYILSDEQQERVDEYQSQLEALWANPEAGVIGFDYATRQHGIRHVLTYPVCLFYARRA
FT                   KYLAAFGQLPTPEGSLGWHNFRLDRIQSERLAVIPWDAPSIPPELAIRKRQKKLPSPEE
FT                   VQAAWEEAWGSDFYLPKALLILRFSPEFARRYVESTVRHPTFQPIAYERIPALVQQAVA
FT                   DAREREQILNIVRQRPTSDRYFRAWVRVGDTNFTMRLRDWRPNGEVIAPLAYREQMARE
FT                   AQAELQFYRPDVNYPAPTAKRYGAGFQ"
FT   gene            608339..609307
FT                   /gene="csx3"
FT                   /locus_tag="CYB_0599"
FT   CDS_pept        608339..609307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csx3"
FT                   /locus_tag="CYB_0599"
FT                   /product="CRISPR-associated protein, Csx3 family"
FT                   /note="identified by match to protein family HMM TIGR02579"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01589"
FT                   /db_xref="InterPro:IPR013409"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR6"
FT                   /protein_id="ABD01589.1"
FT                   /translation="MAAVALHLLSGCLAARASGTESFRASGTESLDPRRSHSSELSFQV
FT                   IEIELTRPDRLVFPEDLAQLQLPAGINAQLGVVLTGRAPIWLYGWLVHECHFTRWVACY
FT                   DPRLGAVVVSSHTPEVRVGQVIPWVQGRPGKAYGPLTRTELAAAVMVVGPPDSGKSRLA
FT                   RALFEALLPEHPDIYLQRAHWDGEGNWTLDLPPEEAKILKHQYRGSFTPEFFSFHAQAI
FT                   LALRRQKSLVIVDVGGKVDPQKQPILEACSHYLVVSRDPEAIPLWHEFCRDRGNLRCVA
FT                   ILHTSPGPPQVLKDSPELEIRWDPNSPPPAELLRAVRRLIA"
FT   gene            609411..610202
FT                   /locus_tag="CYB_0600"
FT   CDS_pept        609411..610202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0600"
FT                   /product="ADP-ribosylglycohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF03747"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01590"
FT                   /db_xref="GOA:Q2JNR5"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR5"
FT                   /protein_id="ABD01590.1"
FT                   /translation="MLGAIAGDVIGSVHEHSGTKTKNFPLFVEASQFTDDTVLTVAVAE
FT                   RLLRGGSYVDWYHEYFHAYPEAGYGSSFIHWAEHRCREPYYSWGNGAAMRVSPIGIACN
FT                   TLEEVLAQARASAEVTHNHPEGIRGAQATAAAVFLARSGYTKADIKTYIEQEFGYCLSE
FT                   RLDDIREHYCFDVSCQGSVPQSIIAFLEADGFEDAVRNAISLGGDADTMACIAGGIAEA
FT                   FFGGVPDEIASRTLAVLDERLHGVVCEFQERFADRLTRGCT"
FT   gene            complement(610278..611165)
FT                   /locus_tag="CYB_0601"
FT   CDS_pept        complement(610278..611165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0601"
FT                   /product="nitrate ABC transporter, ATP-binding protein
FT                   NtrD"
FT                   /note="identified by similarity to SP:P38046; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01184"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01591"
FT                   /db_xref="GOA:Q2JNR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR4"
FT                   /protein_id="ABD01591.1"
FT                   /translation="MTALLTTSTPANVAAEPYLSLENVSKTYSTPKGDYPVLRDINLSV
FT                   NEGEFVCLVGHSGCGKTTLLNMVSGFAQPTSGSVKLKGQPITAPGPERMVVFQGYALLP
FT                   WLTVYENVYLAVRSVFPQKSQSEKHRIVEEHLDLVGLGEAAQKYPSQISGGMKQRVAIA
FT                   RALAIRPEVLILDEPFGALDAITKEELQEELLRIWDEHRCTVLMITHDIDEALFLADRL
FT                   VLIAPAGRSPFAPAGRSPLTNGPAATIGQIVTIPFPRPRDRERILEDPQYYRLRNSVLS
FT                   YLYGHEANPEAAYR"
FT   gene            complement(611237..613234)
FT                   /gene="ntrC-2"
FT                   /locus_tag="CYB_0602"
FT   CDS_pept        complement(611237..613234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC-2"
FT                   /locus_tag="CYB_0602"
FT                   /product="nitrate ABC transporter, ATP-binding proteins
FT                   NtrC"
FT                   /note="identified by similarity to SP:P38045; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01184"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01592"
FT                   /db_xref="GOA:Q2JNR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR3"
FT                   /protein_id="ABD01592.1"
FT                   /translation="MSVLVSVEQVEKSFPLSGGQEYLALKGIDLQIHRGEFVSLIGHSG
FT                   CGKSTLLNMVAGLSLPTGGIVALDGHTITAPGPDRMVVFQHYSLLPWLTVRQNIALAVN
FT                   AVLKNHSPAERQQIVEEHIDLVGLRHAADKLPAQLSGGMKQRVAIARALALRPKVLLLD
FT                   EPFGALDALTRGNLQEQLIRICEEHQMTTLMVTHDVDEAVLLSDRVVMLTNGPGSRIGN
FT                   ILTIDIPRPRRRLEVVNHPSYYSYRSEIIYFLNQQKRIKQWRARRSTVVAKHGLEKINL
FT                   EIGFVPLTACAPLAVAKEKGFFAKHGLEEVNLVRETSWRGIQDDIQGGYLDAAQMPAGM
FT                   PVWMSLGGGDNPPQPVVTALTLTRNGNAITLHKRFYEQGIHTLSQLKAYILDSPSRRLT
FT                   FGVVHPSSMHNLLLRYWLAAGGIHPDHDVVLKTLPPAQMVANLTAGNIDGYCVGEPWNL
FT                   RAALEGSGFTVATDLEIWLGHPGKVLGVREDWARAYPNTHIALVKALLEACRYCEDPAH
FT                   HDEIRELLSRRAYLSTDPSYIHLGDPQRLICDLDRPMREYAHHRFFLGAGNRPSRTEHL
FT                   WMMTQMARWGDLPFPRNWVEIVERVCQVGVFSTAARELGLDVSYQRQPIQLFDGIPFNG
FT                   EDPLAYLNSLAIKHDIYVAEVALDRRPVLL"
FT   gene            complement(613303..614130)
FT                   /gene="ntrB-2"
FT                   /locus_tag="CYB_0603"
FT   CDS_pept        complement(613303..614130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB-2"
FT                   /locus_tag="CYB_0603"
FT                   /product="nitrate ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:AAB86903.1; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01183"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01593"
FT                   /db_xref="GOA:Q2JNR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR2"
FT                   /protein_id="ABD01593.1"
FT                   /translation="MTTTLSSPAKSATAKFDLAKYRDQILPPVVGIVGFLLIWQILASA
FT                   NLIRLPGPWDVWMDERSRYLILHPLYRNSDLDQGLLRQTLASLQRVAIGYCSAALVGIT
FT                   LGILVGSSVWINRALDPIFQFLRMVAPLAWVPISLAALQRNEPAALFVIFITSIWPILI
FT                   NTAVGVRQIPEDYINVSKVLKLSKVDFFFKVLLPSALPYMFTGLRIGIGLSWLAIIAAE
FT                   IVMSGVPGIGFFIWDAYQQNYVTEIIVAVIYIGAVGLLLDRLMSVLQNKIANQ"
FT   gene            complement(614652..615956)
FT                   /locus_tag="CYB_0604"
FT   CDS_pept        complement(614652..615956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0604"
FT                   /product="nitrate/nitrite/cyanate ABC transporter (NitT)
FT                   family, periplasmic substrate-binding protein"
FT                   /note="identified by similarity to SP:P39660; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01594"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR1"
FT                   /protein_id="ABD01594.1"
FT                   /translation="MTSRRNFLLSAGAATVGGLVSGSLARASTGYWVAQASGPETPNLR
FT                   LGFIPIVESAPLIIAKEKGFFDKHGMTGVEVLKQASWPAARDNVVIGSAGGGIDGGQWQ
FT                   MPMPHMIHIGAITNNQPVRMAVLCQLITQGNGIAIAGMHAGKGLGLDISGAADYIKNFS
FT                   ASNGRKFKAAYTFPNANQDFWIRYWLAAGGVDPDQDIDLLAVPSAETVQGMRNGTMDAF
FT                   STGDPWPYRIVADGIGFMAALTQQIWPFHPEEYLAIRADWVEQNPRATQAVLMAVMEAQ
FT                   QWCDDPANREELTRILSGRAYLNVPVEVLTPPFQGNYELGDGKPAVQDFNAGPLYWEDG
FT                   RGSVSYPYKSHDLWFLTESLRWGFHARFLPDLDTARRLVDEVNREDLWREAAQALGVKN
FT                   IPNNTSRGTERFFDGVVFDPQDPQAYLNSLKIKRV"
FT   gene            616167..617264
FT                   /locus_tag="CYB_0605"
FT   CDS_pept        616167..617264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0605"
FT                   /product="putative tocopherol cyclase"
FT                   /note="identified by similarity to SP:Q94FY7"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01595"
FT                   /db_xref="GOA:Q2JHM4"
FT                   /db_xref="InterPro:IPR025893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM4"
FT                   /protein_id="ABD01595.1"
FT                   /translation="MAFPPTAACSGQNNSTDWGSLPHAGYHWDGCTERFFEGWYSRVTL
FT                   PGDPPISFAFMYAIDPKRGGMAQVLGPEEELHWRTFPNPRRFWASSTHLALGHSGIPGP
FT                   GCRGLQDPFTFFQRTASGYQYTAHLNQGILPDPLGSEPIRWLYRIQPRFAYGIPPRATM
FT                   GAWSYLPIFEPGWQILMSHGLATGWVEWRGRRYAFQQAPAYAEKNWGQSFPRRWFWIQC
FT                   NAFPQHPGLSLTCAGAERQVLTRPEEVALISLHGWGSQPFLEWRPGSARLTWQVDPWGS
FT                   WRIRGESALWCIQLEGHTRRPGQTVFAPGPEGMQRNCRDTLAGHLHLQLWQRNGQVWTP
FT                   VIKATSPQAGLEVGGEVRQPWQGQC"
FT   gene            617440..617513
FT                   /locus_tag="CYB_0606"
FT   tRNA            617440..617513
FT                   /locus_tag="CYB_0606"
FT                   /product="tRNA-Arg"
FT   gene            617632..620106
FT                   /gene="clpC"
FT                   /locus_tag="CYB_0607"
FT   CDS_pept        617632..620106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="CYB_0607"
FT                   /product="Clp protease, ATP-binding subunit ClpC"
FT                   /note="identified by similarity to SP:P37571; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01596"
FT                   /db_xref="GOA:Q2JHM3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM3"
FT                   /protein_id="ABD01596.1"
FT                   /translation="MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVA
FT                   AKVLKSMGVNLKDARIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG
FT                   TEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTAGGGSSSRTKTPTL
FT                   DEFGSNLTQLAQEGKLDPVVGRTREIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QRIVQGDVPDILADKRVISLDIGLLVAGTKYRGEFEERLKKIMDEIRNAGNIILVIDEV
FT                   HTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIERDAALERRFQPIMVG
FT                   EPTVSETIEILFGLRERYEQHHKLKISDAALDAAAKLADQYISDRFLPDKAIDLIDEAA
FT                   SRVRLINSQLPPAARELDQELRRVLKEKDAAVRAQNFDKAGELRDREMEIKQQIRAIAA
FT                   AKKAEESSRSEMPEVTEEDVAQVVSAWTGVPVAKLTESESVKLLNMEETLHQRIIGQDE
FT                   AVRAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKTELTKALAAYFFGSESAMIRLDM
FT                   SEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNLLLQI
FT                   LEDGRLTDAKGRTVDFKNTLIVMTSNIGSKVIEKGGGSLGFEFNTNDEDANYNRIRNLV
FT                   NEELKQYFRPEFLNRVDEIIVFRQLTKDEVKQIADILLKEVFDRMTEKKIRLTVSDRFK
FT                   DLVVEEGYNPSYGARPLRRAIQRLLEDILAEEILTGHVREGSEVLIDVDEERKPKVLVT
FT                   EPERVLLPQGAE"
FT   gene            620234..620869
FT                   /gene="clpP-1"
FT                   /locus_tag="CYB_0608"
FT   CDS_pept        620234..620869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-1"
FT                   /locus_tag="CYB_0608"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01597"
FT                   /db_xref="GOA:Q2JHM2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JHM2"
FT                   /protein_id="ABD01597.1"
FT                   /translation="MVQSTYYYYGGAPVRTPPPDLASLLLQERIVYLGLPLAEESNANV
FT                   TKLIIEQLLYLQYEDREKPIKMYINSTGTYNYDTAAFAILDTMNYIKPPVHTICIGNAI
FT                   GMAAMLLAAGAKGFRASLPNATIVLHQPYGGTRGQASDIEIRTREILTLRNMMLEQLSR
FT                   STGQPMERIKKDTERLFFMTPEEAKAYGLIDQVLTSSKGVPKLAAAKN"
FT   gene            620887..621535
FT                   /pseudo
FT                   /locus_tag="CYB_0609"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            621483..622094
FT                   /gene="clpP"
FT                   /locus_tag="CYB_0610"
FT   CDS_pept        621483..622094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="CYB_0610"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by similarity to SP:P19245; match to
FT                   protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01598"
FT                   /db_xref="GOA:Q2JHM1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JHM1"
FT                   /protein_id="ABD01598.1"
FT                   /translation="MPIGVPRVPYRLPGEPYSQWISLDDRLYQERILFIGEPIDDSLAN
FT                   TIVGVMLYLNSQDPQKDIVMYINSPGGSVTAGMAIYDTMNHIKPDIVTVCVGQAASMGA
FT                   FLLAAGTKGKRFALPHSRIMLHQPSLGTIQGQASDIEIRARETLRVKRRMNEILAQTTG
FT                   QPLEKIERDVERDFYLSATEAQAYGIVDRVIQERSEAMAS"
FT   gene            622202..622504
FT                   /locus_tag="CYB_0611"
FT   CDS_pept        622202..622504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01599"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNR0"
FT                   /protein_id="ABD01599.1"
FT                   /translation="MGQRLWSAGLGCCAGLLLLWPEAWALPPADEIPEEVLRAQPDLRA
FT                   PSPVDNQPLTAAEALELQEALAARPETGSVSPEVERLIFLLRLRKGFRDLFPFLF"
FT   gene            complement(622509..623096)
FT                   /locus_tag="CYB_0612"
FT   CDS_pept        complement(622509..623096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01600"
FT                   /db_xref="GOA:Q2JNQ9"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ9"
FT                   /protein_id="ABD01600.1"
FT                   /translation="MVDEKSASDLHTLANWLEGYYSNRTQAMAEPVWFVPVSLWYVRLP
FT                   HLFSEGIGFFTEQFNQHTPGQFYRSRVLQVLGDPLRIENYKLRDQAAWAGASQDPQRLA
FT                   QLSLADLEHLPGCRILVEKRPDCYHGEMLPGGECRLNPGDSTYIHIEFDLTPSEFITWD
FT                   RGFDAATGQQTWGSRAGPYRYQKGIPPAPLQV"
FT   gene            623105..624499
FT                   /locus_tag="CYB_0613"
FT   CDS_pept        623105..624499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0613"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01601"
FT                   /db_xref="GOA:Q2JNQ8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ8"
FT                   /protein_id="ABD01601.1"
FT                   /translation="MTKLTPSSSYSIALRIRLLNQPGALARVTQAIAEVGGSLSQIDLI
FT                   HQSAAETVREICVDAVSSEHAQQIYTAVASLANVKVERVVDRTFELHRGGKLQVVAKSP
FT                   LESAADLAMAYTPGVGRVSLEIAANPAAVYEYTIKGNSVGIVTDGSAVLGLGNVGPEAA
FT                   LPVMEGKAALFKRFADIDAFPLCLATQEVGEIVETVVRLAPGFGGFNLEDISAPRCFAI
FT                   ESQLKARLNLPVFHDDQHGTAIVVLAALLNALKVVKKSLDEVRIVLNGAGAAGIAVTQL
FT                   LRRAGAAHILVCDRQGILSRSRSDLTPEKAAIAVEEKGSLAEALVGADVFIGVSVANAL
FT                   TVEMVEKMAPDPIVFALANPVPEIQPELVGNRVAVMATGRSDYPNQINNVLAFPGVFRG
FT                   ALDCRAKQINTEMCVAAAQAIAALIPAEELDPQWIIPSVFDGRVVPQVAAAVIQAARQT
FT                   GVAGIP"
FT   gene            complement(624600..625292)
FT                   /locus_tag="CYB_0614"
FT   CDS_pept        complement(624600..625292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0614"
FT                   /product="putative CRISPR-associated protein, APE2256
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR02619"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01602"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ7"
FT                   /protein_id="ABD01602.1"
FT                   /translation="MKLFFERELGQQQVSLVPLPGIDYELEGSSLERMAELLKQLAESA
FT                   KGIVTFAATGGFKAQAMIMAVVGSQLGIPVCYIHEQYKSLVYLPYLQPEVQPRIPRAGL
FT                   PDRASGTESYRASGTESFSGRPRSEVIQLQVDSSHHRPRSWVKVEKLLRDIPWVDLVRY
FT                   DPHAYSAPKNSLKAANRKTEDGRHILWIHLHESQDTHLAVRVETTGYTPEHLEQAAAEL
FT                   RERLGRLV"
FT   gene            complement(625289..625561)
FT                   /locus_tag="CYB_0615"
FT   CDS_pept        complement(625289..625561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01603"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ6"
FT                   /protein_id="ABD01603.1"
FT                   /translation="MQTIIMTVGTSLLTNLDKDLQPQRPWVGQKTIGDPEQALAWMKRT
FT                   DLELISADRASGTESLTNTYYRLDPTPGDALVLLHSAMGWSVPGF"
FT   gene            625763..625966
FT                   /locus_tag="CYB_0616"
FT   CDS_pept        625763..625966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0616"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01604"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ5"
FT                   /protein_id="ABD01604.1"
FT                   /translation="MGIGCFAVVCPAGARLPRLGERRPCDQSGCWAGIPGVAESRQQAS
FT                   PHSRSSGPCLAQDLQHLCRPVL"
FT   gene            626315..626986
FT                   /locus_tag="CYB_0618"
FT   CDS_pept        626315..626986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0618"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07758"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01605"
FT                   /db_xref="GOA:Q2JNQ4"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ4"
FT                   /protein_id="ABD01605.1"
FT                   /translation="MFYLPVSLLLFFMLVLLLPFLWLGLAVDVVALAVGKLGFSREGAL
FT                   LLLLAILVGSSVNIPLYRVKCEVTLVEDLASLWMRQFWGIPLTKLSQETVIALNVGGGL
FT                   IPVLLALYQFGRADSVLILAVTALVTLVSYYASHVVPGIGIQMNPLIAPATAALAALFW
FT                   AGDQAPAVAFAGGVLGTVIGADLLHLPEVLRRNCSGILSIGGAGVFDGIALCGLFALLL
FT                   S"
FT   gene            complement(626983..629181)
FT                   /locus_tag="CYB_0617"
FT   CDS_pept        complement(626983..629181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0617"
FT                   /product="peptidase, C14 family"
FT                   /note="identified by match to protein family HMM PF00656;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ3"
FT                   /protein_id="ABD01606.1"
FT                   /translation="MERRSFLQKLLLVAAGLGLSPGWLRGRAERYGQALAAGSRKLAVL
FT                   IGINRYLGEGSALQGCLTDVELQRELLLYRFGFDPADILTLTDGAATPAGIQSAFAEHL
FT                   GGQGHTAETVVVQFSGYGQWRLGSAPNCWQPVLLLSGSEGVAAMELDSFFRLLEGLGTA
FT                   QITTLLDCGFTYVSPSVRGNLQLRSRPPAAISDSKDSVPLARSEPQRVWPSPPKGLLIS
FT                   ATTPQDLAAEAAWPGFYAGVLTYLLTQYLWETTPATRLLVAFNQVVSRRELGLFACQRP
FT                   TLEGKDTARHIHPYFLMPTPAGVSGVVQEVKGNRAQVWLGGIPSAALCGLQPGTLLVPI
FT                   PADPSASSPTPLLMRSRSGLLAQVQMASPEGQLPPVGTPLREQLRGLSSTLKLLVGLEE
FT                   NLGRIEKVDLTNAIAGYSWMETANPRERQVDCLLGRITPEMAAAFRTPSRWRERSDTLL
FT                   KPLEVNSYSLFWPGRELLLNSCGPAGEAAAMAVQRLAPRLAHLLAAKRLRTTLNAVSSS
FT                   LAVVAELAVKGRAANRASGTESLAPSLAARLVQSATSAPAEVGMQRFTRGDPLHLTLCN
FT                   NSEQDLYGYLLLIDPTGQLHLLAPLPQDNFTTPLRLEAKSSLTLPPLPEVDGELRSAVS
FT                   SDLLTCHAQGLTELLFVASTRPLSASLEALKAMARKLGVARSPMLLNGPLEWTQTLLEE
FT                   LTQRASDRASGTESLGDPDLRWLDPAQSITLSLTYLLV"
FT   gene            629485..630702
FT                   /locus_tag="CYB_0620"
FT   CDS_pept        629485..630702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0620"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01607"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ2"
FT                   /protein_id="ABD01607.1"
FT                   /translation="MSQVLSISCKLKVSPSQAAKLDETLDAFGQALNWVNQNTPEKVVN
FT                   AVKLQSLCYREIRARFGLSSNLARTTSRLRDQQVCRRLAGARKVARQKNRPVKTFKGGF
FT                   ATYDARIFSFREKDWTVSLTTVEGRERFELAIGRYQRERLAGSNPKSATLVKRKDGSYS
FT                   IQICVETEPSPPQRTGRVLGVDLGRTDIAHTSEGDNWNGQQLNRIRDHYSKLRAALQRK
FT                   ASKGTRSSRRRCRQLLQRLSGKERRFQTWVNHRISKAIVSRAKATNSAIALEDLTGIRK
FT                   RVNQQPRSKAERRRANSWAFYQLRQFLEYKARVAGVSLVLVPPAYTSQTCHKCLHIHPD
FT                   PAQSYRSGKKFKCGHCGWEGDADLNGANVIALLGAAVNQPGGPGLFCSLVEQSRLRATE
FT                   SPLRTA"
FT   gene            complement(630674..630955)
FT                   /locus_tag="CYB_0619"
FT   CDS_pept        complement(630674..630955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0619"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01608"
FT                   /db_xref="GOA:Q2JNQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ1"
FT                   /protein_id="ABD01608.1"
FT                   /translation="MAQLFHLPSDDPLLADFVYCATFVLTCIWSWRRGQQAHLQMRRLW
FT                   GNWRAAIPWGSLLRVVPALVVLSIGTTLLMIYVNYPTPTAKRYGAGFQ"
FT   gene            complement(631020..631208)
FT                   /locus_tag="CYB_0621"
FT   CDS_pept        complement(631020..631208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0621"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01609"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNQ0"
FT                   /protein_id="ABD01609.1"
FT                   /translation="MGLKRPAKPSEKDLHPLPEKVTAAHLRGSPPNLKWENRDLCLCVW
FT                   IPPSTACRAECDRICSP"
FT   gene            631292..633211
FT                   /locus_tag="CYB_0623"
FT   CDS_pept        631292..633211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0623"
FT                   /product="ABC1 domain protein"
FT                   /note="identified by match to protein family HMM PF03109"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01610"
FT                   /db_xref="GOA:Q2JNP9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP9"
FT                   /protein_id="ABD01610.1"
FT                   /translation="MGATPVVTIAARQDGLGSGAVSIPPADLGVVPEPSLRYDPEQLAK
FT                   QYRGRWDLVVRRLFQLITPFLGLLAWVFWDRWRGVELKNRPKHAARLREILTELGPTAI
FT                   KIGQALSTRPDLVSPLFLEELAKLQDELPPFENAIAFALIESEIGKPIDKIFREISPEP
FT                   IAAASLGQVYQAYLHSGEKVAVKVQRPDLIGRISLDMYIVRSLAAWAKRTFRRIRSDLV
FT                   GIVDEFAGRLYEEMDYTQEGRNAERFLALYRHPSIYAPKIYWEYTRTKVLTMEWIDGIK
FT                   LTQVDKIAAAGLDGRHLIEIGVNCSLKQLLENGFFHADPHPGNLLAMYDGRLAYIDFGM
FT                   MSTIAPHQRYGLIKAIVHLVNRDFAGLAQDYVDLEFLDPDTDLTPIIPALEAVFAEAMG
FT                   KSVSELNFKSITDRLSGVMYDFPFRVPAYYALIIRSLLTLEGIAIGLDPNFKVLSVAYP
FT                   YVAQRLLTDPAPELRVSLRELLFNQGQFRWNRLENLLRNAVNSEDFDLQGSLEKAVDFI
FT                   FSERGAFLRERLVDVLFSSSGSQGGSDGLAHLQRLWELLSSNPSFQPLQLLPIVAKVAA
FT                   KPEAQQLGRQLASRWLQRSAARLIRDLLLPDTEKPSSPSSLNGRGGIPGPATSASTAQL
FT                   PLPA"
FT   gene            complement(633208..633606)
FT                   /locus_tag="CYB_0622"
FT   CDS_pept        complement(633208..633606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC90741.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01611"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP8"
FT                   /protein_id="ABD01611.1"
FT                   /translation="MPSEPKTRKSRESTNPRPRDRRRESAKGSKGSVSATHLSLPKLIQ
FT                   ENAVLQSRSQLLLMYSDFQTEMPNDGKTGVGTWLQSRLKEHGMPSLLRFGPRSRPQVFR
FT                   RDEFSEWITLALASVNPNSDTAPQEHLS"
FT   gene            634116..635006
FT                   /gene="tyrA"
FT                   /locus_tag="CYB_0624"
FT   CDS_pept        634116..635006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="CYB_0624"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by similarity to SP:P20692; match to
FT                   protein family HMM PF02153; match to protein family HMM
FT                   PF02254; match to protein family HMM PF02558; match to
FT                   protein family HMM PF02737; match to protein family HMM
FT                   PF03446; match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01612"
FT                   /db_xref="GOA:Q2JNP7"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP7"
FT                   /protein_id="ABD01612.1"
FT                   /translation="MCIAIVGLGLIGGSLALKLTEKGYSVWGISRNPATCKQALERGAV
FT                   QGCGTELAQLARFDPQMVLICTPLEQVLATLAALLPYLSAETVVSDVGSVKQPIVAPAT
FT                   ELWPWFVGGHPIAGKSLQGIQAAEADLFRGRPYVLTPIAETQPQALDAVKELIAAVGAE
FT                   AVLTDPARHDRAVAWISHLPVMVSASLIAAVSQEGDPAILELARTLASSGFRDTSRVGG
FT                   GIPQLGLEMARHNRQALLTALHSYQAQLRQIEQLIAGERWDELLLVLQRAQQEWQQFPV
FT                   NHPREILHNLGGGNG"
FT   gene            635075..635824
FT                   /locus_tag="CYB_0625"
FT   CDS_pept        635075..635824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0625"
FT                   /product="cytochrome c biogenesis membrane protein"
FT                   /note="identified by match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01613"
FT                   /db_xref="GOA:Q2JNP6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP6"
FT                   /protein_id="ABD01613.1"
FT                   /translation="MLNAAQLWLYHLEQWATELVQFQLQHLSPVSLLVVGLAGLLTSLS
FT                   PCTLSMLPVTIGYIGGYTPASEETAGEGRWQVWAQSLGFAAGVAFTLTLLGLSAALLGR
FT                   VYGQTGSFGPVVVGGIAILMGLNLLEVIPLRFPDWFNRLEIPGEWPRLGRAVLLGLTFG
FT                   LVASPCSTPVLVALLAWVSTTGQPWVGGGLLLAYGLGLAFPLLLAGVFTGLVKQLLALR
FT                   RWSGWLTYASGVVLVGFGSVTILSAWV"
FT   gene            635936..637345
FT                   /locus_tag="CYB_0626"
FT   CDS_pept        635936..637345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0626"
FT                   /product="cytochrome c-type biogenesis protein ResB,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF05140"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01614"
FT                   /db_xref="GOA:Q2JNP5"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNP5"
FT                   /protein_id="ABD01614.1"
FT                   /translation="MVIYSLPLARWVSSLRRYFRHELLPLLADLRLAIGLLLAIAVLSA
FT                   TGTVIEQEETAAFYQAHYPEHPALFGFLTWRVILSLGLDHVYRTPWFLAILILFGSSLA
FT                   ACSLTRQWPMLKRARRWSYLTRPQSFQRLPFRTYLPQQSLQGLPQQLRRQGYLVFQEGH
FT                   YLYARKGLIGRIGPILVHVSMLLILLGAIWGSISGFKAQELIPSGGVASIQHLTGAGDL
FT                   ARAHLPTWQIRANRFWIDYAADGRVKQFYSDLSILDQGQEVKRQTISVNHPLSYRGVTL
FT                   YQADWSIDSIRIRINNSPTFQIPVVPVRTEAGNKLWGAFVPTQPDMSQGLTLLLPDLQG
FT                   TALLYDTEGQWMGSLRQGMSLALDEVAPQRFPNPLTLYLDEVIGATGLQIKSDPGIPAV
FT                   YLGFGLLMVGVVMSYFSYSQIWALQTETGLYLGGKTNRALVTFEREFDRLVEQQKVAFS
FT                   LSQIPVEAEIG"
FT   gene            637687..637947
FT                   /locus_tag="CYB_0628"
FT   CDS_pept        637687..637947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0628"
FT                   /product="ferredoxin-thioredoxin reductase, variable
FT                   subunit"
FT                   /EC_number="1.18.-.-"
FT                   /note="identified by match to protein family HMM PF02941"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01615"
FT                   /db_xref="GOA:Q2JNP4"
FT                   /db_xref="InterPro:IPR004207"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP4"
FT                   /protein_id="ABD01615.1"
FT                   /translation="MKVGDRVRVRTSVIVYHHPEHRNQPFDLKGMEGELKAVIRDWNGR
FT                   PISANFPFQVQFDNKFRAHLQADELEVVESAGSGESAETAA"
FT   gene            complement(637944..638417)
FT                   /locus_tag="CYB_0627"
FT   CDS_pept        complement(637944..638417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:S76420"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01616"
FT                   /db_xref="GOA:Q2JNP3"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP3"
FT                   /protein_id="ABD01616.1"
FT                   /translation="MLTQLRELSIAADGRYLRDEELQFMETYLASFDLRLSAYRKIQAA
FT                   EAQIIRDVEMKMRALDPYLLMRGVEDFSNKWKADTVRVLRLSALAMLLDDEQRYKDRFL
FT                   YWFQTLMRAFRTQRSCEATYRFLQEVIANYLTPEETKLIRPILETNRTLLGLN"
FT   gene            638440..638562
FT                   /locus_tag="CYB_0629"
FT   CDS_pept        638440..638562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP2"
FT                   /protein_id="ABD01617.1"
FT                   /translation="MRMEKTPPILADGTALVPQSYPQTPGQKRGIAGIPGNPLS"
FT   gene            638633..639850
FT                   /locus_tag="CYB_0630"
FT   CDS_pept        638633..639850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0630"
FT                   /product="ISSoc1, transposase"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01618"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNP1"
FT                   /protein_id="ABD01618.1"
FT                   /translation="MTQVLTVSCKLKVAQSQAAKLDATLEAFGQALNWVNQNTPEKIVN
FT                   AVKLQSLCYYEIRARFGLSSNLARTTSRLRDQQVCRRVAGSRKVAKQKKRPVKEFKSGF
FT                   VTYDARIFSFRQKDWTVSLTTVEGRERFELAIGNYQRGMLAGSNPKSATLVKRKDGSYY
FT                   IQICVEKKPPKQQDTDKVIGVDLGRTDIAHTSEGDNWNGQQLNRVRDRYSRLRAALQRK
FT                   ASKGTRSSRRRCRQLLQRLSGKERRFQAWVNHRISKAIVSRAKTTNSAIALEDLTGIRK
FT                   RVNQQPRNKAERRRTNSWAFYQLRQFLEYKARVAGVSLILVPPAYTSQTCHKCLHIHPD
FT                   PAQSYRSGKSFKCGHCGWEGDADLNGANVIALLGAVVNRPRGPGLFCSLVEQNRLRATE
FT                   SPLRTA"
FT   gene            639992..641908
FT                   /gene="hflB"
FT                   /locus_tag="CYB_0631"
FT   CDS_pept        639992..641908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="CYB_0631"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01619"
FT                   /db_xref="GOA:Q2JNP0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNP0"
FT                   /protein_id="ABD01619.1"
FT                   /translation="MSQKGKNKKWRSAGLYALLAIVLISLATTFLGNRPPERLEISYSD
FT                   LISRVERGEVSKVLVETAPDGRQVAIAEAEINNRATQVQVNLPPLTPEFENTLVANGVE
FT                   LAVRPVQEEGLLGRILSTFFLPVLLLLGLFFLLRRAQNGPGSQALNFGKSRARVQMEPK
FT                   TQITFNDVAGIDQAKLELAEVVDFLKNSERFTALGAKIPRGVLLVGPPGTGKTLLARAV
FT                   AGEAGVPFFSISGSEFVEMFVGVGASRVRDLFEQAKQNAPCIVFIDEIDAVGRQRGAGL
FT                   GGGNDEREQTLNQLLTEMDGFEGNSGIIVIAATNRPDVLDAALLRPGRFDRQVTVDRPD
FT                   FQGRLEILKVHARGKTLSADVDLEKLARRTPGFTGADLANLLNEAAILAARRNLTEISM
FT                   DEINDAVDRVLAGPEKKDRLMSERRKELVAYHEAGHALVGSLLPNYDPIQKVTIIPRGQ
FT                   AGGLTWFMPSDDDMGLTTRAHLKNMMTVALGGRVAEEVVYGESEITTGAASDLQQVARI
FT                   ARNMVTRFGMSDRLGNVALGRQYANIFLGREIAAERDFSEETAALIDEEVRRLVNEAYQ
FT                   RATYLIRENRALLDRIARRLVEAETIDGEELQAIIDNSEVVMLPPEEEPEPLTLPMAVN
FT                   AGA"
FT   gene            complement(642012..644168)
FT                   /locus_tag="CYB_0632"
FT   CDS_pept        complement(642012..644168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0632"
FT                   /product="alpha-glucan phosphorylase, putative"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02094"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01620"
FT                   /db_xref="GOA:Q2JNN9"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN9"
FT                   /protein_id="ABD01620.1"
FT                   /translation="MLPEALTPLCEIARNYWWTWNPDHLTIFREMDPALWEKTSHNPVR
FT                   MLEEVSYLRLAALATDVNYLNTLNRMVQSYRQYMTAEDTWAKRTMKTYDWQRPIAYFCA
FT                   EYGLHESLPTYSGGLGMLAADHLKSASDLGVPLVAIGLLYRQGYFQQRLDNNGWQGELY
FT                   EDSEFESLPLTLVRQPDGSPLLVEVAMRQRLVKARAWRADVGRVPLFLLDTDLPENDPI
FT                   DRWITAHLYGGSTDTRIAQECILGIGGVRLLRQLGLDPMVYHMNEGHAAFLTLELLREE
FT                   VARGTPFETAEAKVREKCVFTTHTPVPAGHDAFSPNEMDAFFASFWPQLGLTREQFLAL
FT                   GARRTGDPWERFNMTVLALRYARAANGVSKLHGRVSREMWHVLYPERSVDEVPISSITN
FT                   GVHARTWVSPLFWNLYDQYLGPDWPERVSDPELWAKVEEIPDEELWRRKEALRERLVSF
FT                   TRHRVLRARRNRGESNERIQAVNQLLDPKVLTIGFARRFSTYKRGDLILRNLERITRIF
FT                   TNKEYPVQIIFAGKAHPRDEGGKRLIQRVVEWSNRPEVANRVAFIENYDAYVGRNLVQG
FT                   VDVWLNNPRRPLEASGTSGQKVGFSGGLNLSVLDGWWPEGYNGRNGWAIGQEIEGLDPA
FT                   AQDDLDANSLYDLLEYEVIPMFYDRDEKGIPRRWIARMKEAIRTLNPVFNTDRMVAEYV
FT                   LKIYEPQPLEAEASRTLLGSAVAG"
FT   gene            complement(644667..645770)
FT                   /locus_tag="CYB_0633"
FT   CDS_pept        complement(644667..645770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0633"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="identified by match to protein family HMM TIGR02669"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01621"
FT                   /db_xref="GOA:Q2JNN8"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN8"
FT                   /protein_id="ABD01621.1"
FT                   /translation="MTFPVQARVLLRVGIAVNKPQVTVGSSTGARLLNAQGQPLAEVQA
FT                   MQPLQASRSGSAVSLAGQQGERLYLQPTTSDGLVFIDQNWYRGLVELIPGERGVIAINQ
FT                   VGLEDYVSSVVGSEMGHRFPMEALKAQAVASRTYALYHRSRRSQQPFDLGNGIDWQVYK
FT                   GVAAESSRTQAAARETAGQVLIYQGQLINAVFHSSAGGHTDDAGNVWLESRPYLQGVPD
FT                   FDQHSPVFSWTATVPAQQIQQLAAGIGAIRSVEVLRSSPWGRAITVRLTGSQGIRDLNA
FT                   GDFRRALGLRSTKIAISPRGEAATTASLAPVAGTFPAFFEIHGRGYGHGVGMSQWGAAA
FT                   LASQNYSYQQILSHYYRNTSLAVVEGR"
FT   gene            complement(645805..645996)
FT                   /locus_tag="CYB_0634"
FT   CDS_pept        complement(645805..645996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01622"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN7"
FT                   /protein_id="ABD01622.1"
FT                   /translation="MRDLLSPTVAAWVVEGASALCLDSQNPTCLGSLAGYAQRRVVFHR
FT                   GLVCDYCPLLFSSPISLA"
FT   gene            complement(646125..646640)
FT                   /locus_tag="CYB_0635"
FT   CDS_pept        complement(646125..646640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0635"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01623"
FT                   /db_xref="GOA:Q2JNN6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN6"
FT                   /protein_id="ABD01623.1"
FT                   /translation="MLHSSEPQGWDLWQRHRAWMQLALREAEQAGEAGEVPVAALVVGP
FT                   GEKLLALSSNRRERDRDPTAHAEILALRQAGQRLGDWQLQGCRLYVTLEPCPMCAGAIS
FT                   QSRLAQVIYGADDPKAGALRSVLNLPASAASFHCPEVIGGVCEAECRRLLQQWFCRRRG
FT                   IPSEPAES"
FT   gene            646851..648092
FT                   /locus_tag="CYB_0636"
FT   CDS_pept        646851..648092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0636"
FT                   /product="peptidase, S1C (protease Do) family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01624"
FT                   /db_xref="GOA:Q2JNN5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN5"
FT                   /protein_id="ABD01624.1"
FT                   /translation="MARILRHTLLAMALFGGGVAGGVWLSSRAGQEWLQQTPLITWTRR
FT                   ASEGVGSLLPWSEPRPEAANSAPPADAVRPSNFIAAVAQKVGPAVVRIDATRTVSRGVN
FT                   PELFNQPLFRRFFGNQIPQLPQEFQQEGTGSGFIIDASGLILTNAHVVEGSERVRVHLL
FT                   DGRTFEGEVKGSDPVTDIAVIKIEGENLPTVTLGNSDLVRPGDWAIAIGNPLGLDNTVT
FT                   AGIISAVGRSSGQIGAVNKRVTFLQTDAAINPGNSGGPLLDAEGRVIGVNTAIFQRAQS
FT                   VGFAIPINRAMEIAEQLIRNGRVEHAFLGIRMITLNPDIVARLNRDPARPTTLTVEEGV
FT                   LIGQVIPGSPAEEIGLREGDVITEINGQAIHDAEQVQQLVEAAGVGNTLTLRVIRDGQA
FT                   RTFQVKTGVLPVDF"
FT   gene            648160..649764
FT                   /locus_tag="CYB_0637"
FT   CDS_pept        648160..649764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0637"
FT                   /product="protein kinase"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF05419"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01625"
FT                   /db_xref="GOA:Q2JNN4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN4"
FT                   /protein_id="ABD01625.1"
FT                   /translation="MAWAVGEQLQGGRYRIEAVLGEGGFGITYRAWDSVRADQVVIKVL
FT                   NDSLREDPDYPHFQQNFMNEALQLARCHHPHVVKVEEVIWEQERWCIVMEYIRGQTLHQ
FT                   LLRQKGPLPLPEALRLTREVGSALMALHEQGILHRDVKPANIMVREGSGQAVLIDFGLA
FT                   RGYTQGLIQRHTSYGTDGYAPLEQYDSLRRRGAFTDVYALAATLYTALTGMVPMCAPVR
FT                   ATGRQLDTPRSLNPNIPEVVEAAILKGMALHPEERPQTMAEWLALLPAEASQQGRKPVA
FT                   FEPAIRTQELRELEQILAQPPEPQDELEQLLSRHSAEELEQLVAPPTPATAKKAGREEG
FT                   SGSLIFPEVCPEERGKGGSLPGTLSWPEWVGEAAPALQGLWDRLRAGQWGEADRWTTAL
FT                   MLKLAGRSQVGFFDPKDVQAFPCPMLRLIDQLWVRASHGRFGFSVQKQLWQGCDPGGTS
FT                   IGRSRSFSALPREECMGEAVGWRIQGRWLGYGELKTSLDAPPGHLPVGFFWGYSGGLRS
FT                   ALLTLDRVVLKKLKACF"
FT   gene            650296..650421
FT                   /locus_tag="CYB_0638"
FT   CDS_pept        650296..650421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01626"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN3"
FT                   /protein_id="ABD01626.1"
FT                   /translation="MVYRILKLVEEMLELLQSYDSMTENFLRLKLLFHKLSHSVG"
FT   gene            651097..651255
FT                   /locus_tag="CYB_0639"
FT   CDS_pept        651097..651255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN2"
FT                   /protein_id="ABD01627.1"
FT                   /translation="MVLLAKKGEWLGLGSLQPAWKGQKSPAGGLFREYSGGLRTALPML
FT                   KRLKACL"
FT   gene            651524..651909
FT                   /pseudo
FT                   /locus_tag="CYB_0640"
FT                   /note="ISSoc13, transposase orfA, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to
FT                   GB:CAD85699.1"
FT   gene            651867..652274
FT                   /locus_tag="CYB_0641"
FT   CDS_pept        651867..652274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0641"
FT                   /product="ISSoc13, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01628"
FT                   /db_xref="GOA:Q2JNN1"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN1"
FT                   /protein_id="ABD01628.1"
FT                   /translation="MGRSRGGYSTKIHVSVDGLGNPLELRITGGEKSDITQGEELIEGW
FT                   QRKDTKVIGDKGYDADKLIEKIGEAQAVIPPKRNRKTQRHYDKHLYQERHLIECFFHKL
FT                   KQYRHLCSRFDKLARNFLSFLYLVSALFWLK"
FT   gene            652537..653388
FT                   /locus_tag="CYB_0642"
FT   CDS_pept        652537..653388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0642"
FT                   /product="GTPase family protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01629"
FT                   /db_xref="GOA:Q2JNN0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNN0"
FT                   /protein_id="ABD01629.1"
FT                   /translation="MSSPAIQWYPGHIAKAIGQLREELQRVDAVIEVLDARIPLASRHP
FT                   ELGRWLGEKPRLLALNRADCIEAGDLKAWQEYFLRQGIPVYPTNGRSGEGVNRLKQAVL
FT                   HLGQSVNTRRQQRGMRPRAVRAVVVGFPNVGKSALLNRLLGRRAAESAARPGVTRQLRW
FT                   VRLGGELDLLDSPGIIPPSLPDQQAASLLAICDDIGEAAYDPERVAAHFLDQVLRVQPQ
FT                   AGSLLQKRYGWPDPIPPGGAAVQELAERRYQGDPQRAARQVLNDYRKGLLGPLALELPP
FT                   KA"
FT   gene            complement(653484..654602)
FT                   /locus_tag="CYB_0643"
FT   CDS_pept        complement(653484..654602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0643"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01630"
FT                   /db_xref="GOA:Q2JNM9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM9"
FT                   /protein_id="ABD01630.1"
FT                   /translation="MFRPSLCLLLMSAVIPQLERLHIEVTNVCNFKCEFCPDGIMQRRR
FT                   GHMEPALLEQILEEVAATGLARVMAFHLMGEPLLYPYLFEGIRRAAELGLRLHLTSNGS
FT                   TFALWPEHIEKLNRSPFAKLTISLQTPDPVTFSIRGAPPRLTPERYFAGITQFLQVHLR
FT                   SSSPTQVHLKFLDTSPHPFLVPHKALSVIDSAQQMPAQLSAWARRALQGIPDAPALDWV
FT                   EAQIATYRPGRWQQIRIHPRLVLETFPLDSWGNVETDRVIPARWGYCNGASGQAGILYD
FT                   GTVVPCCKDYEGQIPLGQVTLGGSLAEILRGQPACALRRGFNRLQVNHPVCQRCMGGDT
FT                   CIKALARQVGSVVYFKVYRPWKQRLDPGWGQV"
FT   gene            654687..655052
FT                   /locus_tag="CYB_0644"
FT   CDS_pept        654687..655052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89463.1"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01631"
FT                   /db_xref="GOA:Q2JNM8"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNM8"
FT                   /protein_id="ABD01631.1"
FT                   /translation="MLKCTTRHVHIFAGEVTADNNFVPRDDLFTLDVDPDNELVWTDAA
FT                   LQKVYARFEELVEEYRGRDLTEYNIRRIGSDLEHFIRSLLKQGEIAYNLQGRAPNFSMG
FT                   FPQIPAEEIVGQYIPKG"
FT   gene            655133..655558
FT                   /locus_tag="CYB_0645"
FT   CDS_pept        655133..655558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01632"
FT                   /db_xref="InterPro:IPR021374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM7"
FT                   /protein_id="ABD01632.1"
FT                   /translation="MSGEPTPEAAAAEKPAEAAKPAAEDSPKAAAKKVAKEEKPFEQQI
FT                   TEEVIPAAIAAFQKRGVSDLELRLEGKTLVGAFAGGKKQFSVLFAEGSLNGRKFFRCTT
FT                   EGSPASTIESFMIDERRVDVNLFVFYLVQRLYAQQWY"
FT   gene            656104..657579
FT                   /gene="glgA-1"
FT                   /locus_tag="CYB_0646"
FT   CDS_pept        656104..657579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA-1"
FT                   /locus_tag="CYB_0646"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM TIGR02095"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01633"
FT                   /db_xref="GOA:Q2JNM6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2JNM6"
FT                   /protein_id="ABD01633.1"
FT                   /translation="MYIVQIASECAPVIKAGGLGDVVYGLSRELEVRGHCVELVLPKYD
FT                   TMRYDQIWGLHDAYRDLWVPWYGGAIHCSVYCGWVHGRLCFFIEPHSGDNFFNRGCYYG
FT                   CPDDNMRFAFFSKAALEFLLQSNKRPDIIHCHDWQTGLVPVLLFEIYKYHGMGNQRVCY
FT                   TIHNFKHQGFGGPEILWATGLNREPYYFHYDRLRDNFNPFSLNFMKGGIVFSNFVTTVS
FT                   PNHALEVQFGDYGYGLGHTLYLHRHKFRGVLNGIDYDIWNPEIDRFIPVRYTAQTLENK
FT                   AKNKKALRDRLLLQDVDKPIVAYIGRLDEQKGVHLVHHAIYRSLFKNAQFVLLGSATER
FT                   GIGAWFAHEKSYLNNNPDVHIELGFNEELSHLIYAGADIIVVPSHYEPCGLTQMIGLKY
FT                   GTVPVVRGVGGLVDTVFDRDYDPHKLPEQRNGYVFYHTDPAALESALDRAIDLWYTAPD
FT                   QFRQLQIQGMSYDYSWNYPGKEYLEIYDFIRHR"
FT   gene            657739..659346
FT                   /locus_tag="CYB_0647"
FT   CDS_pept        657739..659346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0647"
FT                   /product="glycosyl hydrolase, family 57"
FT                   /note="identified by match to protein family HMM PF03065"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01634"
FT                   /db_xref="GOA:Q2JNM5"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM5"
FT                   /protein_id="ABD01634.1"
FT                   /translation="MGYLALVLHAHLPFVRHPEQDFVLEEEWLYEAITETYVPLLHMFE
FT                   GLQRDGIDFRFTMSLTPPLVSMLRDPLLQERYDHYLTKLEELAQLEYDKNATNGHIRYL
FT                   AEHYIKQFAMVRDLWERYDRDLVRAFRQFQDSGNLEIITCGATHGYLPLMQMYPQAVWA
FT                   QLIVACEHYNEHFGQWPRGIWLPECAYYQGLERMIADAGLRYMITDAHGLLYAKPRPRY
FT                   GMYAPIFTETGVAVFGRDHESSQQVWSAEVGYPGDPVYREFYKDLGYEADYEYIKPYIM
FT                   PNGQRKNTGIKYHRITGRNLDLGQKQLYDPYWAREKAAEHAGNFMFNRQRQIEYLYSVM
FT                   GRPPLVVAPYDAELFGHWWYEGPWFLDFLIRKSYFDQNTYRMTHLAEYLRENPTQQVCK
FT                   PAQSSWGARGFHEYWLNPTNAWIYPHLHKATERMIELSRREPADDLEWRALNQAARELL
FT                   LAQSSDWAFIMRTGTMVPYAVRRTKSHLLRFNHLYEKIKEGQFRREKATPEEEQWLAKV
FT                   EYMDNIFPNINYRVYRPL"
FT   gene            complement(659644..661440)
FT                   /gene="ilvB"
FT                   /locus_tag="CYB_0648"
FT   CDS_pept        complement(659644..661440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="CYB_0648"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01635"
FT                   /db_xref="GOA:Q2JNM4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM4"
FT                   /protein_id="ABD01635.1"
FT                   /translation="MATGGYALVDSLHRHGVQHIFGYPGGAILPIYDELYKAESQGLLK
FT                   HYLVRHEQAAAHAADGYARATGKVGVCFATSGPGATNLVTGIANAMMDSVPMVVITGQV
FT                   PRHLIGTDGFQETDIFGITLPIVKHSYVVRDPRQMARIVAEAFHIAGTGRPGPVLIDIP
FT                   KDVGLEEFDYQPVSEVNIPGYRPTVRGNPRQIHAAAKLILQAKRPLLYVGGGAIISGAH
FT                   AEIAELAHTYQIPVTTTLMGKGAFDENDPLSVGMLGMHGTAYANFAVTECDLLIAVGAR
FT                   FDDRVTGKLDEFAKHAKVIHIDIDPAEVGKNRTPDVPIVGDVRTVLVELLAQLSKMPHT
FT                   PGQTQAWLERIERWKRDYPLQVPRYEGVIAPQQVIDAFRRHAPHAYYTTDVGQHQMWAA
FT                   QFLRNGPRQWISSSGLGTMGYGFPAAMGVKVALPHAEVICISGDASFQMNMQELGTVAQ
FT                   YGIATKVAIINNGWQGMVRQWQQAFHGERYSHSDMTPGMPDFVKLAEAFGVKGMRVDHP
FT                   DQVDDAIQEMLRHEGPVVVDFVVKRDENCYPMVPAGKANYQMIGLPEKRQLEQAAELIY
FT                   CPNCGTKNPSLHKFCAECGTKL"
FT   gene            661655..663232
FT                   /locus_tag="CYB_0649"
FT   CDS_pept        661655..663232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0649"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.109"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01636"
FT                   /db_xref="GOA:Q2JNM3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM3"
FT                   /protein_id="ABD01636.1"
FT                   /translation="MTGEPTPIDPGPERSQGSLLLAVPILGSPHSAVGSRQWLVWGALG
FT                   IFLVGLGLRLWRLDEFPAPVFDEVYFPEFAQNYLDGKPFYDVHPPLGKYFIALSIQVFG
FT                   RNEWGFRFATAFCGSLIPLLLTGLAYRLTYHVGFALLSGVLLLTDGVFLVESRFGLINV
FT                   YLVAFGLAATILLLRGLENQGWRRAAHFACSGILLGAAASVKWNGLWFAFMFALLGILV
FT                   WGVVWLRPQWIPRLGILIQIRHLRWWHYVFCFILAPLAFYAIQWIPHLQLNPQQGLTLD
FT                   WSWTGIQNYFRSLVLINQSIYGGHMAAHLVVNEETPVHPYCSTSLRSLVAWFPALRPWL
FT                   TTPLASAGAWSWPILGRPVAYYFGSQGNLWQAVHGLGNPWLWWLGTGSILVLVWRGIRH
FT                   FHGLEAFILIGYAANYLPWFRVSRCVFIYHYMSALAFSTLALAWLVLLGWQSYRRFWRG
FT                   ASITAVALVLASFVFFFPVWLGLPLSPSGFYARMWFRSSPVPLFCFSPQSCQQPPLHLP
FT                   PIPGLNWI"
FT   gene            663342..664406
FT                   /locus_tag="CYB_0650"
FT   CDS_pept        663342..664406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0650"
FT                   /product="oxidoreductase, NAD-binding"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01637"
FT                   /db_xref="GOA:Q2JNM2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM2"
FT                   /protein_id="ABD01637.1"
FT                   /translation="MARSCPSSANSPRRPLAYSEQAVPVGVIGVGNMGQHHTRVFSLMK
FT                   DVRVVGVADINVERGLDVASRHRVHFYEDYRDLLPHVAAVAIAVPTVLHHEVGMACLEA
FT                   GVHVLIEKPIAASISEAESLVNRAADCNCILQVGHIERFSPVFQKLGQVLQSEEPLAFE
FT                   AHRLSPYSDRASDVSVVFDLMIHDIDLLLELIPSPVTQITASGNRISKLGYLDYVTATL
FT                   TFANGAIATLTASKVTHRKVRKIAVHCKNALVEADFLHNEISVYRQGSVGSTSDYGQMP
FT                   YQRDCLIEKVHTDNIDKLHAELEHFINCVRGGNQPSVGGEQALKALRLASEVERIALDG
FT                   CAWSEAKPRRSLLS"
FT   gene            complement(665042..666871)
FT                   /locus_tag="CYB_0651"
FT   CDS_pept        complement(665042..666871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0651"
FT                   /product="putative membrane-bound protease"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01638"
FT                   /db_xref="GOA:Q2JNM1"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM1"
FT                   /protein_id="ABD01638.1"
FT                   /translation="MVAIHPANDLGALKNLGSTARGSQPAWWPPSGRQQGTVAPLQPLG
FT                   LVALEGLATWGDRLLGLDRVRGYLVEIQEHNTLLLNPHHVHSFQGAYGLWVESEGDQAW
FT                   IWLSREQEGQILRIPMSALQQPGSLEAFPVCRCPYPIEGIALWSDPHTGNRYLYATCYR
FT                   RGKILQLDPSRGLIVQEMPAPGVGREQIAVQGDYLWVSDRVEETIYVLERQTGRELARI
FT                   LTPSPGPTGLAHWRGQLWVAYAHEEAYIHDNPNAPDPLSVALRDKTWVAPLRLRPLDPP
FT                   SSPDPSGGSGTEAEDSPIACPVVFQPQCLGERATYTLSHGYRVELTYVEEIAQEEPRFL
FT                   PDLVWRIALPCNSLRQRVRSLHWVGLPFEVEEQSGQQVAVFSLGSLGAHEVRLFGWRAV
FT                   LDLYSIKYCIDPLDVEAAVLPRELRDRYLVDDDYLAMDTSIVREAARLAVGSETNLLRK
FT                   MLNIRAYVYDKLSYRVTSRIDPPDEVLRRGSGSCGEYVGVLLALARLNGIPCRTVGRYK
FT                   CPPHPELKGIPLFPQYNHVWIEFYLPGWGWVPMESNPDDRGERPYSQRYFMGLPWTHAE
FT                   IAKGIPFETINTDQASIGELAINHVQFRILEEI"
FT   gene            667103..667960
FT                   /locus_tag="CYB_0652"
FT   CDS_pept        667103..667960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0652"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01639"
FT                   /db_xref="GOA:Q2JNM0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNM0"
FT                   /protein_id="ABD01639.1"
FT                   /translation="MELALAIGGLVAGILAGVLGIGGGVILVPLQVSLGIPPVQAAATS
FT                   NLSIVMTSIAGSIQNWRMGMLDLKRVILLGIPALLTAQVGAIIASRLPSYLLLAAFGVL
FT                   LLANTYLVQLNKKVVIQAQELGADVSGAEHLSGTESSGQMSPWLARALTGGTAGLLAGL
FT                   FGIGGGVILVPMQILLLKETIKVAIQTSLGAIVITAVAATASHAGLSDWIWNGLGFGDG
FT                   TIHQNVLWIPGLILGTGGLIGVQISTRTLPKLPDETVSLLFRGFLAILSLYIFWQAWQG
FT                   YRAL"
FT   gene            complement(668015..669001)
FT                   /locus_tag="CYB_0653"
FT   CDS_pept        complement(668015..669001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0653"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01640"
FT                   /db_xref="GOA:Q2JNL9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL9"
FT                   /protein_id="ABD01640.1"
FT                   /translation="MELRSASANVSPSPVAFLGPAGTYTELAALLACPEQPHLHSQGSH
FT                   PLVPYPTISACLEAVAAGQQQWAVVPVENSVEGGVSMTLDALWQLEGLGIRQALILPIR
FT                   HALIGRASRLEQIEQVYSHPQALAQCQAWLRSHLPQATLIPTRSTTEELDRLQEQPSAA
FT                   VIASERAATLYQLPVLACPINDHPDNCTRFWVIGRAPLSRSGQQGETSADPASPGGSHT
FT                   SLAFSLPHNVPGALLKPLQVFAERGLNMSRIESRPTKKSAGTYVFFVDLENPIGQPYLD
FT                   AEVVAALESIAETLKLFGSYPVHDLCKQGDLSQVAKALPSEGKARPT"
FT   gene            complement(669015..669383)
FT                   /locus_tag="CYB_0654"
FT   CDS_pept        complement(669015..669383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01641"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL8"
FT                   /protein_id="ABD01641.1"
FT                   /translation="MAEQHKPLKSLENQMERAVLEMVNEILLMESQQRYCFCEKFCNDA
FT                   AALALNNLQPRYATSFHGSLRTLEAIQADQELQRLIRLEVVKAMDKVAANPRCPEPECP
FT                   LLLRDVEAIELELAPSDN"
FT   gene            complement(669567..670841)
FT                   /gene="alr"
FT                   /locus_tag="CYB_0655"
FT   CDS_pept        complement(669567..670841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="CYB_0655"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by similarity to SP:P54918; match to
FT                   protein family HMM PF00842; match to protein family HMM
FT                   PF01168; match to protein family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01642"
FT                   /db_xref="GOA:Q2JNL7"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL7"
FT                   /protein_id="ABD01642.1"
FT                   /translation="MNREPVAPAAQGTLRAAALGVQGNTWREGSQRANPSAELDCAIDL
FT                   ELLTSRAWVEIDAAQLRENLRLLQRRLGSNVEIWAVVKANAYGHGAQLVAPVAVAAGAK
FT                   GLCVATLAEGIELRQTGLQAPVLVLGALNTWAELQQAMAARLEVSLTCTDQIPLMRQVA
FT                   RWAGRPIPVHVNVDTGMTRLGIPWKEAAAVWGQICRIPELEGCSLFSHLATADEPHSPV
FT                   MEQQHARFAQVVEQIRQAGDPLPALHLDNSAGALTHLHYSRVRLGLVLYGLSPAPHLPV
FT                   PGLQPILRLKARLSHIQTVPAQTGVSYGHRYITSRPSRIATLAIGYADGIPRRLSGWLR
FT                   GWVRGGLIQQVGTITMDQCMWDVTERPDIQVGDVVELLGPNLANAGLSVQDWADQLGTI
FT                   SYELLCGLSARLPRVLVNSLGFDDA"
FT   gene            complement(670886..672040)
FT                   /gene="sppA-1"
FT                   /locus_tag="CYB_0656"
FT   CDS_pept        complement(670886..672040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA-1"
FT                   /locus_tag="CYB_0656"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01343;
FT                   match to protein family HMM TIGR00706"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01643"
FT                   /db_xref="GOA:Q2JNL6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL6"
FT                   /protein_id="ABD01643.1"
FT                   /translation="MAQPGGSNSGVCSALSLLLPGIPGSPRGGRTESVAIEGPVTQETQ
FT                   LNRILAASLLVVCLIAAIVGGTRPAPEPTRGGVGLEAARGAERIEVVTLEGTIGGPGGS
FT                   TLVGLPTSPVEQLREAARDPSVKAVLLRINSPGGAVGSSQELYRAVTALHEADKPVIAI
FT                   LENIAASGGYYVASAADKIYANPGTLTGSIGAIISGLSFGKLLENYGIEPQTFKTGEYK
FT                   DLLSPFRSATPQEQRLLQNLVEDTLEQFIRDVAQGRQHLPEKADEVLEAEMIARRQSLD
FT                   EDRVRQLADGRIFTGAQAVEVGLVDALGGYTEAVEDLRRMTGDPSLSPAGEGEGFQRVL
FT                   RRLLSQGLSSQRQAAWLGRLLESNEAVGIPDVPLLWMAPEWTLR"
FT   gene            672186..672258
FT                   /locus_tag="CYB_0657"
FT   tRNA            672186..672258
FT                   /locus_tag="CYB_0657"
FT                   /product="tRNA-Ala"
FT   gene            complement(672274..672543)
FT                   /locus_tag="CYB_0658"
FT   CDS_pept        complement(672274..672543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01644"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL5"
FT                   /protein_id="ABD01644.1"
FT                   /translation="MPVSHEATDCWVEDIGLERSDITIGVNCGKGWGSLVPLLFFCSWF
FT                   LLANLWPVNSPGLTVLVSFAGSRVEESQNPGLPETLQALDAVGS"
FT   gene            complement(672563..672841)
FT                   /locus_tag="CYB_0659"
FT   CDS_pept        complement(672563..672841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CYB_0659"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01645"
FT                   /db_xref="UniProtKB/TrEMBL:Q2JNL4"
FT                   /protein_id="ABD01645.1"
FT                   /translation="MTNEEIETRFVQLAEAVTRVANTVAQVTDAQLALQTLSGRLAEVV
FT                   LELRQEVRELRQELRELRQRQAESDQRFEVLLQEIRFLIRRQGEGQP"
FT   gene            complement(673292..674284)
FT                   /gene="cyoE"
FT                   /locus_tag="CYB_0660"
FT   CDS_pept        complement(673292..674284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="CYB_0660"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:CYB_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD01646"
FT                   /db_xref="GOA:Q2JNL3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT