(data stored in ACNUC7421 zone)

EMBL: CP000246

ID   CP000246; SV 1; circular; genomic DNA; STD; PRO; 3256683 BP.
XX
AC   CP000246;
XX
PR   Project:PRJNA304;
XX
DT   26-JUL-2006 (Rel. 88, Created)
DT   18-MAR-2017 (Rel. 132, Last updated, Version 11)
XX
DE   Clostridium perfringens ATCC 13124, complete genome.
XX
KW   .
XX
OS   Clostridium perfringens ATCC 13124
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-3256683
RX   DOI; 10.1101/gr.5238106.
RX   PUBMED; 16825665.
RA   Myers G.S., Rasko D.A., Cheung J.K., Ravel J., Seshadri R., Deboy R.T.,
RA   Ren Q., Varga J., Awad M.M., Brinkac L.M., Daugherty S.C., Haft D.H.,
RA   Dodson R.J., Madupu R., Nelson W.C., Rosovitz M.J., Sullivan S.A.,
RA   Khouri H., Dimitrov G.I., Watkins K.L., Mulligan S., Benton J., Radune D.,
RA   Fisher D.J., Atkins H.S., Hiscox T., Jost B.H., Billington S.J.,
RA   Songer J.G., McClane B.A., Titball R.W., Rood J.I., Melville S.B.,
RA   Paulsen I.T.;
RT   "Skewed genomic variability in strains of the toxigenic bacterial pathogen,
RT   Clostridium perfringens";
RL   Genome Res. 16(8):1031-1040(2006).
XX
RN   [2]
RP   1-3256683
RA   Myers G.S., Rasko D.A., Cheung J.K., Ravel J., Seshadri R., DeBoy R.T.,
RA   Ren Q., Varga J., Awad M.M., Brinkac L.M., Daugherty S.C., Haft D.H.,
RA   Dodson R.J., Madupu R., Nelson W.C., Rosovitz M., Sullivan S.A.,
RA   Khouri H.M., Dimitrov G., Watkins K.L., Mulligan S., Benton J.L.,
RA   Fisher D.J., Atkins H.S., Hiscox T., Titball R.W., Rood J.I., Melville S.,
RA   Paulsen I.T.;
RT   ;
RL   Submitted (20-JAN-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-3256683
RA   Shrivastava S., Brinkac L.M., Dodson R.J., Harkins D.M., Durkin A.S.,
RA   Sutton G.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; be8e4f27dc0fb93c3372f69ecd910ecf.
DR   BioSample; SAMN02604008.
DR   EnsemblGenomes-Gn; CPF_0008.
DR   EnsemblGenomes-Gn; CPF_0009.
DR   EnsemblGenomes-Gn; CPF_0016.
DR   EnsemblGenomes-Gn; CPF_0017.
DR   EnsemblGenomes-Gn; CPF_0019.
DR   EnsemblGenomes-Gn; CPF_0020.
DR   EnsemblGenomes-Gn; CPF_0031.
DR   EnsemblGenomes-Gn; CPF_0035.
DR   EnsemblGenomes-Gn; CPF_0048.
DR   EnsemblGenomes-Gn; CPF_0068.
DR   EnsemblGenomes-Gn; CPF_0073.
DR   EnsemblGenomes-Gn; CPF_0193.
DR   EnsemblGenomes-Gn; CPF_0229.
DR   EnsemblGenomes-Gn; CPF_0260.
DR   EnsemblGenomes-Gn; CPF_0272.
DR   EnsemblGenomes-Gn; CPF_0489.
DR   EnsemblGenomes-Gn; CPF_0573.
DR   EnsemblGenomes-Gn; CPF_0679.
DR   EnsemblGenomes-Gn; CPF_0944.
DR   EnsemblGenomes-Gn; CPF_0946.
DR   EnsemblGenomes-Gn; CPF_1633.
DR   EnsemblGenomes-Gn; CPF_2120.
DR   EnsemblGenomes-Gn; CPF_2153.
DR   EnsemblGenomes-Gn; CPF_2154.
DR   EnsemblGenomes-Gn; CPF_2155.
DR   EnsemblGenomes-Gn; CPF_2156.
DR   EnsemblGenomes-Gn; CPF_2246.
DR   EnsemblGenomes-Gn; CPF_2419.
DR   EnsemblGenomes-Gn; CPF_2420.
DR   EnsemblGenomes-Gn; CPF_2436.
DR   EnsemblGenomes-Gn; CPF_2437.
DR   EnsemblGenomes-Gn; CPF_2438.
DR   EnsemblGenomes-Gn; CPF_2439.
DR   EnsemblGenomes-Gn; CPF_2440.
DR   EnsemblGenomes-Gn; CPF_2441.
DR   EnsemblGenomes-Gn; CPF_2442.
DR   EnsemblGenomes-Gn; CPF_2505.
DR   EnsemblGenomes-Gn; CPF_2506.
DR   EnsemblGenomes-Gn; CPF_2507.
DR   EnsemblGenomes-Gn; CPF_2513.
DR   EnsemblGenomes-Gn; CPF_2514.
DR   EnsemblGenomes-Gn; CPF_2515.
DR   EnsemblGenomes-Gn; CPF_2516.
DR   EnsemblGenomes-Gn; CPF_2517.
DR   EnsemblGenomes-Gn; CPF_2518.
DR   EnsemblGenomes-Gn; CPF_2519.
DR   EnsemblGenomes-Gn; CPF_2520.
DR   EnsemblGenomes-Gn; CPF_2521.
DR   EnsemblGenomes-Gn; CPF_2522.
DR   EnsemblGenomes-Gn; CPF_2523.
DR   EnsemblGenomes-Gn; CPF_2524.
DR   EnsemblGenomes-Gn; CPF_2525.
DR   EnsemblGenomes-Gn; CPF_2526.
DR   EnsemblGenomes-Gn; CPF_2527.
DR   EnsemblGenomes-Gn; CPF_2528.
DR   EnsemblGenomes-Gn; CPF_2529.
DR   EnsemblGenomes-Gn; CPF_2530.
DR   EnsemblGenomes-Gn; CPF_2531.
DR   EnsemblGenomes-Gn; CPF_2532.
DR   EnsemblGenomes-Gn; CPF_2533.
DR   EnsemblGenomes-Gn; CPF_2619.
DR   EnsemblGenomes-Gn; CPF_2620.
DR   EnsemblGenomes-Gn; CPF_2621.
DR   EnsemblGenomes-Gn; CPF_2622.
DR   EnsemblGenomes-Gn; CPF_2626.
DR   EnsemblGenomes-Gn; CPF_2627.
DR   EnsemblGenomes-Gn; CPF_2628.
DR   EnsemblGenomes-Gn; CPF_2629.
DR   EnsemblGenomes-Gn; CPF_2630.
DR   EnsemblGenomes-Gn; CPF_2731.
DR   EnsemblGenomes-Gn; CPF_2769.
DR   EnsemblGenomes-Gn; CPF_2770.
DR   EnsemblGenomes-Gn; CPF_2771.
DR   EnsemblGenomes-Gn; CPF_2772.
DR   EnsemblGenomes-Gn; CPF_2773.
DR   EnsemblGenomes-Gn; CPF_2780.
DR   EnsemblGenomes-Gn; CPF_2790.
DR   EnsemblGenomes-Gn; CPF_2791.
DR   EnsemblGenomes-Gn; CPF_2792.
DR   EnsemblGenomes-Gn; CPF_2793.
DR   EnsemblGenomes-Gn; CPF_2794.
DR   EnsemblGenomes-Gn; CPF_2795.
DR   EnsemblGenomes-Gn; CPF_2796.
DR   EnsemblGenomes-Gn; CPF_2941.
DR   EnsemblGenomes-Gn; CPF_2942.
DR   EnsemblGenomes-Gn; CPF_2943.
DR   EnsemblGenomes-Gn; CPF_2944.
DR   EnsemblGenomes-Gn; CPF_2945.
DR   EnsemblGenomes-Gn; CPF_2946.
DR   EnsemblGenomes-Gn; CPF_2947.
DR   EnsemblGenomes-Gn; CPF_2948.
DR   EnsemblGenomes-Gn; CPF_2949.
DR   EnsemblGenomes-Gn; CPF_2950.
DR   EnsemblGenomes-Gn; CPF_2998.
DR   EnsemblGenomes-Gn; CPF_2999.
DR   EnsemblGenomes-Gn; CPF_3000.
DR   EnsemblGenomes-Gn; CPF_3001.
DR   EnsemblGenomes-Gn; CPF_3002.
DR   EnsemblGenomes-Gn; CPF_3003.
DR   EnsemblGenomes-Gn; CPF_3004.
DR   EnsemblGenomes-Gn; CPF_3005.
DR   EnsemblGenomes-Gn; CPF_3006.
DR   EnsemblGenomes-Gn; CPF_3007.
DR   EnsemblGenomes-Gn; CPF_3008.
DR   EnsemblGenomes-Gn; CPF_3009.
DR   EnsemblGenomes-Gn; CPF_3010.
DR   EnsemblGenomes-Gn; CPF_3011.
DR   EnsemblGenomes-Gn; CPF_3012.
DR   EnsemblGenomes-Gn; CPF_3013.
DR   EnsemblGenomes-Gn; CPF_3014.
DR   EnsemblGenomes-Gn; CPF_3015.
DR   EnsemblGenomes-Gn; CPF_3016.
DR   EnsemblGenomes-Gn; CPF_3017.
DR   EnsemblGenomes-Gn; CPF_3018.
DR   EnsemblGenomes-Gn; CPF_3019.
DR   EnsemblGenomes-Gn; CPF_3020.
DR   EnsemblGenomes-Gn; CPF_3021.
DR   EnsemblGenomes-Gn; EBG00001046761.
DR   EnsemblGenomes-Gn; EBG00001046764.
DR   EnsemblGenomes-Gn; EBG00001046767.
DR   EnsemblGenomes-Gn; EBG00001046770.
DR   EnsemblGenomes-Gn; EBG00001046773.
DR   EnsemblGenomes-Gn; EBG00001046774.
DR   EnsemblGenomes-Gn; EBG00001046776.
DR   EnsemblGenomes-Gn; EBG00001046778.
DR   EnsemblGenomes-Gn; EBG00001046779.
DR   EnsemblGenomes-Gn; EBG00001046780.
DR   EnsemblGenomes-Gn; EBG00001046782.
DR   EnsemblGenomes-Gn; EBG00001046784.
DR   EnsemblGenomes-Gn; EBG00001046785.
DR   EnsemblGenomes-Gn; EBG00001046788.
DR   EnsemblGenomes-Gn; EBG00001046790.
DR   EnsemblGenomes-Gn; EBG00001046792.
DR   EnsemblGenomes-Gn; EBG00001046795.
DR   EnsemblGenomes-Gn; EBG00001046797.
DR   EnsemblGenomes-Gn; EBG00001046800.
DR   EnsemblGenomes-Gn; EBG00001046804.
DR   EnsemblGenomes-Gn; EBG00001046806.
DR   EnsemblGenomes-Gn; EBG00001046809.
DR   EnsemblGenomes-Gn; EBG00001046814.
DR   EnsemblGenomes-Gn; EBG00001046816.
DR   EnsemblGenomes-Gn; EBG00001046817.
DR   EnsemblGenomes-Gn; EBG00001046818.
DR   EnsemblGenomes-Gn; EBG00001046819.
DR   EnsemblGenomes-Gn; EBG00001046820.
DR   EnsemblGenomes-Gn; EBG00001046822.
DR   EnsemblGenomes-Gn; EBG00001046824.
DR   EnsemblGenomes-Gn; EBG00001046826.
DR   EnsemblGenomes-Gn; EBG00001046829.
DR   EnsemblGenomes-Gn; EBG00001046832.
DR   EnsemblGenomes-Gn; EBG00001046833.
DR   EnsemblGenomes-Gn; EBG00001046836.
DR   EnsemblGenomes-Gn; EBG00001046838.
DR   EnsemblGenomes-Gn; EBG00001046839.
DR   EnsemblGenomes-Gn; EBG00001046843.
DR   EnsemblGenomes-Gn; EBG00001046846.
DR   EnsemblGenomes-Gn; EBG00001046847.
DR   EnsemblGenomes-Gn; EBG00001046850.
DR   EnsemblGenomes-Gn; EBG00001046853.
DR   EnsemblGenomes-Gn; EBG00001046855.
DR   EnsemblGenomes-Gn; EBG00001046857.
DR   EnsemblGenomes-Gn; EBG00001046859.
DR   EnsemblGenomes-Gn; EBG00001046862.
DR   EnsemblGenomes-Gn; EBG00001046866.
DR   EnsemblGenomes-Gn; EBG00001046869.
DR   EnsemblGenomes-Gn; EBG00001046872.
DR   EnsemblGenomes-Gn; EBG00001046874.
DR   EnsemblGenomes-Gn; EBG00001046877.
DR   EnsemblGenomes-Gn; EBG00001046880.
DR   EnsemblGenomes-Gn; EBG00001046884.
DR   EnsemblGenomes-Gn; EBG00001046887.
DR   EnsemblGenomes-Gn; EBG00001046890.
DR   EnsemblGenomes-Gn; EBG00001046893.
DR   EnsemblGenomes-Gn; EBG00001046896.
DR   EnsemblGenomes-Gn; EBG00001046898.
DR   EnsemblGenomes-Gn; EBG00001046901.
DR   EnsemblGenomes-Gn; EBG00001046903.
DR   EnsemblGenomes-Gn; EBG00001046905.
DR   EnsemblGenomes-Gn; EBG00001046907.
DR   EnsemblGenomes-Gn; EBG00001046909.
DR   EnsemblGenomes-Gn; EBG00001046913.
DR   EnsemblGenomes-Gn; EBG00001046915.
DR   EnsemblGenomes-Gn; EBG00001046917.
DR   EnsemblGenomes-Gn; EBG00001046919.
DR   EnsemblGenomes-Gn; EBG00001046921.
DR   EnsemblGenomes-Gn; EBG00001046924.
DR   EnsemblGenomes-Gn; EBG00001046926.
DR   EnsemblGenomes-Gn; EBG00001046928.
DR   EnsemblGenomes-Gn; EBG00001046930.
DR   EnsemblGenomes-Gn; EBG00001046933.
DR   EnsemblGenomes-Gn; EBG00001046935.
DR   EnsemblGenomes-Gn; EBG00001046939.
DR   EnsemblGenomes-Gn; EBG00001046940.
DR   EnsemblGenomes-Gn; EBG00001046942.
DR   EnsemblGenomes-Gn; EBG00001046944.
DR   EnsemblGenomes-Gn; EBG00001046946.
DR   EnsemblGenomes-Gn; EBG00001046949.
DR   EnsemblGenomes-Gn; EBG00001046951.
DR   EnsemblGenomes-Gn; EBG00001046953.
DR   EnsemblGenomes-Gn; EBG00001046955.
DR   EnsemblGenomes-Gn; EBG00001046956.
DR   EnsemblGenomes-Gn; EBG00001046959.
DR   EnsemblGenomes-Gn; EBG00001046961.
DR   EnsemblGenomes-Gn; EBG00001046963.
DR   EnsemblGenomes-Gn; EBG00001046964.
DR   EnsemblGenomes-Gn; EBG00001046965.
DR   EnsemblGenomes-Gn; EBG00001046967.
DR   EnsemblGenomes-Gn; EBG00001046968.
DR   EnsemblGenomes-Gn; EBG00001046970.
DR   EnsemblGenomes-Gn; EBG00001046971.
DR   EnsemblGenomes-Gn; EBG00001046973.
DR   EnsemblGenomes-Gn; EBG00001046974.
DR   EnsemblGenomes-Gn; EBG00001046976.
DR   EnsemblGenomes-Gn; EBG00001046977.
DR   EnsemblGenomes-Gn; EBG00001046978.
DR   EnsemblGenomes-Gn; EBG00001046979.
DR   EnsemblGenomes-Gn; EBG00001046981.
DR   EnsemblGenomes-Gn; EBG00001046983.
DR   EnsemblGenomes-Gn; EBG00001046984.
DR   EnsemblGenomes-Gn; EBG00001046985.
DR   EnsemblGenomes-Gn; EBG00001046986.
DR   EnsemblGenomes-Gn; EBG00001046987.
DR   EnsemblGenomes-Gn; EBG00001046989.
DR   EnsemblGenomes-Gn; EBG00001046991.
DR   EnsemblGenomes-Gn; EBG00001046992.
DR   EnsemblGenomes-Gn; EBG00001046994.
DR   EnsemblGenomes-Gn; EBG00001046996.
DR   EnsemblGenomes-Gn; EBG00001046997.
DR   EnsemblGenomes-Gn; EBG00001046998.
DR   EnsemblGenomes-Gn; EBG00001046999.
DR   EnsemblGenomes-Gn; EBG00001047001.
DR   EnsemblGenomes-Gn; EBG00001047002.
DR   EnsemblGenomes-Gn; EBG00001047004.
DR   EnsemblGenomes-Gn; EBG00001047006.
DR   EnsemblGenomes-Gn; EBG00001047008.
DR   EnsemblGenomes-Gn; EBG00001047009.
DR   EnsemblGenomes-Gn; EBG00001047010.
DR   EnsemblGenomes-Gn; EBG00001047012.
DR   EnsemblGenomes-Gn; EBG00001047013.
DR   EnsemblGenomes-Gn; EBG00001047014.
DR   EnsemblGenomes-Gn; EBG00001047015.
DR   EnsemblGenomes-Gn; EBG00001047017.
DR   EnsemblGenomes-Gn; EBG00001047018.
DR   EnsemblGenomes-Gn; EBG00001047019.
DR   EnsemblGenomes-Gn; EBG00001047021.
DR   EnsemblGenomes-Gn; EBG00001047022.
DR   EnsemblGenomes-Gn; EBG00001047023.
DR   EnsemblGenomes-Gn; EBG00001047024.
DR   EnsemblGenomes-Gn; EBG00001047025.
DR   EnsemblGenomes-Gn; EBG00001047027.
DR   EnsemblGenomes-Gn; EBG00001047029.
DR   EnsemblGenomes-Gn; EBG00001047030.
DR   EnsemblGenomes-Gn; EBG00001047031.
DR   EnsemblGenomes-Gn; EBG00001047032.
DR   EnsemblGenomes-Gn; EBG00001047033.
DR   EnsemblGenomes-Gn; EBG00001047035.
DR   EnsemblGenomes-Gn; EBG00001047036.
DR   EnsemblGenomes-Tr; CPF_0008-1.
DR   EnsemblGenomes-Tr; CPF_0009-1.
DR   EnsemblGenomes-Tr; CPF_0016-1.
DR   EnsemblGenomes-Tr; CPF_0017-1.
DR   EnsemblGenomes-Tr; CPF_0019-1.
DR   EnsemblGenomes-Tr; CPF_0020-1.
DR   EnsemblGenomes-Tr; CPF_0031-1.
DR   EnsemblGenomes-Tr; CPF_0035-1.
DR   EnsemblGenomes-Tr; CPF_0048-1.
DR   EnsemblGenomes-Tr; CPF_0068-1.
DR   EnsemblGenomes-Tr; CPF_0073-1.
DR   EnsemblGenomes-Tr; CPF_0193-1.
DR   EnsemblGenomes-Tr; CPF_0229-1.
DR   EnsemblGenomes-Tr; CPF_0260-1.
DR   EnsemblGenomes-Tr; CPF_0272-1.
DR   EnsemblGenomes-Tr; CPF_0489-1.
DR   EnsemblGenomes-Tr; CPF_0573-1.
DR   EnsemblGenomes-Tr; CPF_0679-1.
DR   EnsemblGenomes-Tr; CPF_0944-1.
DR   EnsemblGenomes-Tr; CPF_0946-1.
DR   EnsemblGenomes-Tr; CPF_1633-1.
DR   EnsemblGenomes-Tr; CPF_2120-1.
DR   EnsemblGenomes-Tr; CPF_2153-1.
DR   EnsemblGenomes-Tr; CPF_2154-1.
DR   EnsemblGenomes-Tr; CPF_2155-1.
DR   EnsemblGenomes-Tr; CPF_2156-1.
DR   EnsemblGenomes-Tr; CPF_2246-1.
DR   EnsemblGenomes-Tr; CPF_2419-1.
DR   EnsemblGenomes-Tr; CPF_2420-1.
DR   EnsemblGenomes-Tr; CPF_2436-1.
DR   EnsemblGenomes-Tr; CPF_2437-1.
DR   EnsemblGenomes-Tr; CPF_2438-1.
DR   EnsemblGenomes-Tr; CPF_2439-1.
DR   EnsemblGenomes-Tr; CPF_2440-1.
DR   EnsemblGenomes-Tr; CPF_2441-1.
DR   EnsemblGenomes-Tr; CPF_2442-1.
DR   EnsemblGenomes-Tr; CPF_2505-1.
DR   EnsemblGenomes-Tr; CPF_2506-1.
DR   EnsemblGenomes-Tr; CPF_2507-1.
DR   EnsemblGenomes-Tr; CPF_2513-1.
DR   EnsemblGenomes-Tr; CPF_2514-1.
DR   EnsemblGenomes-Tr; CPF_2515-1.
DR   EnsemblGenomes-Tr; CPF_2516-1.
DR   EnsemblGenomes-Tr; CPF_2517-1.
DR   EnsemblGenomes-Tr; CPF_2518-1.
DR   EnsemblGenomes-Tr; CPF_2519-1.
DR   EnsemblGenomes-Tr; CPF_2520-1.
DR   EnsemblGenomes-Tr; CPF_2521-1.
DR   EnsemblGenomes-Tr; CPF_2522-1.
DR   EnsemblGenomes-Tr; CPF_2523-1.
DR   EnsemblGenomes-Tr; CPF_2524-1.
DR   EnsemblGenomes-Tr; CPF_2525-1.
DR   EnsemblGenomes-Tr; CPF_2526-1.
DR   EnsemblGenomes-Tr; CPF_2527-1.
DR   EnsemblGenomes-Tr; CPF_2528-1.
DR   EnsemblGenomes-Tr; CPF_2529-1.
DR   EnsemblGenomes-Tr; CPF_2530-1.
DR   EnsemblGenomes-Tr; CPF_2531-1.
DR   EnsemblGenomes-Tr; CPF_2532-1.
DR   EnsemblGenomes-Tr; CPF_2533-1.
DR   EnsemblGenomes-Tr; CPF_2619-1.
DR   EnsemblGenomes-Tr; CPF_2620-1.
DR   EnsemblGenomes-Tr; CPF_2621-1.
DR   EnsemblGenomes-Tr; CPF_2622-1.
DR   EnsemblGenomes-Tr; CPF_2626-1.
DR   EnsemblGenomes-Tr; CPF_2627-1.
DR   EnsemblGenomes-Tr; CPF_2628-1.
DR   EnsemblGenomes-Tr; CPF_2629-1.
DR   EnsemblGenomes-Tr; CPF_2630-1.
DR   EnsemblGenomes-Tr; CPF_2731-1.
DR   EnsemblGenomes-Tr; CPF_2769-1.
DR   EnsemblGenomes-Tr; CPF_2770-1.
DR   EnsemblGenomes-Tr; CPF_2771-1.
DR   EnsemblGenomes-Tr; CPF_2772-1.
DR   EnsemblGenomes-Tr; CPF_2773-1.
DR   EnsemblGenomes-Tr; CPF_2780-1.
DR   EnsemblGenomes-Tr; CPF_2790-1.
DR   EnsemblGenomes-Tr; CPF_2791-1.
DR   EnsemblGenomes-Tr; CPF_2792-1.
DR   EnsemblGenomes-Tr; CPF_2793-1.
DR   EnsemblGenomes-Tr; CPF_2794-1.
DR   EnsemblGenomes-Tr; CPF_2795-1.
DR   EnsemblGenomes-Tr; CPF_2796-1.
DR   EnsemblGenomes-Tr; CPF_2941-1.
DR   EnsemblGenomes-Tr; CPF_2942-1.
DR   EnsemblGenomes-Tr; CPF_2943-1.
DR   EnsemblGenomes-Tr; CPF_2944-1.
DR   EnsemblGenomes-Tr; CPF_2945-1.
DR   EnsemblGenomes-Tr; CPF_2946-1.
DR   EnsemblGenomes-Tr; CPF_2947-1.
DR   EnsemblGenomes-Tr; CPF_2948-1.
DR   EnsemblGenomes-Tr; CPF_2949-1.
DR   EnsemblGenomes-Tr; CPF_2950-1.
DR   EnsemblGenomes-Tr; CPF_2998-1.
DR   EnsemblGenomes-Tr; CPF_2999-1.
DR   EnsemblGenomes-Tr; CPF_3000-1.
DR   EnsemblGenomes-Tr; CPF_3001-1.
DR   EnsemblGenomes-Tr; CPF_3002-1.
DR   EnsemblGenomes-Tr; CPF_3003-1.
DR   EnsemblGenomes-Tr; CPF_3004-1.
DR   EnsemblGenomes-Tr; CPF_3005-1.
DR   EnsemblGenomes-Tr; CPF_3006-1.
DR   EnsemblGenomes-Tr; CPF_3007-1.
DR   EnsemblGenomes-Tr; CPF_3008-1.
DR   EnsemblGenomes-Tr; CPF_3009-1.
DR   EnsemblGenomes-Tr; CPF_3010-1.
DR   EnsemblGenomes-Tr; CPF_3011-1.
DR   EnsemblGenomes-Tr; CPF_3012-1.
DR   EnsemblGenomes-Tr; CPF_3013-1.
DR   EnsemblGenomes-Tr; CPF_3014-1.
DR   EnsemblGenomes-Tr; CPF_3015-1.
DR   EnsemblGenomes-Tr; CPF_3016-1.
DR   EnsemblGenomes-Tr; CPF_3017-1.
DR   EnsemblGenomes-Tr; CPF_3018-1.
DR   EnsemblGenomes-Tr; CPF_3019-1.
DR   EnsemblGenomes-Tr; CPF_3020-1.
DR   EnsemblGenomes-Tr; CPF_3021-1.
DR   EnsemblGenomes-Tr; EBT00001649344.
DR   EnsemblGenomes-Tr; EBT00001649345.
DR   EnsemblGenomes-Tr; EBT00001649346.
DR   EnsemblGenomes-Tr; EBT00001649347.
DR   EnsemblGenomes-Tr; EBT00001649348.
DR   EnsemblGenomes-Tr; EBT00001649349.
DR   EnsemblGenomes-Tr; EBT00001649350.
DR   EnsemblGenomes-Tr; EBT00001649351.
DR   EnsemblGenomes-Tr; EBT00001649352.
DR   EnsemblGenomes-Tr; EBT00001649353.
DR   EnsemblGenomes-Tr; EBT00001649354.
DR   EnsemblGenomes-Tr; EBT00001649355.
DR   EnsemblGenomes-Tr; EBT00001649356.
DR   EnsemblGenomes-Tr; EBT00001649357.
DR   EnsemblGenomes-Tr; EBT00001649358.
DR   EnsemblGenomes-Tr; EBT00001649359.
DR   EnsemblGenomes-Tr; EBT00001649360.
DR   EnsemblGenomes-Tr; EBT00001649361.
DR   EnsemblGenomes-Tr; EBT00001649362.
DR   EnsemblGenomes-Tr; EBT00001649363.
DR   EnsemblGenomes-Tr; EBT00001649364.
DR   EnsemblGenomes-Tr; EBT00001649365.
DR   EnsemblGenomes-Tr; EBT00001649366.
DR   EnsemblGenomes-Tr; EBT00001649367.
DR   EnsemblGenomes-Tr; EBT00001649368.
DR   EnsemblGenomes-Tr; EBT00001649369.
DR   EnsemblGenomes-Tr; EBT00001649370.
DR   EnsemblGenomes-Tr; EBT00001649371.
DR   EnsemblGenomes-Tr; EBT00001649372.
DR   EnsemblGenomes-Tr; EBT00001649373.
DR   EnsemblGenomes-Tr; EBT00001649374.
DR   EnsemblGenomes-Tr; EBT00001649377.
DR   EnsemblGenomes-Tr; EBT00001649378.
DR   EnsemblGenomes-Tr; EBT00001649380.
DR   EnsemblGenomes-Tr; EBT00001649381.
DR   EnsemblGenomes-Tr; EBT00001649383.
DR   EnsemblGenomes-Tr; EBT00001649385.
DR   EnsemblGenomes-Tr; EBT00001649387.
DR   EnsemblGenomes-Tr; EBT00001649391.
DR   EnsemblGenomes-Tr; EBT00001649392.
DR   EnsemblGenomes-Tr; EBT00001649395.
DR   EnsemblGenomes-Tr; EBT00001649396.
DR   EnsemblGenomes-Tr; EBT00001649398.
DR   EnsemblGenomes-Tr; EBT00001649399.
DR   EnsemblGenomes-Tr; EBT00001649403.
DR   EnsemblGenomes-Tr; EBT00001649404.
DR   EnsemblGenomes-Tr; EBT00001649406.
DR   EnsemblGenomes-Tr; EBT00001649407.
DR   EnsemblGenomes-Tr; EBT00001649408.
DR   EnsemblGenomes-Tr; EBT00001649409.
DR   EnsemblGenomes-Tr; EBT00001649410.
DR   EnsemblGenomes-Tr; EBT00001649413.
DR   EnsemblGenomes-Tr; EBT00001649414.
DR   EnsemblGenomes-Tr; EBT00001649415.
DR   EnsemblGenomes-Tr; EBT00001649416.
DR   EnsemblGenomes-Tr; EBT00001649418.
DR   EnsemblGenomes-Tr; EBT00001649420.
DR   EnsemblGenomes-Tr; EBT00001649422.
DR   EnsemblGenomes-Tr; EBT00001649424.
DR   EnsemblGenomes-Tr; EBT00001649428.
DR   EnsemblGenomes-Tr; EBT00001649429.
DR   EnsemblGenomes-Tr; EBT00001649431.
DR   EnsemblGenomes-Tr; EBT00001649433.
DR   EnsemblGenomes-Tr; EBT00001649435.
DR   EnsemblGenomes-Tr; EBT00001649437.
DR   EnsemblGenomes-Tr; EBT00001649439.
DR   EnsemblGenomes-Tr; EBT00001649442.
DR   EnsemblGenomes-Tr; EBT00001649444.
DR   EnsemblGenomes-Tr; EBT00001649446.
DR   EnsemblGenomes-Tr; EBT00001649447.
DR   EnsemblGenomes-Tr; EBT00001649449.
DR   EnsemblGenomes-Tr; EBT00001649450.
DR   EnsemblGenomes-Tr; EBT00001649451.
DR   EnsemblGenomes-Tr; EBT00001649454.
DR   EnsemblGenomes-Tr; EBT00001649456.
DR   EnsemblGenomes-Tr; EBT00001649458.
DR   EnsemblGenomes-Tr; EBT00001649459.
DR   EnsemblGenomes-Tr; EBT00001649461.
DR   EnsemblGenomes-Tr; EBT00001649462.
DR   EnsemblGenomes-Tr; EBT00001649463.
DR   EnsemblGenomes-Tr; EBT00001649465.
DR   EnsemblGenomes-Tr; EBT00001649466.
DR   EnsemblGenomes-Tr; EBT00001649467.
DR   EnsemblGenomes-Tr; EBT00001649469.
DR   EnsemblGenomes-Tr; EBT00001649470.
DR   EnsemblGenomes-Tr; EBT00001649471.
DR   EnsemblGenomes-Tr; EBT00001649472.
DR   EnsemblGenomes-Tr; EBT00001649473.
DR   EnsemblGenomes-Tr; EBT00001649474.
DR   EnsemblGenomes-Tr; EBT00001649476.
DR   EnsemblGenomes-Tr; EBT00001649478.
DR   EnsemblGenomes-Tr; EBT00001649479.
DR   EnsemblGenomes-Tr; EBT00001649481.
DR   EnsemblGenomes-Tr; EBT00001649482.
DR   EnsemblGenomes-Tr; EBT00001649483.
DR   EnsemblGenomes-Tr; EBT00001649485.
DR   EnsemblGenomes-Tr; EBT00001649486.
DR   EnsemblGenomes-Tr; EBT00001649488.
DR   EnsemblGenomes-Tr; EBT00001649489.
DR   EnsemblGenomes-Tr; EBT00001649490.
DR   EnsemblGenomes-Tr; EBT00001649492.
DR   EnsemblGenomes-Tr; EBT00001649494.
DR   EnsemblGenomes-Tr; EBT00001649496.
DR   EnsemblGenomes-Tr; EBT00001649498.
DR   EnsemblGenomes-Tr; EBT00001649500.
DR   EnsemblGenomes-Tr; EBT00001649502.
DR   EnsemblGenomes-Tr; EBT00001649503.
DR   EnsemblGenomes-Tr; EBT00001649504.
DR   EnsemblGenomes-Tr; EBT00001649506.
DR   EnsemblGenomes-Tr; EBT00001649508.
DR   EnsemblGenomes-Tr; EBT00001649509.
DR   EnsemblGenomes-Tr; EBT00001649512.
DR   EnsemblGenomes-Tr; EBT00001649513.
DR   EnsemblGenomes-Tr; EBT00001649514.
DR   EnsemblGenomes-Tr; EBT00001649516.
DR   EnsemblGenomes-Tr; EBT00001649517.
DR   EnsemblGenomes-Tr; EBT00001649518.
DR   EnsemblGenomes-Tr; EBT00001649520.
DR   EnsemblGenomes-Tr; EBT00001649521.
DR   EnsemblGenomes-Tr; EBT00001649522.
DR   EnsemblGenomes-Tr; EBT00001649523.
DR   EnsemblGenomes-Tr; EBT00001649524.
DR   EnsemblGenomes-Tr; EBT00001649528.
DR   EnsemblGenomes-Tr; EBT00001649530.
DR   EnsemblGenomes-Tr; EBT00001649532.
DR   EnsemblGenomes-Tr; EBT00001649534.
DR   EnsemblGenomes-Tr; EBT00001649536.
DR   EnsemblGenomes-Tr; EBT00001649537.
DR   EnsemblGenomes-Tr; EBT00001649539.
DR   EnsemblGenomes-Tr; EBT00001649540.
DR   EnsemblGenomes-Tr; EBT00001649541.
DR   EnsemblGenomes-Tr; EBT00001649542.
DR   EnsemblGenomes-Tr; EBT00001649545.
DR   EnsemblGenomes-Tr; EBT00001649547.
DR   EnsemblGenomes-Tr; EBT00001649548.
DR   EnsemblGenomes-Tr; EBT00001649549.
DR   EnsemblGenomes-Tr; EBT00001649551.
DR   EnsemblGenomes-Tr; EBT00001649553.
DR   EnsemblGenomes-Tr; EBT00001649555.
DR   EnsemblGenomes-Tr; EBT00001649556.
DR   EuropePMC; PMC1524862; 16825665.
DR   EuropePMC; PMC2822771; 20074323.
DR   EuropePMC; PMC2918953; 20581181.
DR   EuropePMC; PMC3209701; 21925113.
DR   EuropePMC; PMC3324638; 22353049.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC3599539; 23452396.
DR   EuropePMC; PMC4005833; 24775609.
DR   EuropePMC; PMC4192522; 25164812.
DR   EuropePMC; PMC4403768; 25887695.
DR   EuropePMC; PMC5007783; 27422836.
DR   EuropePMC; PMC5183799; 28058047.
DR   EuropePMC; PMC5633248; 29021903.
DR   EuropePMC; PMC5767839; 29348922.
DR   EuropePMC; PMC5836418; 29506466.
DR   EuropePMC; PMC5964661; 29788909.
DR   EuropePMC; PMC6007111; 29678922.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000246.
DR   SILVA-SSU; CP000246.
DR   StrainInfo; 7940; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3256683
FT                   /organism="Clostridium perfringens ATCC 13124"
FT                   /strain="ATCC 13124"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:195103"
FT                   /culture_collection="ATCC:13124"
FT   gene            411..1784
FT                   /gene="dnaA"
FT                   /locus_tag="CPF_0001"
FT   CDS_pept        411..1784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CPF_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P05648; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   PF08299; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83425"
FT                   /db_xref="GOA:Q0TV64"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV64"
FT                   /protein_id="ABG83425.1"
FT                   /translation="MDAQLNNLWEQALNIIKGEISEISFNTWIKSCTPISISDNILKLS
FT                   VPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEEKKENTN
FT                   DVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFAHAASLAVAESPAKAYNPLFIYGGVG
FT                   LGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKDDKNEEFRNKYRKVDVLLI
FT                   DDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEWGLIAD
FT                   IQPPDFETRMAILKKKADVEGLNVPNEVMVYIATKIKSNIRELEGALIRIIAYSSLTNR
FT                   DVSVDLASEALKDIISNKESAPVTVKTIQESVANYYNLRIEDLKSQRRTRNIAYPRQIA
FT                   MYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKLTQK"
FT   gene            2079..3179
FT                   /gene="dnaN"
FT                   /locus_tag="CPF_0002"
FT   CDS_pept        2079..3179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CPF_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P05649; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82581"
FT                   /db_xref="GOA:A0A0H2YP79"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP79"
FT                   /protein_id="ABG82581.1"
FT                   /translation="MIFTCDKNKLQESIAIAQKAITGKSTMPILEGLYIEASENIVTII
FT                   GSDKDVSIETKFEADVTEPGKLVVDAKIFGEIIRKLPNDKIKIETVSEEAIRITCQKSV
FT                   FDLLHMNAEDFPSLPKINENMIFSINQGILKNMIKGTSFAIAQDETRPILQGILFEIKD
FT                   SKLNLVALDGYRLAIRTENIDTNNTINAVIPGKTLNEVAKILEDSEEIVNITFTPNHIL
FT                   FNMGDTKVISRLLEGEFIKYDALLPKEHKLQIEVDKQTLQNGIERASLMAKEGNSNLVK
FT                   FDITDENIVITSNSQLGKVREEVTIKLQGDEIQIAFNSKYLLDVLKNMEEDKIELRMTS
FT                   SISPCIIRNKNNDLCEYLVLPVRIAR"
FT   gene            3305..3511
FT                   /locus_tag="CPF_0003"
FT   CDS_pept        3305..3511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0003"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83316"
FT                   /db_xref="GOA:A0A0H2YQW6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQW6"
FT                   /protein_id="ABG83316.1"
FT                   /translation="MQEVKINTEFIKLDSFLKWCGAVSLGSEAKMFIMDGEVLVNGEVC
FT                   TQRGKKLRVDDTVEFNGEIYKLI"
FT   gene            3567..4652
FT                   /gene="recF"
FT                   /locus_tag="CPF_0004"
FT   CDS_pept        3567..4652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CPF_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P05651; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84696"
FT                   /db_xref="GOA:Q0TV61"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV61"
FT                   /protein_id="ABG84696.1"
FT                   /translation="MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYY
FT                   CGFAKSHRTNRDKELIEWNKDRAFIRLDVHKDRLDKIIDVNILKDGKKAISINSIKISK
FT                   IGELIGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQLNKRYYHNLVQYNKVLHERNL
FT                   VLKNKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKEITSGKEEIEFKY
FT                   ISTVKDLDNIKDSMIKLLEQNRKKDIDKRATSIGPHRDDFNIYLNNIDAKIYGSQGQQR
FT                   TSVLTIKFASLKIIKEITGEYPVLLLDDVLSELDFNRKRYVLTSIKNIQTVITCTGIED
FT                   LTSYLDENSKVFRVINGRIQC"
FT   gene            4666..4926
FT                   /locus_tag="CPF_0005"
FT   CDS_pept        4666..4926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:T46554"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83877"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTL4"
FT                   /protein_id="ABG83877.1"
FT                   /translation="MFLHLGENVVVPVKDVIGIFDIQTAMYSSDTIQFLRMAEEDGFVE
FT                   RITDEKPKSFVIAEIDKMSKVYLSPISSSTLTKRTDINYNP"
FT   gene            5163..7079
FT                   /gene="gyrB"
FT                   /locus_tag="CPF_0006"
FT   CDS_pept        5163..7079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CPF_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05652; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83071"
FT                   /db_xref="GOA:A0A0H2YQ43"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ43"
FT                   /protein_id="ABG83071.1"
FT                   /translation="MLEQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYE
FT                   IVDNSIDEALAGYCKNIKVYIHKDNSVTVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAG
FT                   GKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLEKIGEA
FT                   EGSGTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHY
FT                   EGGIKSFVSYLNRNKEVLHDEPIYVEGLKDGIAVEVSLQYHDGFNENIFTFANNIDTVE
FT                   GGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISEPQFEGQT
FT                   KTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTRKS
FT                   VLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEK
FT                   QRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFY
FT                   RYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSVNVQRYKGL
FT                   GEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSN
FT                   LDI"
FT   gene            7101..9620
FT                   /gene="gyrA"
FT                   /locus_tag="CPF_0007"
FT   CDS_pept        7101..9620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CPF_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05653; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84520"
FT                   /db_xref="GOA:A0A0H2YV49"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV49"
FT                   /protein_id="ABG84520.1"
FT                   /translation="MSLNEGKVIPIDINKEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMQELGLYPERGYRKCARIVGEVLGKYHPHGDSSVYDALVRMAQDFSLRYMLVD
FT                   GHGNFGSVDGDSAAAMRYTEAKMNKIASEMLRDINKNTVDFIPNFDGEEKEPVVLPSRY
FT                   PNLLVNGSSGIAVGMATNIPPHNLGEVIDGTIALIDNPELTSLELMTYIKGPDFPTAGI
FT                   IMGKSGIRAAYETGKGRIVVRAKAEIEEENGRHKIIVTELPYQVNKAKLIEYIADLVKD
FT                   KKITGISDLRDESDREGMRMVIELKRDANPNVTLNLLYKHTKMQDTFGVIMLALVDNQP
FT                   QILNLKQVLVHYINFQKDVITRRTQFELNKAKERAHILEGLIIALDNIDDVINIIRSSK
FT                   TSEIAKNTLIERFSLSEKQAAAILEMRLRRLTGLERDKIENEYNELMKLIDYLNAILAS
FT                   EERLLEVIKEELLEIKAKYSDERRTQIEKQENEIDIEDLIQEEDVVITLTHTGYIKRIS
FT                   SDVYSAQKRGGKGIQAMTTKEDDFVENVLVTSTHSNLLFFTTKGKVYKIKAYEVPDAGR
FT                   TAKGTNLVNILPLEADEKIQTVLSFKDVQEDGYLFMGTKLGIVKKTPLKDFKNIRKNGL
FT                   IALNLREGDELLRAKITYGDADIIFVTQDGNAIRFNETDVRPMGRTASGVKAISLREGD
FT                   VAVCMDIAVEDEKLLVVSENGYGKRTNLDEYKVQNRGGIGLITYKVSDKTGKVVGATVC
FT                   KEDDELMLINNQGVAIRINVSDISVTSRSAMGVKLMRTLEDEAVVTIAKISGDTNEEEE
FT                   EMTLLDESEDTNIIVEEVATEVKDEEN"
FT   gene            10165..11682
FT                   /gene="rrsA"
FT                   /locus_tag="CPF_2998"
FT   rRNA            10165..11682
FT                   /gene="rrsA"
FT                   /locus_tag="CPF_2998"
FT                   /product="16S ribosomal RNA"
FT   gene            11868..14773
FT                   /gene="rrlA"
FT                   /locus_tag="CPF_2999"
FT   rRNA            11868..14773
FT                   /gene="rrlA"
FT                   /locus_tag="CPF_2999"
FT                   /product="23S ribosomal RNA"
FT   gene            14868..14986
FT                   /gene="rrfA"
FT                   /locus_tag="CPF_3000"
FT   rRNA            14868..14986
FT                   /gene="rrfA"
FT                   /locus_tag="CPF_3000"
FT                   /product="5S ribosomal RNA"
FT   gene            14992..15068
FT                   /locus_tag="CPF_0008"
FT   tRNA            14992..15068
FT                   /locus_tag="CPF_0008"
FT                   /product="tRNA-Met"
FT   gene            15074..15149
FT                   /locus_tag="CPF_0009"
FT   tRNA            15074..15149
FT                   /locus_tag="CPF_0009"
FT                   /product="tRNA-Ala"
FT   gene            15422..15925
FT                   /locus_tag="CPF_0010"
FT   CDS_pept        15422..15925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34741.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82919"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR95"
FT                   /protein_id="ABG82919.1"
FT                   /translation="MSYRIKQFLWAISANFKELDYSYVRSILNDYEFSLFKRLKKGEQL
FT                   HSIKVSKDCVNLAKSKGINSESELKIFSKLGLLHDIGKLYYPLNIMTKSFLVLGKKISK
FT                   NRISKFQNIKPIYIYYNHGDKAFDYLREDDYDKEFVEAIRGHHSIKSSKNILLCILKEA
FT                   DDMN"
FT   gene            16274..19030
FT                   /locus_tag="CPF_0011"
FT   CDS_pept        16274..19030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0011"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03699"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82295"
FT                   /db_xref="GOA:Q0TV56"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV56"
FT                   /protein_id="ABG82295.1"
FT                   /translation="MKNKILNTVLISILLLVVVFFVSTNFIINVQWFKEVGYLNVFFTK
FT                   LIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLVGDTKFKSVKKYFLLSNLVISILGAG
FT                   ATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKLPLVQSLFSTAISLIIILVLITV
FT                   IIYLALGFKDKIYQNKDNVININSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLKSYNL
FT                   VYSTRGVSYGAGYTDVKITMIFYKVIAVACVISSIVVFISILKLKFRPIIISIASIAVL
FT                   IVLEPVVAIFTQQFVVKPNEMELEKPYISYSIDATKKAFNIDEIEVKEMEPNENITSEK
FT                   LEDNKDIIENLKVNSTGPLLSFYQQVQLIKNYYEFNDADTDRYNINGKYTQVFVSPREI
FT                   NRDSMTTWQNKHLRYTHGYGLAMSRVNSVTEFGQPDFVMKDIPTVNTTDINLENPRIYF
FT                   GESDNDYVIVNTEGGEFDYPTGDTENTFNYNGTGGLKMTPFNRVLFSIYERNPKILMSS
FT                   SITSESRIILNRNIVKRVQEIAPFLTYDSDPYIVVHDGRLVWMMDAYTSTDKYPFSEPH
FT                   EGVNYIRNSVKVVVDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLSEMPEDLKEHFR
FT                   YPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLEVVKHGGENLSQGDEGKEESILNK
FT                   AKENKNNEAENEGLYLMTKLPDEENVEMMLLDYFNMRGKQSMVALLGARMDGDNYGELV
FT                   MYKFPPQRTIYSPILFKNRIQQDPNISKEISLWAGKGSEVIYGDIIIVPIEDSLLYLNT
FT                   IYLKANSENSMPEMKRVILSNGDKIVIEENIEKALLKLFNYSSSEENKNSNKDETPKNE
FT                   ITSDNSGIKEAADLFNKAIEAQKNGDWATYGEFINKLGDILNKMSQE"
FT   gene            19273..20667
FT                   /locus_tag="CPF_0012"
FT   CDS_pept        19273..20667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0012"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84191"
FT                   /db_xref="GOA:A0A0H2YT18"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT18"
FT                   /protein_id="ABG84191.1"
FT                   /translation="MDYDVLILGGGIIGCSVAYELSKYNLNIALIEKDFDIADDVSFVN
FT                   TAIVYDGSECKDNLMSYLENMGNMMLPEITKKLNVPFKRVGHLTIADNDETVRIIEENY
FT                   KRAKSRGINNIYLIDEKRAREIEPNYKGEIKKAMYSENIAVTSPYDLAIGFAEIAYDNG
FT                   VSFRLEEVVLDIQSIAKGFKVTTNKNKFTCRFVINTTPSEHYTIDQDKDYEQKNALKTY
FT                   YLLLNDEIKEKTSNIVVKLKNEEEFIIQKNTVNGDTLIGINSNNSLGFMKSLKIAKEMI
FT                   NSISRKHVKDIFYDNHNQDRLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKIICDEIID
FT                   KLNCSLNKNFVDKRREFYRFRELSNEERNELISLDKRYGKIVCLCNGISEGEIVDCIRR
FT                   PLGARTVEGVKRRTGATFGTCHGAYCISKIINILARELEKKPTEIVEDSKNSKVLASRI
FT                   KEFDRV"
FT   gene            20680..20913
FT                   /locus_tag="CPF_0013"
FT   CDS_pept        20680..20913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E96901"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83544"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRJ2"
FT                   /protein_id="ABG83544.1"
FT                   /translation="MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLY
FT                   VGVPTKSGNVVCKNIMNTGVDIICTKNLPKDS"
FT   gene            21265..22542
FT                   /gene="serS"
FT                   /locus_tag="CPF_0014"
FT   CDS_pept        21265..22542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CPF_0014"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82627"
FT                   /db_xref="GOA:Q0TV53"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV53"
FT                   /protein_id="ABG82627.1"
FT                   /translation="MLDLKKLRSNTEEVKKALSNRGEDFDVNVIDEVIALDEERRKILV
FT                   DVEALKKQRNEVSAEIPKRKKAGEDVTEVMAEMREIGGKIKADDAKVAELNDKINYIML
FT                   RIPNIPNPAVPEGETDEDNVEIKRWGEPTKFNFEPKAHWDLGTDLDLLDFERGGKVAGS
FT                   RFTVYKGMGARLERSIINYFLDKHTFENGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFK
FT                   VENNGYFLIPTAEVPVTNMYRNETLEGDKLPIKHAAYSACFRAEAGSAGRDTRGLIRQH
FT                   QFNKVELVKFCKPEQSYEELDKLVQDAESVLQGLGLPYRIVRICKGDLGFTAALKYDIE
FT                   VWMPSYNRYVEISSCSNFEDFQARRANIKYKNSPKEKPQFVHTLNGSGVAIGRTVAAIL
FT                   ENYQQEDGSVVIPEALKEYMRCDLLK"
FT   gene            22719..23138
FT                   /locus_tag="CPF_0015"
FT   CDS_pept        22719..23138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVD7"
FT                   /protein_id="ABG84857.1"
FT                   /translation="MDNCKYNYKCNCECNWDKYEDNCHKCRKLEKVAEELTRESAELNE
FT                   AVEEKLEGVKYIQKEIDELEERLECLRKKQKSLFCEAMELDRELDKTVFEAFKHLFATI
FT                   ECYKKYKNNERPERPEKPDKPGRPGCGCKYCCKDR"
FT   gene            23280..23370
FT                   /locus_tag="CPF_0016"
FT   tRNA            23280..23370
FT                   /locus_tag="CPF_0016"
FT                   /product="tRNA-Ser"
FT   gene            23404..23494
FT                   /locus_tag="CPF_0017"
FT   tRNA            23404..23494
FT                   /locus_tag="CPF_0017"
FT                   /product="tRNA-Ser"
FT   gene            23755..24021
FT                   /locus_tag="CPF_0018"
FT   CDS_pept        23755..24021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83266"
FT                   /db_xref="GOA:A0A0H2YQV9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQV9"
FT                   /protein_id="ABG83266.1"
FT                   /translation="MKGSSGPVRPKKPKRSTAYTLSLYLGWSSIFAALYFFIVGLPFSI
FT                   PGIIAGYIAFKKHNEGKLPLILNIIGFLLTVFTWVLFMKIPLK"
FT   gene            24130..24220
FT                   /locus_tag="CPF_0019"
FT   tRNA            24130..24220
FT                   /locus_tag="CPF_0019"
FT                   /product="tRNA-Ser"
FT   gene            24226..24316
FT                   /locus_tag="CPF_0020"
FT   tRNA            24226..24316
FT                   /locus_tag="CPF_0020"
FT                   /product="tRNA-Ser"
FT   gene            complement(24351..24533)
FT                   /locus_tag="CPF_0021"
FT   CDS_pept        complement(24351..24533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83770"
FT                   /db_xref="GOA:A0A0H2YTC3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTC3"
FT                   /protein_id="ABG83770.1"
FT                   /translation="MSTFLYFIFFTFIIYILLTGFFKKVFKEAFIELLNEDNEKLKLFI
FT                   KECLREHDFSKRNKN"
FT   gene            24771..25652
FT                   /locus_tag="CPF_0022"
FT   CDS_pept        24771..25652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36323.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84066"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSR7"
FT                   /protein_id="ABG84066.1"
FT                   /translation="MKVEKLNDIKNNSKEIIFNSNSKIVLFSDCHRGDGTYKDSLAPNI
FT                   NIYLSAIRYYYKNKFTYIEVGDGDELWKFKDIQEIYDMNYEIYEVLEEFKEKNRLYMIY
FT                   GNHDKDKSKIKFLRKNKRRNRFNHSASDFYSTLEIYESLVLVHEESKKDFFVIHGHQID
FT                   FLNNELAFLSKFLVRYVWAILEAFMGFKDPTSPAKSNNKRNLFDEKISKWAEENKTRVI
FT                   LGHTHKTLFPKSRNESTYFNIGCCVLPRTITAIEIERGEISLIKWTIKADEKGSLFVGR
FT                   DIIGGPIRIENY"
FT   gene            complement(25741..25905)
FT                   /locus_tag="CPF_0023"
FT   CDS_pept        complement(25741..25905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84879"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUW7"
FT                   /protein_id="ABG84879.1"
FT                   /translation="MKIGDTFKKFMDTTAEIETKLGNPMACFLEEQEREEKEKKAHHKE
FT                   VKAKGKNDN"
FT   gene            26114..29590
FT                   /gene="addB"
FT                   /locus_tag="CPF_0024"
FT   CDS_pept        26114..29590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="CPF_0024"
FT                   /product="ATP-dependent nuclease, subunit B"
FT                   /note="identified by similarity to SP:P23477; match to
FT                   protein family HMM TIGR02773"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82499"
FT                   /db_xref="GOA:Q0TV47"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV47"
FT                   /protein_id="ABG82499.1"
FT                   /translation="MGLKIIYGRAGTGKSTFCINQIKKKINNSPTNKLILIVPEQFTFQ
FT                   TENKVLNAIGERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDLGD
FT                   NMTVFKNASRQKGFIDIASKTITEFKKYNVNNEVLDLTINEIEDENLKMKMEELKDVFN
FT                   EFNSRLHEGYVDEEDQLLLLNEKLDGCSLYDGAEIWIDEFSSFTPNQLSVIGKLLKRAK
FT                   SVNITLSIDEVNSPKGESDLFVATKNTEKRLMNLIQEEGIAFNGYINLNEDISYRFKEN
FT                   KELAHIERQLYAYPFKQYRGKNNSLRLYRANNNYDEIEFVAKDILRLVREKQYRFKDIS
FT                   VICRDVDNYEKVVSAIFAEYEIPYYIDKKIDIASNPLIVFINSAVDIISKNWTYESMFK
FT                   YLKTGLIKEFRGIEGAELIDELENYVLAYGIKGKKWMEEWVNYSSSILKEEEISEEDKQ
FT                   RLERLNDIRENIVTPLDEFNKQCKGKKTLKEFATILYEFLDSKLDVMDTIDKYVDYFKE
FT                   NDMAIEAKEYYEVRDIFIDVLEQAVDVLGNEVMDLNEFMKVLNIGLSQYEMGLIPVALD
FT                   QVNIGDITRIKSRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLEKGISLASDTRT
FT                   KIFEEQFLVYTAFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKILPNVKEESEGFKL
FT                   VDDKYEKISAKLPTLNELMIAIRKNYDGAEIEDYWKYVYDWYLREPKWKERIEYVRKGL
FT                   EYTNLENNISKEKAKKLYEDNKNKISLSVSRLERYAQCPFAYYIQYGLKAKDRKIYEFT
FT                   APDLGSFMHEILDEFTNEIKEKDLKWSDLSKENCRNIINSLVDNQVKNNKSSILNSSKR
FT                   YSYFTDRFKRILTKSVMVISEQMKRSDFEIYKNELAFGFSKDVNSIKLDLPSGESFYLN
FT                   GRIDRVDKLNLDGETYLRIIDYKTGSKKFDLNKFYNGLQMQLLVYLDALINNSENIVEN
FT                   QAMPGAILYFRIDDPILKSKGDLTEEEIKSEVLKELKLEGLLLDDVKVVKAMDNTLEPG
FT                   THSLIIPANMKKAGDLGKNKALITMEQFELLRKYVNEKMVEICQNMIEGKIDIEPCKEN
FT                   KNIVCDYCNYSHICQFDSSLEDNRYKVIPKKKDEDIWKSINEKVGGEVNGD"
FT   gene            29580..33395
FT                   /gene="addA"
FT                   /locus_tag="CPF_0025"
FT   CDS_pept        29580..33395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="CPF_0025"
FT                   /product="ATP-dependent nuclease, subunit A"
FT                   /note="identified by similarity to SP:P23478; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   TIGR02785"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82931"
FT                   /db_xref="GOA:Q0TV46"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV46"
FT                   /protein_id="ABG82931.1"
FT                   /translation="MGTKWTEEQELAINTRKCNLLVAAAAGSGKTAVLVERIIKMITEG
FT                   ENPVDIDKLLVVTFTNAAASEMRERIGDAISKALEKDPSSEALQRQLALLNRASITTMH
FT                   SFCLEVIKNNFHLIDLDPGFRIGDQTECELIKQDILADLFEDMYAKDDECFKDLVEAYG
FT                   GSKSDDNLNSIILKFYNFIMSGPWPETWLKDKVEEFNINSIEELEGKKWIEVLKESIIL
FT                   DLNNAYSMLTQARDIAEMGGGLEPYLVNIYPEIIQVEELRIALSEGIVKFYNKLMGASF
FT                   GRLKSVRKASVDDERALEKAKSLRDESKKIIENLRDNVFETSLEEAVLGMKKMYPLMKC
FT                   LSGLVIEFSNRYRDKKREKDILDFNDLEHLCLEILIDKDEEGNIKPSQVALEFKDKFEE
FT                   VLVDEYQDSNTIQETIVGMVSRRDVENPNVFMVGDVKQSIYKFRQANPELFLEKYINYR
FT                   EFEDSNRKIMLYKNFRSREEIINGVNYIFKTLMSNTVGELEYDEKEALNLGASYGELNE
FT                   ENVEKEYIDEIENLKVAGDIELNILNKAGNKEYRDDDELGEEEEDLDSIQLEARIIGKK
FT                   IKELMNPEDGSHYMVFDKDLGKYRRIKYKDIVILLRATKNWAETFVDELGTYGIPVYAD
FT                   TGTGYFQTIEIRTILALLHIIDNPMQDIYILSALRSPIFSFTSEEFADLRLLNKDKYFF
FT                   EIIKEVVDGIYDESISKELKGKCKYFLDYLNKWREKAAYMPIDEFIWFLYSDTSYYGYV
FT                   GTMPNGVQRQANLRILFQRAKQYESTSFKGLFNFINFINKLKKSSGDMGSAKILGENEN
FT                   VVRIMSIHKSKGLEFPVVILGGTGKQFNKMDLREDILLHETLGIGTNCIDVKKRIKYDT
FT                   LQKHAIKKKCELEVLSEEMRILYVAFTRAKEKLIITGAVSDLEKSCENWCKASASSGDN
FT                   RINPGNVLKGKSYLDWICMALTKHKDGDAIRNIGNGDITLNLDDKSNWSFKSWDRSELL
FT                   ETNNNKKEKNNIDIFESNNWIESKKDIKEVIEIRDRLGFKYKYIESCNTPSNISVTELK
FT                   RAHQEEEFMQESYNIIDNESNEENKKEKIKRKPRFMEERQEEFSAAKKGTITHFVMQHI
FT                   DLDKVTYIDEIREEVLKMVKKELLTEEEGKVVNVFKIQKFFKSDLGQRMLNSYKSGKKV
FT                   YRELPFITEIPSSIIEKNLDPKIYGEEKVRLQGIIDAFFEEEDGYVLLDYKTDYVKEGE
FT                   EEDFINKYKIQINLYKDTLNKILGEEVKEAYLYSFYLEKELKISKE"
FT   gene            complement(33434..34708)
FT                   /locus_tag="CPF_0026"
FT   CDS_pept        complement(33434..34708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0026"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83729"
FT                   /db_xref="GOA:A0A0H2YRZ0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRZ0"
FT                   /protein_id="ABG83729.1"
FT                   /translation="MLMKLPNNVQYILEKFNSNGFEAFIVGGCVRDSLLNKKPQDYDIT
FT                   TNAFPEKIEELFDKTIPTGIKHGTVTVLIDKNPYEVTTYRVDGEYLNNRKPKDVKFVSN
FT                   IEEDLSRRDFTINAMAYSPYLGFKDCFNGKDDLKNKLIRCVGDPDKRFSEDALRMLRAI
FT                   RFSCQLNFKIEKLTAESIRKNFKLIKNISMERIQSEFTKIILSNDPDRGLMLLRKLGFS
FT                   DFLVEEFKNLKLINCYDLYDDIHDTYGLINSLPKKLHVRLAGLFYKVFNSENAVEKCRT
FT                   ILKKLKYDNNTINDTCNLVENINNISCNMTRKKLKLLINSVGTENIFDLLDLQKSYLSY
FT                   MDEYDTECIDILKNRVSDILASKEPIFIKDLAITGNDLITELNFKPGKNIGVILNFLLE
FT                   NVMQTPELNNKEDLLNLSKQFYSYN"
FT   gene            34839..35810
FT                   /gene="yhaM"
FT                   /locus_tag="CPF_0027"
FT   CDS_pept        34839..35810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaM"
FT                   /locus_tag="CPF_0027"
FT                   /product="3'-5' exoribonuclease YhaM"
FT                   /note="identified by similarity to SP:O07521; match to
FT                   protein family HMM PF01336; match to protein family HMM
FT                   PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82742"
FT                   /db_xref="GOA:A0A0H2YPL7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL7"
FT                   /protein_id="ABG82742.1"
FT                   /translation="MEIPVKKIGEFVKGERVEGFFLLKSVTLKTTNSGGKKYLDLVLSD
FT                   KTGDILGKVWEIKPEHEELKSNTVFKIRGTVNSWQGTLQLKVEHASKVTEEDNINLDDF
FT                   VQSAPYTSDEMFNTIKDTVHNMNDVDIKNILNRVLEINKDKLMYYPAAKSNHHSIKGGL
FT                   LYHITTMLKLAENICGIYDFLNRDLVYAGVILHDMAKIKEMSSNEMGIVDEYTLEGTLL
FT                   GHITQGIKEIEVIGKEVNADSKIIMLLQHMVLSHHYEPEYGSPVKPLIPEAEMLHYLDV
FT                   MDARMYDMKKAIKETKENEFSERIWSLDSRRIYNHGMYEKNN"
FT   gene            complement(35842..37002)
FT                   /locus_tag="CPF_0028"
FT   CDS_pept        complement(35842..37002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0028"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83474"
FT                   /db_xref="GOA:A0A0H2YS13"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS13"
FT                   /protein_id="ABG83474.1"
FT                   /translation="MKNKKLLISISSAISVLLIIVVSYFIFSYSNNLNKFKEDLSSNNY
FT                   EDASYCFNNGTKNIILKKTFIKSSEDIITEKLSEIENEYYSGDISEEETVEDLNGLLSL
FT                   NTSNEEILNFKNTLPLIKDSKDSFDIGISKLDEGNYLEALNYFKSVHNLSDCKPQALEY
FT                   EETCLDKIREPILKTVDEYISNEKYSKGIEYLDSQINFLPDDPKLQEKRDELEKLRLEH
FT                   LEDYSQKNIDKATARTAPVMEYYKKLNEDTINQFDITSNTNYLVFVNIAEQKTYVYEGS
FT                   KNDWTLDKTFTCSTGIEGKETPVGVFTVQNRAPWFFSPKYGQGGKYYVQFMGNYLFHSI
FT                   PFDSDRTTVSDPTLGVPSSHGCIRLSVEDSKWLYDNVQNGSKIIIY"
FT   gene            37194..38414
FT                   /gene="pepT"
FT                   /locus_tag="CPF_0029"
FT   CDS_pept        37194..38414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="CPF_0029"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01882"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84056"
FT                   /db_xref="GOA:Q0TV42"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV42"
FT                   /protein_id="ABG84056.1"
FT                   /translation="MKKVHERFLEYVKVDTKSDETTRVTPSTKGQLELGKILAEELKEI
FT                   GVDEVRISDKGYVYACLKSNCDKDIPKIGFISHMDTAPDMSGKNVNPKIVENYDGKDIE
FT                   LGNGYTLSPSFSPELPMYKGQTLITTDGTTLLGADDKAGVAEIVTAIEYLINNPEIKHG
FT                   DIKIGFTPDEEIGEGADHFDVEGFGADFAYTLDGGRIGELEYENFNAASAKVEIIGKNV
FT                   HPGSAKGKMINSILVAHEFVSMLPLDEVPEKTEGYEGFSFLLDIQGEVEKTSLSFIIRD
FT                   FDKEGFKNRKERFNEIAKELNKKYGEGTVTVTLKDQYMNMKEMIEPRMHIVETAEKAMK
FT                   QCGIEPIKNPIRGGTDGARLSFMGLPTPNLFTGGENFHGRYEYISINSMEKAVEVILNI
FT                   IKIYAEK"
FT   gene            complement(38520..39395)
FT                   /locus_tag="CPF_0030"
FT   CDS_pept        complement(38520..39395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0030"
FT                   /product="degV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84878"
FT                   /db_xref="GOA:A0A0H2YUU0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUU0"
FT                   /protein_id="ABG84878.1"
FT                   /translation="MKKFVIFTDSAADLPKSMVKDLDINYLGLICNINNTEYIDNIDSE
FT                   LTPKAFYNKLREGIMPSTSQVNSFRFVEAFEEYVKQGISILYLAFSSALSGTYNSSLIA
FT                   REELLEKYPDADIKIVDTRAACLGQGLLVYYAAQMKKDGKSIDEIYSWVEENKNKLCHY
FT                   FTVDSLDHLKRGGRISSTAAAIGSLLSIKPMLYVNDAGELHNFAKAKGRKKSLKMLFQE
FT                   LEKRIVNPNEQTIFIAHSDCIEDAETLAEMIREKYTVKDIIIDYIGIVIGSHTGIGTLA
FT                   VFFLGDTKEP"
FT   gene            39585..39661
FT                   /locus_tag="CPF_0031"
FT   tRNA            39585..39661
FT                   /locus_tag="CPF_0031"
FT                   /product="tRNA-Arg"
FT   gene            39832..40971
FT                   /locus_tag="CPF_0032"
FT   CDS_pept        39832..40971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82436"
FT                   /db_xref="GOA:A0A0H2YNQ6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR015093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNQ6"
FT                   /protein_id="ABG82436.1"
FT                   /translation="MNYDFIITILDEHNESSILLAEKLKPKEIIYLYKKDEELKVLNSL
FT                   RQFYLNKFPNCNFSDEKLGKDTISSIEEIIKRMKSKNTAICLNQGNKKDILIMYTLALK
FT                   HNIDGFFLDIPKEELLKLNLESVQCEKCNFVDLDVEDIIDSIGASIVVDSTEISEINII
FT                   ETMTNYIASNLDLWKKYKIRLSDNSVFIHDESNPRSIKIDKELLSREEVMLLDKILNFL
FT                   EKNGQIKVKELEQCLKVTFQNEFIKGFIFKSGTWLEVLTKNIIEEIKSIDDIKSGLLFL
FT                   WNDKESRVKNELDVVAIKDSVLICVSCKDSKKYDEVALNELNVYSEQLGGENVIKILVA
FT                   THPPIKSSISKRAKEMGINLVVFDGNKKAFKEELEKIIK"
FT   gene            complement(41086..41970)
FT                   /gene="psd"
FT                   /locus_tag="CPF_0033"
FT   CDS_pept        complement(41086..41970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="CPF_0033"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by similarity to SP:P10740; match to
FT                   protein family HMM PF02666; match to protein family HMM
FT                   TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82267"
FT                   /db_xref="GOA:Q0TV39"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV39"
FT                   /protein_id="ABG82267.1"
FT                   /translation="MIKIYNRKTKAYDVEQVAGLKYINWSYASPIGKSFLELFIKKKMF
FT                   SKLYGNFCDSSLSKKKIKAFIDEFNIDMSLCNKNIDEFENFNDFFARTLTPEARPIDYS
FT                   ENILISPGDGRLSAFENIDLNKVVQIKGYTYSLKELIDDPKVAEEFEGGTCLILRLCPT
FT                   DYHRFHFVDSGTCSESKKISGFYYSVNPIALNNVSELFCKNKREWSIFNSDNFGKILHV
FT                   EVGATCVGTILQTYSPEKRVKKGEEKGYFKFGGSTTILFFKKDTIKIDSDIVEQTKLGF
FT                   ETKVNMGETIGNK"
FT   gene            42133..42702
FT                   /locus_tag="CPF_0034"
FT   CDS_pept        42133..42702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0034"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85055"
FT                   /db_xref="GOA:A0A0H2YVR7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVR7"
FT                   /protein_id="ABG85055.1"
FT                   /translation="MNRTKKAIFEAAINVFATSGYNGSTVDEIASKANVAKGTLYYNFK
FT                   SKEEIFNFVISKGLEIWHEKLTDIENLEDEPIEKLKKLFKMQFELLYENRAFFKMVMSQ
FT                   LWGKETRQDELRNKITEYIEGIERILKEAISKKQIRECDISLLAHSLFGSLISTSLYEL
FT                   SRDKEFNVNKVIDEITINILDGIVIK"
FT   gene            42757..42831
FT                   /locus_tag="CPF_0035"
FT   tRNA            42757..42831
FT                   /locus_tag="CPF_0035"
FT                   /product="tRNA-Arg"
FT   gene            42977..44242
FT                   /locus_tag="CPF_0036"
FT   CDS_pept        42977..44242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0036"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84237"
FT                   /db_xref="GOA:A0A0H2YUH1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH1"
FT                   /protein_id="ABG84237.1"
FT                   /translation="MDPYTFQIVLLIILIILSGFFSASETALMALSRIRVRHMVDEEIK
FT                   GAKLLEKLLEDPNKLLGGILIGNNIVNIGASSLASTLAFRIFGDGGVALATGVMTILVL
FT                   IFGEITPKSLAKQNAEKVSLAVAPIINIVVTIFKPLVWLFSSVSSLIVRLLGGDLNKSE
FT                   PFITEEELKTMVDVSEEEGVLEVEEKEMIFNVFEFGDLQVKDIMVQRVNVIAVNVTATY
FT                   EEVLKVIKEQQFSRIPVYNESIDDIVGILNVKDLILLDSDEENFNVTEYMREPFRTFEF
FT                   KKITELFAEMKTTRNHIAVVLDEYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIK
FT                   ENEFVVDGSTRLSDLSDMIGFEIESEEFDSIGGYVIGYLGRMPKVGEEIKTNDFRVIVE
FT                   ELDRNRVKKVRVYTYKREKEES"
FT   gene            44245..44676
FT                   /locus_tag="CPF_0037"
FT   CDS_pept        44245..44676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0037"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82588"
FT                   /db_xref="GOA:A0A0H2YP84"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP84"
FT                   /protein_id="ABG82588.1"
FT                   /translation="MLSLALEEAEKAREKGEVPVGAVIVKDGEIIARAHNLKETLKDPT
FT                   AHAEILAIREACNKLNNWRLHGCEMYVTLEPCPMCAGAILQSRLSKIYIGTFDDTTGAA
FT                   GSVVNILQNHNLNYFLEVVWENDEKCSKILTKFFKDRRG"
FT   gene            44754..45197
FT                   /locus_tag="CPF_0038"
FT   CDS_pept        44754..45197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSJ1"
FT                   /protein_id="ABG83677.1"
FT                   /translation="MMVGYEMNFYEKKFEENIKKLSYYMHRCFNETIGEKVAGIAIEEN
FT                   LLYAWSYYFVTIADEDPKMGDRIMMGLINHFNTLLEDENVRINGKEGAKLMIDPSFCRV
FT                   WFGTSLNVMLVKKYGEEDYKEVFNYIKDNYLQKECKIRSLKVS"
FT   gene            45310..45675
FT                   /locus_tag="CPF_0039"
FT   CDS_pept        45310..45675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO79590.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83258"
FT                   /db_xref="GOA:A0A0H2YQS2"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQS2"
FT                   /protein_id="ABG83258.1"
FT                   /translation="MKINKRYLAIFLILLIIEVFIALFVHDNFIRPYIGDVLVVIVIYT
FT                   FIRGIIGRKIKNLPIYIFLFGVLVEVLQYFRIVEILHLQNSRFFTILIGTSFDVKDIIC
FT                   YFVGTLILIFWEVINKE"
FT   gene            45836..46447
FT                   /locus_tag="CPF_0040"
FT   CDS_pept        45836..46447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35771.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83212"
FT                   /db_xref="GOA:A0A0H2YQN7"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQN7"
FT                   /protein_id="ABG83212.1"
FT                   /translation="MLTIINIDVVHVTEAQSVKIEIETEEDIPIVSDVFITVDDAKKWA
FT                   QGKGATKEFVELADLYWEYSDEHGDVNPALAYVQAAKETAYGNFGGVLDASYHNPCGLK
FT                   TNKGGSDKDPKAHMKFKSWNEGVKAHLDHLALYAGAEGYPKAETKDPRHFASIFGKANS
FT                   VIDLSKNWAPSPTYGEEILGMYNEMMEGAGNKDIEVMNIF"
FT   gene            complement(46559..48031)
FT                   /locus_tag="CPF_0041"
FT   CDS_pept        complement(46559..48031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS42428.1; match to
FT                   protein family HMM PF02696"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83440"
FT                   /db_xref="GOA:Q0TV32"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV32"
FT                   /protein_id="ABG83440.1"
FT                   /translation="MDNKNFQSKTGFNLENTYLTLPNIFFSEQNPKGSKNPKLIKFNTS
FT                   LAEELGLNEEVLNSDFGLNIFAGNETFPGIVPIAQAYAGHQFGHFTMLGDGRALLLGEH
FT                   VTKDSKRYDVQLKGSGRTIYSRGGDGKAALAPMLREYIISEGMHGLGIPTTRSLAVVNT
FT                   GEEVLRERFEQGAILTRIASSHIRVGTFAYAAQWGTLEDLKSLADYTIKRHFPNIAKSE
FT                   NKYILFLEEVINRQAELIVKWQSVGFIHGVMNTDNMVISGETIDYGPCAFMDTYDTNTV
FT                   FSSIDYAGRYAYGNQPNMALWNLARFSEALLPLLNPNLDEAVNIAKKSISNFSKLYKKY
FT                   WFNKMRAKLGLFTEKENDELLIEGLLSTMQKYEADFTNTFVSLTLNKFEDEKVFSSDEF
FT                   KTWYALWQNRLKEENRSQEEVRNLMMNNNPYIIPRNHLVEKALKNAEKGDFTFMDNLLE
FT                   ALKNPYSYSKDLEKYTKLPEKSDTPYVTYCGT"
FT   gene            48363..49559
FT                   /gene="plc"
FT                   /locus_tag="CPF_0042"
FT   CDS_pept        48363..49559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plc"
FT                   /locus_tag="CPF_0042"
FT                   /product="phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by similarity to SP:P15310; match to
FT                   protein family HMM PF00882"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84486"
FT                   /db_xref="GOA:Q0TV31"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="InterPro:IPR036392"
FT                   /db_xref="PDB:1QM6"
FT                   /db_xref="PDB:1QMD"
FT                   /db_xref="PDB:2WXT"
FT                   /db_xref="PDB:2WXU"
FT                   /db_xref="PDB:2WY6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV31"
FT                   /protein_id="ABG84486.1"
FT                   /translation="MKRKICKALICAALATSLWAGASTKVYAWDGKIDGTGTHAMIVTQ
FT                   GVSILENDLSKNEPESVRKNLEILKENMHELQLGSTYPDYDKNAYDLYQDHFWDPDTDN
FT                   NFSKDNSWYLAYSIPDTGESQIRKFSALARYEWQRGNYKQATFYLGEAMHYFGDIDTPY
FT                   HPANVTAVDSAGHVKFETFAEERKEQYKINTAGCKTNEAFYTDILKNKDFNAWSKEYAR
FT                   GFAKTGKSIYYSHASMSHSWDDWDYAAKVTLANSQKGTAGYIYRFLHDVSEGNDPSVGK
FT                   NVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMTGSKDTYTFKLK
FT                   DENLKIDDIQNMWIRKRKYTAFSDAYKPENIKIIANGKVVVDKDINEWISGNSTYNIK"
FT   gene            49747..50673
FT                   /locus_tag="CPF_0043"
FT   CDS_pept        49747..50673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0043"
FT                   /product="CobW/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82615"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNX8"
FT                   /protein_id="ABG82615.1"
FT                   /translation="MKVDIISGFLGAGKTTLIKKLLDTLVKDEKVAIVENEYGEVGIDG
FT                   DLLKDRRIEVKEINSGCICCTIKGDFKQNILDIISNYRPDRIIIEPSGVANFSQVLESI
FT                   KEAHIEGLRINMKITMVDAQNVHMYMKNFGDFYRSQLVNANTIILTRVEKLSDKEITHV
FT                   CNEIKTINNKANIITTELSKLSPERIIQVSEKKVENLIENINIKKPKRIGLRRVSAPEF
FT                   FENWGVETPKTFEYSELVKILNEFQNNKHGEVLRAKGIIKSKDNKWFKFDFVPNDISIV
FT                   NYKSDYTGRVCVIGRNLNKDSIDKLFS"
FT   gene            50693..51277
FT                   /locus_tag="CPF_0044"
FT   CDS_pept        50693..51277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35532.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83355"
FT                   /db_xref="GOA:A0A0H2YSB3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSB3"
FT                   /protein_id="ABG83355.1"
FT                   /translation="MKKCSVDLITGFLSSGKTSFINHILDDFSKEEVLVIQCERGQEEL
FT                   INCRKNINVKKFYSMDELKEEDLIRSIKFYAPKRVFIECNGVSETKKFIDKVTNSKLKE
FT                   YLKIGIIVNLIDMTTFNMFLKNIPSMIIPNISLSNLIVLNKCNEISENALKEYKDMIER
FT                   FNHNAHIVNCIGKEGTNMNFNKERLINRMMG"
FT   gene            51280..52173
FT                   /locus_tag="CPF_0045"
FT   CDS_pept        51280..52173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0045"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF03773"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83851"
FT                   /db_xref="GOA:A0A0H2YSA3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSA3"
FT                   /protein_id="ABG83851.2"
FT                   /translation="MELLNKFSIVFSSIVIEALPFILIGAVLASFMQVYISNNIFNKII
FT                   SKNKLLGSIQAGIIGVFLPVCECATVPITKGLLNKKVPLNVAITYMLAAPIVNPLVILS
FT                   TYYAFDGNIKVVLLRVGVGFSIAVIAGLLMLCLSGENNIFIDNGEGELQGKCLCGCSEI
FT                   DDNSSKLIRLLKHTSLEFYEIGKYFIVGATLAAIFQTFVPRDIIFYFENSAVLSIIILM
FT                   AFSFLISLCSEADAFVASTFMNRFSLGSITGFLIIGPMIDLKNTIMLFSIFKKSFVIKL
FT                   LFVVFSLCFIASALIF"
FT   gene            52186..52905
FT                   /locus_tag="CPF_0046"
FT   CDS_pept        52186..52905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C97096; match to
FT                   protein family HMM PF09323"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84665"
FT                   /db_xref="GOA:A0A0H2YUD6"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUD6"
FT                   /protein_id="ABG84665.1"
FT                   /translation="MRKFNFSEFIWFLILFCFEYLIIKMFMSEKIFLIISRDMKAYVIL
FT                   AIILLFLILVIQFFNIFKTSTRRSFKGGYLIFIFALVILNIANGLNINQVSLNLKGVKL
FT                   YHDRHKESEHNHLHSNEKLNSNEALVFTEKNFHSSLEELILHLEDFVGKEISIEGLLYV
FT                   SELYEKEEFAITQIDMTCCIADSVYLGVLCKGDLPDLKNGSEIKVKGLVESKKIKNSAG
FT                   EEIEIPFINVFYTDTLQ"
FT   gene            53171..53959
FT                   /gene="lgt"
FT                   /locus_tag="CPF_0047"
FT   CDS_pept        53171..53959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="CPF_0047"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82351"
FT                   /db_xref="GOA:A0A0H2YNR9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNR9"
FT                   /protein_id="ABG82351.1"
FT                   /translation="MNPVAFSIGSFEVRWYGIIIALGILIAMTLVSINAKKKNLNFDVI
FT                   LDLFLWCFPFAIIGARAYYVLFELENYHSFWDMINIRQGGLAIHGGIIGAFLTAFIYCK
FT                   VKKVDFLAYADIVAPAFILAQGIGRWGNFFNQEAHGGQVTSEFISKFPEFIQRGMYING
FT                   AYYHPTFLYESIWDIFVAILLMIILYNITDRYKGVVISAYISLYSLGRFFIEGLRTDSL
FT                   YFMNIRVAQLVSLLGIIIGIVAIIIIVSRGKKKRKGIFIN"
FT   gene            54210..54299
FT                   /locus_tag="CPF_0048"
FT   tRNA            54210..54299
FT                   /locus_tag="CPF_0048"
FT                   /product="tRNA-Ser"
FT   gene            54732..55235
FT                   /locus_tag="CPF_0049"
FT   CDS_pept        54732..55235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0049"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS14"
FT                   /protein_id="ABG83230.1"
FT                   /translation="MGRKLLVGILWVTLSLFVLGCSTSGEKNTINIPIEKSREEEKSKD
FT                   EEEYIDKISSTIVNMSVDGSIKNMRTVSETGKLNNTMIEQLERSNNFFKCLIEDLKGVK
FT                   VPEKFASYNDDIINNLNKAKTSLETMKNSHDKEIIKSNAKIFIESNKEVSNLVDKILVY
FT                   YAGC"
FT   gene            55675..56961
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0050"
FT   CDS_pept        55675..56961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0050"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84419"
FT                   /db_xref="GOA:A0A0H2YTL0"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTL0"
FT                   /protein_id="ABG84419.1"
FT                   /translation="MNKKKDILVIGFALFSIFFGAGNLIFPPYIGLTSGSEWLISFLGF
FT                   IISDVGIIFLSIVAVSKAGSFQGVVGRAGKKFGITLEILMMLCLGPILVVPRTAATTFE
FT                   MSISPLLGNVNPYVFSVIFFLIVFVLTIKPNKVMDIIGKVLTPLLLISLAVLIIKGIIN
FT                   PIGDLEKVNSGKLFMTGITQGYQTMDALGTGGIVALVMASFASKGYKDKKENRMLTIKS
FT                   ALIACIGLAIVYGGLTFLGATSSTLYDSSISQTTLLMNITNAILGSTGTIMLAIVIGLA
FT                   CLTTAVGLTSVTAKYFEDVSNKKLKYKYIVIAICVFSALSSNLGVDKIIEIAVPVLSLI
FT                   YPVSILLVVMSIFEKFVPNNVVVKGATYATLLISLLTVIDSLGIKFEFVHKLPLANLGF
FT                   NWVVPAIVGGLIAGLVFRKREVVSLEESY"
FT   gene            complement(57107..57592)
FT                   /gene="folA"
FT                   /locus_tag="CPF_0051"
FT   CDS_pept        complement(57107..57592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="CPF_0051"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by similarity to SP:P11045; match to
FT                   protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84475"
FT                   /db_xref="GOA:A0A0H2YTW0"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTW0"
FT                   /protein_id="ABG84475.1"
FT                   /translation="MFSIIVAKSINNIIGVNNKMPWNIPSDLKRFKELTMGKKILMGRK
FT                   TFESLPFVLPGRTHLVLTTKKDFSYNHKDVIIYNDLNKLISEYKDSMEEIFVIGGGKIY
FT                   SELLKYTSKLYITEVLKEYKGDTYFPKVDYYKWIKTYESSIHEENGNKFKFFNYKKI"
FT   gene            57783..59426
FT                   /gene="dnaX"
FT                   /locus_tag="CPF_0052"
FT   CDS_pept        57783..59426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CPF_0052"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P09122; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF06144; match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82798"
FT                   /db_xref="GOA:A0A0H2YPR7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPR7"
FT                   /protein_id="ABG82798.1"
FT                   /translation="MAYKALYREWRPQTFNDVVGQEHITTTLKNQIINERTAHAYLFCG
FT                   TRGTGKTSTAKVMAKALNCLDLKDGEPCNQCEMCKKINEGLAIDITELDAASNNGVDNI
FT                   RDIIDDVQYPPQEARFKVYIMDEVHMLSIGAVNAFLKTLEEPPKNVVFILATTDPQKLP
FT                   ITILSRCQRFDFKRISRKDITGRLRKIVTEQGIFCDDKSLDLVARVSDGAMRDSLSILD
FT                   QAISIGDGKVDYDELVSMLGLVTNDNLFKIVDSIIKRDIESAMEIIEELVLTGKDMTLF
FT                   IKDLIVHYRNLLMIKVTSNPEEVLDTAEENIEKLKVQGAKLKVEEIMRCIRIVQECDEE
FT                   AKLSKQARVYLELAVIKMCKIEYDTSKEVMLARINKLEQAIRSGNIQVNTNLEEVKSQV
FT                   SNEASNNKTLNNKQQNVTQSSNNYEVVNENSTLTPEYLRKVWKDILETFKSRGKYMVYI
FT                   ALAKGISKVSCNKGVVEFRYTYEYRHNKERLEKHDFSKIVNDIFSEVLKEPVRVVYSVE
FT                   QGTEEEKAEEADLEARLSGIMGDGLEIVEE"
FT   gene            59538..59876
FT                   /locus_tag="CPF_0053"
FT   CDS_pept        59538..59876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0053"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by similarity to SP:Q97MR5; match to
FT                   protein family HMM PF02575; match to protein family HMM
FT                   TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84016"
FT                   /db_xref="GOA:Q0TV21"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV21"
FT                   /protein_id="ABG84016.1"
FT                   /translation="MARGGFPGGMGNMNNLMKQAQMLQKQMQSMQEEIEASEFEGSAGG
FT                   GAVVAKVNGKKELIALNIKPEVVDPDDVEMLEDLVFSAVKQALEKASEETSEKMGKLTG
FT                   GMGMPGLF"
FT   gene            59974..60570
FT                   /gene="recR"
FT                   /locus_tag="CPF_0054"
FT   CDS_pept        59974..60570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CPF_0054"
FT                   /product="recombination protein RecR"
FT                   /note="identified by similarity to SP:P24277; match to
FT                   protein family HMM PF01751; match to protein family HMM
FT                   PF02132; match to protein family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84861"
FT                   /db_xref="GOA:Q0TV20"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TV20"
FT                   /protein_id="ABG84861.1"
FT                   /translation="MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFA
FT                   NALVKARGTIKYCSVCGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGL
FT                   YHVLHGTISPMQGRGPQDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPL
FT                   DVKVTRIAAGIPVGGDLEYADEVTLSKALEGRTVI"
FT   gene            60796..61074
FT                   /locus_tag="CPF_0055"
FT   CDS_pept        60796..61074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23356.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84537"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV64"
FT                   /protein_id="ABG84537.1"
FT                   /translation="MDKKKISDYLIKKIDYSNQDEEILKAIEQTILEMEVARSAFQNAC
FT                   DDKLIESLIYKEQDINARYEYLIREAKKRGIKVSMEHIFKNARISII"
FT   gene            61090..61368
FT                   /gene="bofA"
FT                   /locus_tag="CPF_0056"
FT   CDS_pept        61090..61368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="CPF_0056"
FT                   /product="sigma-K factor processing regulatory protein
FT                   BofA"
FT                   /note="identified by similarity to GB:BAB79755.1; match to
FT                   protein family HMM PF07441; match to protein family HMM
FT                   TIGR02862"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82495"
FT                   /db_xref="GOA:A0A0H2YP21"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP21"
FT                   /protein_id="ABG82495.1"
FT                   /translation="MDIGALSLDDIILLIVGVLVAILILRLIFGSIGKIIGLVINSVFG
FT                   AILLMIVNYFGAYFGITIGINLLTALIAGILGIPGVVLMILFQVFVR"
FT   gene            61643..62788
FT                   /locus_tag="CPF_0057"
FT   CDS_pept        61643..62788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0057"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83760"
FT                   /db_xref="GOA:A0A0H2YS22"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS22"
FT                   /protein_id="ABG83760.1"
FT                   /translation="MKSNNLILDKYKSRGIRGLIVLGITYFFLMGNYSMIRYFFQARQG
FT                   NLDISIINKCFSIGSVDKFLLFLFLVWSVGFLFQDKEKELKENLAVGEENTKKYFFSKV
FT                   ILIYGVSLMPMLINIFIKLIFYIPYRNFFSLDKLSISFLYFIALGLLFTSIIFTMNLIV
FT                   KDRMFAGIFPIFFMEGLILIFSVSELLISDKLIWVRNFLNFIGEKVLLIFNLLNLDFQI
FT                   NSFSLGKQLTFIIILSSISVLLIYISSLILKIMNLKYLDRPYFFEIPRYFIYISMSILI
FT                   GFVFVNAIGYLIIMFIPSVSYVKGTFMVNIASLISMVLLFVFLEILYRRKILNKDLVED
FT                   NIEVCNEIQPCIGDYIEFDETTGFLDNNKTIDKEENFNNSL"
FT   gene            62939..63118
FT                   /locus_tag="CPF_0058"
FT   CDS_pept        62939..63118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSJ5"
FT                   /protein_id="ABG83984.1"
FT                   /translation="MAVGTSINCKYCIDFKNDRCDGTEKNCLCRLCPRNLGQCICVKYC
FT                   RETESVLFWNDEEE"
FT   gene            63187..63369
FT                   /locus_tag="CPF_0059"
FT   CDS_pept        63187..63369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI1"
FT                   /protein_id="ABG84759.1"
FT                   /translation="MAISEEFIDIAENCVDYSARHREAVSSMNSCKSCLNCNEFHSGTC
FT                   EKEMENKFNILQDMI"
FT   gene            63533..64609
FT                   /locus_tag="CPF_0060"
FT   CDS_pept        63533..64609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0060"
FT                   /product="aminotransferase, class V"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82776"
FT                   /db_xref="GOA:A0A0H2YPQ0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPQ0"
FT                   /protein_id="ABG82776.1"
FT                   /translation="MHKKLFIPGPVEVREEVLEKMATPMIGHRSKEASQLQRRISDNLR
FT                   KLFFTNNEILLSTTSGSGLMEGAIRSCTLKKAAVFSVGAFGDRWYEMGISNNVPVDKFE
FT                   VPWGKSINVDLIDSVLKTGQYDLITVTHNETSTGVMNDLEAISKVIRKYPEVIFCVDAV
FT                   SSAGGSKIEVDKLNIDICITSSQKALGLPPGIAICTFSERARERAEKVKFRGTYLDLLA
FT                   LYKYIKKKDYQYPSTPSISHMYALDYQLDYILNVEGLENRFNRHIEMAKIVREWAEKYF
FT                   EIYPEKEYYSNTLTTIKNNKNIDIGALNKELGKRGFQISNGYGKLKDKTFRIAHMADCQ
FT                   VKDIKELLSNINEILELE"
FT   gene            64678..65583
FT                   /locus_tag="CPF_0061"
FT   CDS_pept        64678..65583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0061"
FT                   /product="putative D-3-phosphoglycerate dehydrogenase"
FT                   /note="identified by similarity to SP:P35136; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83555"
FT                   /db_xref="GOA:A0A0H2YSU4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSU4"
FT                   /protein_id="ABG83555.1"
FT                   /translation="MLRILLNDGLDKKAISNLELLGFDVDTNHYDIEDLKEKIKEVDCI
FT                   VIRSATKITRELIDEAIKGGKLKLIIRGGVGLDNIDVQYAEQNGIKVRNTPNASSSSVA
FT                   EIILAHMFSLARFLNQSNITMKDGLWKKKDYVGVELEGKTLGIIGMGRIGSELAKKCTA
FT                   LGMKIIYFDLIDIKNIDNNYRKVEFDELLRKSDFISINISGTKSIIGSEELKKVKKGVF
FT                   IINTSRGKALDEDAIITSLNDGTLGGVGLDVFLEEPSKNLELINHPKVSLTPHIGASTK
FT                   EAQMKIGEEVINIIKEEIYK"
FT   gene            65733..66989
FT                   /locus_tag="CPF_0062"
FT   CDS_pept        65733..66989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H96901; match to
FT                   protein family HMM PF06245"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84452"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTT9"
FT                   /protein_id="ABG84452.1"
FT                   /translation="MVNIKAFKALRPRKDLVEKVAALPYDVLSRDEAKEEVKNNEFSFL
FT                   NIDKAETYFPENISEYSEEVYKKAGENLERFIQNNIFIKEEKDCLYIYELDLDGKSQRG
FT                   IVSCLSVDDYLNNTIKKHEFTRAKKEEDRVKHIKACNAQTGPIFLTYRDSEKISNIVSK
FT                   IVLEKPLYDFISDDGVLHRVWKIDDKSIIDEIIKEFKEINSIYIADGHHRSEAAVKVCL
FT                   ERREKGECLPEDECNYFLGVLFPKTELTVIDYNRVVKDLNGLSEEEFLLKLEEKFQITK
FT                   LNKEDNPKPKHKGEFGMYINGDWFKLEYKEKNESSLIEKTKIDLVKNLDVSILQDNILE
FT                   PILGIKDVRNDERIDFVGGIRGLKELERRVSEDMKVAFALYPTSIEEVMKISDKGLIMP
FT                   PKSTWFEPKLRSGIFIHKI"
FT   gene            complement(67045..67740)
FT                   /gene="mtnN"
FT                   /locus_tag="CPF_0063"
FT   CDS_pept        complement(67045..67740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="CPF_0063"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /note="identified by similarity to SP:O32028; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82399"
FT                   /db_xref="GOA:A0A0H2YPY5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPY5"
FT                   /protein_id="ABG82399.1"
FT                   /translation="MTLGIIAAMSEELEILLKDMEVKSKETKANMTFHQGTLWGQEVVA
FT                   VVCGIGKVNAAVCTQILISEYKVNKVINVGVAGGIGMEIYPGDVVIGNSLVQYDMDTSA
FT                   FGDPIGQIPRLDTFDFKCSQELVDLCEEACKENEEIKSFTGRIVTGDQFVASVEKVKWL
FT                   EEEFGASACEMEGGSIAHVCYLNNIPFLVIRSISDNANNGAHMDFAEFTAIGVKNSTSI
FT                   LKSMILKMA"
FT   gene            68118..68879
FT                   /locus_tag="CPF_0064"
FT   CDS_pept        68118..68879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0064"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83240"
FT                   /db_xref="GOA:A0A0H2YS23"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS23"
FT                   /protein_id="ABG83240.1"
FT                   /translation="MLQHSLSRTELLIGKDALDKLAKSKVMVFGVGGVGSFTVEALARA
FT                   GVGNLILVDDDTVCLTNLNRQIHATYKTISKNKVEVMKERVLSVNRNCNVETIQVFVTP
FT                   DNLEEIIPDDVDYVVDAIDTVSAKIALAVYCEQKGIKLMSSMGTGNKLNPAEFKVADIY
FT                   NTKVCPLAKVMRYELRKRGVKKLKVVYSEEMPRKPKVEDVVTCKTGCVCTGGTKKCSAK
FT                   RQIPGSVSFVPPVAGMIIASEVVKDLIKEYI"
FT   gene            69170..70336
FT                   /locus_tag="CPF_0065"
FT   CDS_pept        69170..70336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0065"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84060"
FT                   /db_xref="GOA:A0A0H2YTI9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTI9"
FT                   /protein_id="ABG84060.1"
FT                   /translation="MNSKKQNYVALAFLFIMMILAAIVENTKGIFIPVFKQEFGVNDNT
FT                   ISNLLISTSAAYMVLTFIGGMLCEKFGQKKVFLAGLMVIFLSLIFLSFTKNYLMLYTGM
FT                   VISSAGIAMVAISCNTVLPILALTAQNVIMNVMHACYGLGSSVGQGLFGSLTARGVNWR
FT                   TMYFFVGLVYLAVFICFIFVKIPRTEIVKEKDKMTIIEALSNKVIVAYMLALGLYVFTE
FT                   QGISNWFVNYMKYGYNINEQKAGMYLSLFFAIFTIGRLFGGFVVEKRGYFNILYKTLII
FT                   GAALCILGLLLGRNGMVIISVSGLFFSITFPTTVLTISKVFDKNVAYITGIVITSASLV
FT                   GMILNKAIGLLNESVGPDKAFYIIPASAILSAILMFYLYLNTKKRLVK"
FT   gene            70715..71299
FT                   /locus_tag="CPF_0066"
FT   CDS_pept        70715..71299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0066"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to SP:P09454; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84831"
FT                   /db_xref="GOA:A0A0H2YUT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUT1"
FT                   /protein_id="ABG84831.1"
FT                   /translation="MGININDFNDKVKLVQFQLNTERLAFRNLTPENTEEMLDYYIRNE
FT                   EHLRQYEPTRDSGFYTYEGQKEILTESFRQFIDGTSIDLGIFKDEKLIGKIKLSNIVYG
FT                   ILRNAFVGYSIDKEHQGKGYMKEALNTVCSYAFEEMGLHRLEASTLIENSRSQGVLKAC
FT                   GFNELGISEKYLYINGEWRDHKIFYKVNDDL"
FT   gene            71391..72002
FT                   /locus_tag="CPF_0067"
FT   CDS_pept        71391..72002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0067"
FT                   /product="deoxyguanosine kinase/deoxyadenosine kinase"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.113"
FT                   /note="identified by similarity to SP:Q59484; match to
FT                   protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82760"
FT                   /db_xref="GOA:A0A0H2YQU4"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQU4"
FT                   /protein_id="ABG82760.1"
FT                   /translation="MIVVDGVVGVGKSTLMNILAERGLIAYEEPVVDNPILEKFYYDRN
FT                   RYSFPLQVFFLNKRFKHIKEAGLVENSVMDRSIYGDVIFAKMLCEKGEMTVEEFELYKE
FT                   LLENMLEHVKAPKLMVYLEISVDEAMKRIQKRGRDYEQVVEREYWEKLNNEYREYFENY
FT                   NVSPILRINVDELDFENVPEDREYVLNLIDEKLSELENNK"
FT   gene            72548..74065
FT                   /gene="rrsB"
FT                   /locus_tag="CPF_3001"
FT   rRNA            72548..74065
FT                   /gene="rrsB"
FT                   /locus_tag="CPF_3001"
FT                   /product="16S ribosomal RNA"
FT   gene            74251..77155
FT                   /gene="rrlB"
FT                   /locus_tag="CPF_3002"
FT   rRNA            74251..77155
FT                   /gene="rrlB"
FT                   /locus_tag="CPF_3002"
FT                   /product="23S ribosomal RNA"
FT   gene            77207..77324
FT                   /gene="rrfB"
FT                   /locus_tag="CPF_3003"
FT   rRNA            77207..77324
FT                   /gene="rrfB"
FT                   /locus_tag="CPF_3003"
FT                   /product="5S ribosomal RNA"
FT   gene            77330..77405
FT                   /locus_tag="CPF_0068"
FT   tRNA            77330..77405
FT                   /locus_tag="CPF_0068"
FT                   /product="tRNA-Lys"
FT   gene            77726..78574
FT                   /locus_tag="CPF_0069"
FT   CDS_pept        77726..78574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0069"
FT                   /product="transcription antiterminator"
FT                   /note="identified by similarity to SP:P15401; match to
FT                   protein family HMM PF00874; match to protein family HMM
FT                   PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83638"
FT                   /db_xref="GOA:A0A0H2YRR4"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRR4"
FT                   /protein_id="ABG83638.1"
FT                   /translation="MIKKTEKAYEVKRAFNNNIVLVDDDEKEIILFAKGIGFNCKKGSI
FT                   IPENTNIEKIFTIQDENNIANFRRVVGSNDEKFIAFCEELILEISRDFSEELNEIIHIG
FT                   LIDHISFAIERMKKGEILRNPFLVEIETLYPKEFEAATKMVKKLEDFTGVSIVDDEIGF
FT                   IAMHIHSARTTGKISHTIKFTYIANTAVEYIEDAFNIEVDRTSLSYARFISHLRFAIER
FT                   LINNTPVKNELLSIIKLKYPESFKVAEEIGKAINEDFSLEVAEDEIGYLALHVERIRKN
FT                   E"
FT   gene            complement(78607..79086)
FT                   /locus_tag="CPF_0070"
FT   CDS_pept        complement(78607..79086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0070"
FT                   /product="putative PTS system, N-acetylglucosamine-specific
FT                   IIA component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM TIGR00830"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82461"
FT                   /db_xref="GOA:A0A0H2YPM6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPM6"
FT                   /protein_id="ABG82461.1"
FT                   /translation="MFGLFKKELKLIAPATGKTIDLSQVPDQVFAEKMAGDGVAIEVTG
FT                   DTIVAPADGELSLVFKTNHAFAMTLSNGIELLVHVGIDTVSLEGEGFERLTEPGQQVKA
FT                   GTPILKIDRDFILGKGLKLHTPVLITNPDMVKDMKPVIGETVTAGNDTVLTYKVK"
FT   gene            79744..81189
FT                   /gene="nagE"
FT                   /locus_tag="CPF_0071"
FT   CDS_pept        79744..81189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="CPF_0071"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83257"
FT                   /db_xref="GOA:A0A0H2YS35"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS35"
FT                   /protein_id="ABG83257.1"
FT                   /translation="MSKKGSKVLGFLQRIGKSLMVPIAVMPALGLLLRLGDKDLLNIPW
FT                   ISAAGGAAFGDNMAMLFAVGIGFGLSDENNGVGGLAGLLGFLVMKNVATSFDPSINMGA
FT                   FGGVVAGVVGGLLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPTFQA
FT                   GLDGFANIMVAAGAIGAGIYGILNRLLIPIGLHHVMNTVIWFQLGSFTDPVSGQIATGD
FT                   IARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLALTAIIT
FT                   GITEPIEFAFMFLSPILYVIHAILTGISLAVAYALNVHLAFSFSGGLIDYILYFGKGQN
FT                   QLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDTETNSKTVSKSEDNPS
FT                   KGGTLAEKAEVVLEALGGKENIEVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLD
FT                   GKNVQVIMGTLADPLASQMKKLL"
FT   gene            complement(81258..81776)
FT                   /locus_tag="CPF_0072"
FT   CDS_pept        complement(81258..81776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0072"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83541"
FT                   /db_xref="GOA:A0A0H2YS86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS86"
FT                   /protein_id="ABG83541.1"
FT                   /translation="MPKIIKNVKEDLLTEGKKQLLSNGYLNLNIRNITKECNIGTGTFY
FT                   NYFKNKEQLVIDILSNDWTSILKISNEIIEEDISFKEKLIFISNNINDFLKNYRLIFSE
FT                   MAKHTSKNHYVIEPMYETLEKLIEIHIEKGEINPPISSDKFAYFLLNNLILTSRSELTI
FT                   DDLLLLLNI"
FT   gene            82379..83896
FT                   /gene="rrsC"
FT                   /locus_tag="CPF_3004"
FT   rRNA            82379..83896
FT                   /gene="rrsC"
FT                   /locus_tag="CPF_3004"
FT                   /product="16S ribosomal RNA"
FT   gene            84082..86986
FT                   /gene="rrlC"
FT                   /locus_tag="CPF_3005"
FT   rRNA            84082..86986
FT                   /gene="rrlC"
FT                   /locus_tag="CPF_3005"
FT                   /product="23S ribosomal RNA"
FT   gene            87038..87155
FT                   /gene="rrfC"
FT                   /locus_tag="CPF_3006"
FT   rRNA            87038..87155
FT                   /gene="rrfC"
FT                   /locus_tag="CPF_3006"
FT                   /product="5S ribosomal RNA"
FT   gene            87165..87239
FT                   /locus_tag="CPF_0073"
FT   tRNA            87165..87239
FT                   /locus_tag="CPF_0073"
FT                   /product="tRNA-Asn"
FT   gene            87896..89986
FT                   /gene="fusA"
FT                   /locus_tag="CPF_0074"
FT   CDS_pept        87896..89986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CPF_0074"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to SP:P80868; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03764; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84487"
FT                   /db_xref="GOA:A0A0H2YUH3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH3"
FT                   /protein_id="ABG84487.1"
FT                   /translation="MKEHKIENLRNIGIIGHSDSGKTALSEALLYYTKTTDRLGTCEDG
FT                   NTISDYDQEEKKRKISLALSIIPFEYDGTKINILDTPGYFDFVGEQIEGVKAADSAIIT
FT                   VCGVTGVQVGTEKAWECCEKEKLPRAFFINKLDRENSNFDKVLENIRNIFGNKVIPTQY
FT                   PLGKEKEFKGIVNLITEEAFKYDKKSGKINKIEIPNEVKDKVNEYRTYLMESVAETDEE
FT                   LLDKYLSEGELTVDEIYKGLSIGFEEGDIAPVMCGSSVSIVGMKSLLDSIKGYFPSPDI
FT                   SKAKVAIDSNNKEILVKSNKDMPFSAFVFKTIADPFVGKLSIFKVQTGELTTDKIIINS
FT                   KNNKVEKVSSLCFLRGKSQIQTSKIGAGDIGAVTKLQYTSTGDTLCESNFKIAYEGFEF
FT                   PEAVMTMAVLPKSKGDEEKISQGLSKLLDEDPTFKVSRDQENAETLVSGIGETHIEVLA
FT                   SKLKSKFGIDVILQDPKIPYRETIKGSSDVQGKHKKQSGGHGQYGDVKIKFEPRRDGEL
FT                   DLEFVDKVVGGVVPRNYIPAVEKGLRDCLKKGVLAGYPVIGIKATLHDGSYHPVDSSEM
FT                   AFKVAASLAYKKGMENAKPVILEPIMKVEIIIPDEYMGDIISDINKKRGRVIGMEPEGN
FT                   NEKVIADIPLSEMFKYATDLRSMTQGRGSFSMEFEKYEEVPSTEVDKIIEDAKKIKEAK
FT                   EA"
FT   gene            90409..90645
FT                   /locus_tag="CPF_0075"
FT   CDS_pept        90409..90645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97292"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83533"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS82"
FT                   /protein_id="ABG83533.1"
FT                   /translation="MCNYRMDIKGKISLSDYSNIFDYINIVDVCDRFMIYMESLDDDNI
FT                   GIICSMLKDNNFNIKNQGYDNQGIYYINAKKIG"
FT   gene            90897..91844
FT                   /locus_tag="CPF_0076"
FT   CDS_pept        90897..91844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0076"
FT                   /product="putative glucokinase"
FT                   /note="identified by similarity to SP:P54495; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84575"
FT                   /db_xref="GOA:A0A0H2YV95"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV95"
FT                   /protein_id="ABG84575.1"
FT                   /translation="MKNYVVGIDLGGTKISCALADLEGNVKAQHTTPTNAHEGEQAVLD
FT                   RIIGCVETVICEGKVTIDEVEAIGIGSPGPLDARTGIIITTPNLPFKNFNLVSPLKAKF
FT                   GIPVYLDNDANVAAIGEFMLGAGKGTENMIYITVSTGVGGGAILNGKIYRGSTSNALEI
FT                   GHSTVAPGTVRCNCGNMGCLEAVSSGTAIGKRGREAVATNVETSLKDYDNVTSYEVFVE
FT                   AAKGDRVAKSIIDEALNYLGIGVANAIATFDPDMVVIGGGVSKAGEVVFETVQEVVNER
FT                   CFKAMAEHCKIVPAGLGTDAGVIGAVALALLECK"
FT   gene            92386..92928
FT                   /locus_tag="CPF_0077"
FT   CDS_pept        92386..92928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0077"
FT                   /product="rubredoxin/rubrerythrin"
FT                   /note="identified by match to protein family HMM PF00301;
FT                   match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84965"
FT                   /db_xref="GOA:A0A0H2YV53"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV53"
FT                   /protein_id="ABG84965.1"
FT                   /translation="MKKFVCTVCGYVYEGEKAPEKCPVCGVGADKFVEQGEDLAFADEH
FT                   RIGVAKGVDERIIEGLQANFVGECTEVGMYLAMSRQADREGFPEVAEAYQRIAFEEAEH
FT                   AAKFAEMLGEVVEADTKANLQARVNAEHGACQGKKDLATLAKQLNLDAIHDTVHEMCKD
FT                   EARHGKAFAGLLNRYFK"
FT   gene            93261..93884
FT                   /locus_tag="CPF_0078"
FT   CDS_pept        93261..93884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0078"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84026"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSL3"
FT                   /protein_id="ABG84026.1"
FT                   /translation="MKIYFTRHGETLWNLEHRFQGWKDSELTENGVKRAELLGKKFNDI
FT                   KIDKIFTSPIKRAKRTAYLIKGDKDIEVEEVEGLKEISFGKWEGMTTEEIKSHDEYVNE
FT                   LDNLFNKPFSYKSFEGENIKDFTERLFKTVDDIVKNNEDKDILIVTHGMCVRYLIGYFK
FT                   NEFEESKIIDYPIFHQASYNEVEWNGENFEVITLNNIDHYEYDK"
FT   gene            complement(94243..95013)
FT                   /locus_tag="CPF_0079"
FT   CDS_pept        complement(94243..95013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0079"
FT                   /product="putative transcriptional regulator IolR"
FT                   /note="identified by similarity to SP:P46337; match to
FT                   protein family HMM PF00455; match to protein family HMM
FT                   PF08220; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82960"
FT                   /db_xref="GOA:A0A0H2YQ15"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ15"
FT                   /protein_id="ABG82960.1"
FT                   /translation="MRSKRIDLVENYIINHKTVSIDKLCEVFDVSKNTIRRDLSVLVEK
FT                   GTIKKVYGGVTVNENQELVSFEERNVKNSNSKLALGKAAAEFIEDGYSIFLDSGTTTVN
FT                   IIDFLKDKKDITIFTNSVTAICKGIHYNNLNIICLSGILNRKTQSFTGLHSTDILKSYN
FT                   INKCFMACTGISLKRGVTNSTKEEFKIKKTAISRSAECFLLADQSKFDHVSLMTFCEIN
FT                   DLNCVITDAKPSDEYIEYFNDNNVDLKICEKVIY"
FT   gene            95495..96649
FT                   /locus_tag="CPF_0080"
FT   CDS_pept        95495..96649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0080"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82765"
FT                   /db_xref="GOA:A0A0H2YPP0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPP0"
FT                   /protein_id="ABG82765.1"
FT                   /translation="MANQFIMPKRIISGENALNESKAYLKSFGKRVLIVTDKVMTDLGN
FT                   VKVLTEVLDSENIEHVLYNEINSEPTDTMIEKGIKLYKENQCDFLIGLGGGSPIDSTKA
FT                   IGAMITNEGKISDYMGREIEKELPPFAVIPTTAGTGSEATQFTIITDTKNDVKMLLKGA
FT                   NLLPNLAIVDPRFTMTAPAKITAATGLDALTHAIEAYTSRKAQPLSDSFAVSAVKRIFK
FT                   YLPIAFDTPKDLKAREEMSIAALEAGIAFNNSSVTIVHGMSRPIGALFHVPHGLSNAML
FT                   LEACFTYVVDGAYDRFAQLAKEINIANDNMSNEEAAKAFIDEVVKLMVKLEIPTLEEFG
FT                   VDKTKFFDNIEKMAADAMESGSPSNTRKIIEVDDVIKIYNNLWR"
FT   gene            96656..97501
FT                   /locus_tag="CPF_0081"
FT   CDS_pept        96656..97501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0081"
FT                   /product="putative fructose-bisphosphate aldolase, class
FT                   II"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84620"
FT                   /db_xref="GOA:A0A0H2YU97"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU97"
FT                   /protein_id="ABG84620.1"
FT                   /translation="MALVKMTELLDAAREENYAVGSFSIANMEMVKGALKAAEEMHSPM
FT                   ILQIAEVRLTNSPLELIGPLMVSAAKNAKVPVAVHFDHGLTLENIEKALKIGFTSVMID
FT                   GSHLSFDENVKITKRVKELADKYGAAIEAEIGQVGGSEDGSEDIKMKVTNVEDAKRFVQ
FT                   ETKVDALAVAIGNAHGVYKGTPKLRFDVLENLRENIETPLVLHGGSGITPEDFKECKNK
FT                   GIRKINIATATFNSVEESVRKLYVDNEKKDYFTLQATEVQGAYENVKKHMDIFESVNKA
FT                   "
FT   gene            97515..98531
FT                   /locus_tag="CPF_0082"
FT   CDS_pept        97515..98531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0082"
FT                   /product="myo-inositol catabolism protein IolC"
FT                   /note="identified by similarity to SP:P42414; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83660"
FT                   /db_xref="GOA:Q0TUZ4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022841"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUZ4"
FT                   /protein_id="ABG83660.1"
FT                   /translation="MRYIEFDEKRKFDIVPVGRVAIDFNPTDIHKPLSESRNFNKYLGG
FT                   SPANIAVGLARLGKKVGFIGKVSDDRFGEFVVNYFKKEGIDVSEISKAKNGESLGLTFT
FT                   EILSPTESSILMYRNGIADLQLDVDDIDEDYIKNTKAIVISGTALAMSPSREAALKALR
FT                   LAKKNGTVVIFDVDYREYNWKNKDEIAIYYSIVGKESDIIMGSREEFDLMEGLIAKDST
FT                   DEETAKRWLDYGNKIVVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAYASAFI
FT                   YGILEGWDMMDALEFGSASAAMLVASHSCSEDMPTVEAIKEFIKKEKEEYGEMVARS"
FT   gene            98545..99312
FT                   /locus_tag="CPF_0083"
FT   CDS_pept        98545..99312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0083"
FT                   /product="putative myo-inositol catabolism protein IolB"
FT                   /note="identified by similarity to SP:P42413; match to
FT                   protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82276"
FT                   /db_xref="GOA:A0A0H2YNH4"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNH4"
FT                   /protein_id="ABG82276.1"
FT                   /translation="MVENIGFSEDGKKIVTEINGKHSSMLMDIEVIKMKKGNKIVILEP
FT                   KKEVAVLLMEGKIKYLWENKEVEASRKNVFEEEGFCLHVCKNVEVKVEALEEAEILIQK
FT                   AENDKEFLAKLYRPEDVIIQESSLDKWDGTAARKIKTFFDYSNAPYSNMVNGEIVSYPG
FT                   RWSSYIPHEHPQPEVYYYKFDKPQGFGACFIGDEAYKVKDGGYAIIEGGYTHPQATAPG
FT                   YRMYYCWMIRHLDGNPWTDRIDDPAHVWLLDEK"
FT   gene            99329..101248
FT                   /gene="iolD"
FT                   /locus_tag="CPF_0084"
FT   CDS_pept        99329..101248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="CPF_0084"
FT                   /product="myo-inositol catabolism protein IolD"
FT                   /note="identified by similarity to SP:P42415; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02775; match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84674"
FT                   /db_xref="GOA:Q0TUZ2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR023757"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUZ2"
FT                   /protein_id="ABG84674.1"
FT                   /translation="MRMTTGQALVKFLDNQYVSFDGKEEKFVDGIFTIFGHGIVVGLGE
FT                   ALYENPGELKVYQGRNEQGMAHVSTAFAKQNNRRKIIACSSSVGPGAANMVTAAATATV
FT                   NNIPLLLLPGDSFATRQPDPVLQQIEQSYNLGITTNDAFKPVCKYWDRINRPEQLMSAM
FT                   INAMRVLTDPAETGAVCIALPQDVQGEAYDFPEYFFKKRVHRITRPLAVQEEFEEALDI
FT                   IMNKKKPIIICGGGVRYSEAGEALVDFAEEFNIPICETQAGKSAIKSSHPLNLGGIGVT
FT                   GNLAANMIAKDADLVIGVGTRFSDFTTSSKSLFKNPEVDFITVNVSKFHGEKMDAHKII
FT                   GDAKVCIEELQAMLEANNYESSYEDEIVNAKKAWKEEMKRLTNIKYDENFEALIKPKRE
FT                   GCIEEFSVLTGGLITQTAALGVIRETIDDDAIVVGAAGSLPGDLQRMWETDVRDSYHME
FT                   YGYSCMGYEIAATLGAKLAEPEREVYSMVGDGSYLMLHSEMVTAMQEQKKINILLFDNC
FT                   GFGCINNLQMSNGIGSLATEFRYRDENGKLEGGLIPIDFAKVASGYGLKTYSVKTLAQL
FT                   KEALEDAKKQKVSTLIDIKVLPKTMTDGYDAWWHVGIAGESKIDGVNKAFENKEKNLKA
FT                   ARRY"
FT   gene            101318..102325
FT                   /locus_tag="CPF_0085"
FT   CDS_pept        101318..102325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0085"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="identified by similarity to GB:AAC70005.1; match to
FT                   protein family HMM PF01408; match to protein family HMM
FT                   PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83367"
FT                   /db_xref="GOA:A0A0H2YR21"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR21"
FT                   /protein_id="ABG83367.1"
FT                   /translation="MVMINIGVIGAGRIGRIHAQSIQEKVQGAQVKTIADVFEESAKKA
FT                   AEEFKIPNYTGDYMEILNDPEIDAVIICSSTDTHSKISIEAAERGKHIFCEKPIDYDVA
FT                   KIEKTLEAVKKAGVKYQVGFNRRFDHNFAKLKELIEEGKIGNPHIIKITSRDPQAPPIE
FT                   YVKVSGGMFLDMTIHDFDMAAFLSGSRISEVYVQGACMVNPEIGEAGDVDTAIISLKFE
FT                   NGCIGVIDNSREAAYGYDQRVEVFGGKGYVMADNDSDTTVTIASVDGIVGEKPKYFFLE
FT                   RYMDAYVNEMQQFINCLVNDTEVPVGANEGLYSVLVGLAATKSLKEGRPVKIEY"
FT   gene            102444..103337
FT                   /gene="iolE"
FT                   /locus_tag="CPF_0086"
FT   CDS_pept        102444..103337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="CPF_0086"
FT                   /product="myo-inositol catabolism protein IolE"
FT                   /note="identified by similarity to SP:P42416; match to
FT                   protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83745"
FT                   /db_xref="GOA:Q0TUZ0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR023952"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUZ0"
FT                   /protein_id="ABG83745.1"
FT                   /translation="MFNSNVKLGIAPIAWTNDDMPDLGKENTFEQCISEMALAGFKGSE
FT                   VGNKYPRDVKVLKKALELRDMEIASAWFSAFLTTKPYEETEKAFIEHRDFLNAMGAKVI
FT                   VVSEQGHSIQGQMETPIFDGKYVLNEEEWKTLAEGLNKLGALAKEKGMKLVYHHHMGTV
FT                   VQTTEEIDKLMDLTDENLVYLLFDSGHLVYSGEDALEVLKKYVNRVKHVHLKDIRKEKV
FT                   EEVKRDKLSFLQGVRKGAFTVPGDGDIDFEPIFKVLDDNNYEGYLLVEAEQDPAIANPL
FT                   EYAIKARKYIKEKTNL"
FT   gene            103419..105008
FT                   /locus_tag="CPF_0087"
FT   CDS_pept        103419..105008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0087"
FT                   /product="sodium/solute symporter family protein"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83799"
FT                   /db_xref="GOA:A0A0H2YTE9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTE9"
FT                   /protein_id="ABG83799.1"
FT                   /translation="MFIFLSFAIFLVAVFAIAWYKAKGTDNTETATGYFLAGRGLSGPV
FT                   IAATMILTNLSTEQIIGLNGQSYATNMGPMAWEVTSCVALITLALIFLPRYLKGGITTI
FT                   PDYLEERFDSTTKRIVSILFLVSYVVTYIPTVLYSGGLVLNQIFGISDLLGISTFQAVA
FT                   LTGFLLGVVGAIYTVLGGMKLAAFSDTVNGIGLLIGGLLVPILGILLLGNGDFVGGFEI
FT                   IIATPEKLNAINPANAQSPLIPWPVLFTGLLFNNLFYWCTNQSIVQKALGASSLKEAQK
FT                   GAILAGLIKVLTPAILVFPGIIAFAKYGDALPNADMAYPTLLLDVLPKPLLGIFAAILF
FT                   GAAMSSLNGAMNSSSTLFTLDLYKPIINPEASDKQLVKVGQKFIIVVSVISVIVAPFIL
FT                   YAPSGLYNFLQECNGYFNVPILACVIVGFFTKRVPSLAAKAVFVVHIVLYTLSKFFLSD
FT                   IHFLYVLGVLLPIGVIVMLIIGKIKPRETDFVQADKALIDMTPWKYAKPASLAVVLVMA
FT                   FIYLLFSPIGLA"
FT   gene            105096..106145
FT                   /locus_tag="CPF_0088"
FT   CDS_pept        105096..106145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0088"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83504"
FT                   /db_xref="GOA:A0A0H2YRF9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR008354"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRF9"
FT                   /protein_id="ABG83504.1"
FT                   /translation="MKKINFGIVGLGRLGRAHAENLAFKIPNANLLAVCSIDKSQVDEV
FT                   QKAWNIPYGYTDFDEMLKNKELDAIFIASPSGFHCEQIEKALDAGFHVFSEKPLGLYLD
FT                   DAVRAMKAVNSHPNQIFMLGFMRRYDKSYAYAKKKIEEGAIGKPVLVRCYGLDPAKALP
FT                   SFLKFAKDSYSGGLFLDMAIHDIDLARWYLDSEADELWAIGGAYGHKEFDEINDAETGA
FT                   AMVKFKNGTMALLVAGRNCAHGYHIETEIIGTEGTLRIGTTPDKNLVTVFDSRGVNKEC
FT                   AGGFLERFEDAYLAEVKEFVDCVLENRKPAVTVEDGVLSTIVGYACKESFETGELVKVN
FT                   YEGYDKLIK"
FT   gene            106517..107275
FT                   /locus_tag="CPF_0089"
FT   CDS_pept        106517..107275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0089"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="identified by match to protein family HMM PF01226"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84743"
FT                   /db_xref="GOA:A0A0H2YUG5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUG5"
FT                   /protein_id="ABG84743.1"
FT                   /translation="MQKKDINLISDMAVNKFKFADRAPIKYFFRAIVAGFFLVVAIILS
FT                   YTTGAVLNNSYPEIARIMVAATFSLALGLIAFIGGELFTGNNLVMSIGIYNNECTLTMA
FT                   LKVWFMSYLGNFIGSILLGFLFVKSGASMDLIKDYAKGIVDIKLNLPALELFLRGMLCN
FT                   FMVCIAFLSTIKMKSETGKLIIMFWCIFAFVIAGFEHSIANMGIFSITYFASGDVSLPL
FT                   VFRNLFWVTLGNMVGGGVLLALPLKFMSME"
FT   gene            107507..108283
FT                   /locus_tag="CPF_0090"
FT   CDS_pept        107507..108283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0090"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="identified by similarity to SP:P52046; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84755"
FT                   /db_xref="GOA:A0A0H2YUI7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI7"
FT                   /protein_id="ABG84755.1"
FT                   /translation="MENIIFNESNGIAEVIINRPKALNALNNQTITELGEVINEISKRK
FT                   DIKTVIITGAGEKAFVAGADIVEMKDLNSMEARDFSRLAQKVFSDIENMPQIVIAAVNG
FT                   YALGGGCELSMACDIRLASKKAKFGQPEVNLGILPGFAGTQRLPRLVGKGIAKELIFST
FT                   DMIDAEEAHRIGLANKVYESEELMDKARELANKIMSKSPVGVRLAKAAINNGLNMDTES
FT                   AYNYEADLFALCFSTEDQLEGMNAFVDKRKADFKDK"
FT   gene            108386..109936
FT                   /locus_tag="CPF_0091"
FT   CDS_pept        108386..109936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0091"
FT                   /product="propionate CoA-transferase"
FT                   /EC_number="2.8.3.1"
FT                   /note="identified by similarity to GB:CAB77207.1; match to
FT                   protein family HMM PF01144"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83159"
FT                   /db_xref="GOA:A0A0H2YQC0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQC0"
FT                   /protein_id="ABG83159.1"
FT                   /translation="MVRVSFLKPCEVAEFVKDGDTIVTEGFVASCCPESLTKALEKRFL
FT                   ETGHPRNLTLMYSAAQGNRDGSGADHFAHKGMTKRVIAGHWNMAPKLGKMAVENEIEAY
FT                   NLPQGTLAQLFRDIAGKRVGTITHVGLNTFVDPRISGGKLNEVTKEDIVKLIEIEGEEK
FT                   LLYKSFPIDVCFLRGSSADECGNVTLDREVATLDVTSIAQACKNNGGKVFVQVERVVSG
FT                   GCLDPRLVKIPGIYVDGIVLAEPCDHEQCLGMKFNPAYTGEVRIPLSSIEKAPLNARKI
FT                   IARRAAMELKKDTIVNLGIGIPEVISLVANEEGIGDYMTLTVESGPVGGVPQGGAAFGA
FT                   CINPDAILDQPYQFDFYDGGGVDLAFLGLAQADRNGNINVSKFGPRIAGCGGFINITQN
FT                   AKKVIFCGTFTASGLKVETGDGKLHIIQEGKSNKFLEDVEQITFSGEYANKTNQPVMYI
FT                   TERAVFELRNDGLHLTEIAPGVNLEEDILAHMDFVPNIDEPLKLMDERIFYDKLMGLK"
FT   gene            110040..111176
FT                   /locus_tag="CPF_0092"
FT   CDS_pept        110040..111176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0092"
FT                   /product="butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="identified by similarity to SP:P52042; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82390"
FT                   /db_xref="GOA:A0A0H2YNU8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNU8"
FT                   /protein_id="ABG82390.1"
FT                   /translation="MDFSLTQKQLDVQRAVKEFAERELKPFAIENDENSTFPIEAYKKL
FT                   GELGVIGLPYSTEYGGTGGDYLSYVLAIEEISKVDASMGIAVSVTTSLCAGGISNASEE
FT                   LKKKYLPDILSGKKLGSFGLTEPNAGSDAGGVITVAEKKGDNYILNGAKCFITNAPLSG
FT                   TFIVFALTDRTKGPKGLSAFIVEKDFPGISIGKIEDKCGIKSAQVSEVLFNDCVVPASN
FT                   LVGKEDDGFKIAMKTLDGGRIGVAAQGLGIAEGAFEIAKEYMKERKQFGKPLFKQQYLA
FT                   FKMAELAVEIEQAKYMLYKAAMDKQEGKPYSVSAAKAKLVCTDAAMHVTTEAIQMLGGN
FT                   GYMREYQLERMMRDAKITQIYEGTNEIQKLIISGSLFR"
FT   gene            complement(111587..111937)
FT                   /locus_tag="CPF_0093"
FT   CDS_pept        complement(111587..111937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D75566; match to
FT                   protein family HMM PF08754"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83630"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSF4"
FT                   /protein_id="ABG83630.1"
FT                   /translation="MKIIFHIDEPNKWPMVLENLKNVLNNAKETNRKYELEVLANSMAV
FT                   FQLRELIARNTHLIDKIIEPAEQGVVFAVCNNSLNKFNISKDELFSFCKVVPAGIIELA
FT                   EKQSEGYLYIKP"
FT   gene            112515..113645
FT                   /gene="gldA"
FT                   /locus_tag="CPF_0094"
FT   CDS_pept        112515..113645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="CPF_0094"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by similarity to SP:P32665; match to
FT                   protein family HMM PF00465; match to protein family HMM
FT                   PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83028"
FT                   /db_xref="GOA:A0A0H2YQ72"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ72"
FT                   /protein_id="ABG83028.1"
FT                   /translation="MRKAFICPTKYVQGENELLNLGYFVETYGKSALLIAHPEDIKRVK
FT                   DKLDATAKKFNIEFVEGGFKGECSRQEVKRLQDLAKEMKCDCTVGLGGGKALDTAKCVA
FT                   EGEKLIVVPTIAATDAPTSHSAVLYTEDGSFDDYAYFKASPSVVLVDTEVIAKAPTRFL
FT                   VAGMGDALSTYFEARATSSSFTKVNAGLPCGVREEKCRPAIGTNASLALAKLCYETLLE
FT                   DGKKAKDACDCNCVTKSLENIVETNILLSGLGFESGGLAAAHAIHDGLTILEGTHGYFH
FT                   GEKVAFGTIAQLVLENAPKEELYEVLDFCLEIGLPVCLEDIGVTEVSDEELFEVAEKAC
FT                   IPEESIYSMPFGIEVSEVVSAIKLADKIGKDYKNRK"
FT   gene            113671..115419
FT                   /locus_tag="CPF_0095"
FT   CDS_pept        113671..115419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0095"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /note="identified by match to protein family HMM PF02733;
FT                   match to protein family HMM PF02734; match to protein
FT                   family HMM TIGR02363; match to protein family HMM
FT                   TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83277"
FT                   /db_xref="GOA:A0A0H2YQT7"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQT7"
FT                   /protein_id="ABG83277.1"
FT                   /translation="MKKIMNSAETLVREMCNGMVMAHPELEFLNKYKVVKKKDINEDKV
FT                   TLISGGGSGHEPAHAGFIGKGMLDVAVCGDVFASPSQIQIYQAIKASKSNKGTLLIIKN
FT                   YSGDMMNFKNAAHLATEDGIKVDYIKVDDDIAVEDSLYTVGRRGVAGTVLVHKIAGAAA
FT                   ERGNSLEEVKRIAEKAASSVKSIGFAFTSCTVPAKGTPTFELGEDEMEYGVGIHGEPGI
FT                   RREKIATADELAERMVNQLINELDYKDEELVVLVNGFGATPLQELYLLNNSVFRELHKR
FT                   GIKVCKNFVGNYMTSIDMAGASLSIMKLDDELKELMKDECDTPAFKVSNHMDMNEYEEV
FT                   VIEEKEIPVSYKVETCESFKEIKDEKISLENMIYILDKMSEVIIDNEVPFCELDSHAGD
FT                   GDFGMSVAKGFRILKREWKDILEIENLNISEFLNACSLVIMEHCGGASGPIWGSAFRAA
FT                   SKNVINKDELTVKDFAAMMQEAVLGIQKTGERSFGRGAVVGDKTLIDALVPCADSWTNS
FT                   AEEGLSFKEAFKNGAEAAVLGAKKTEEIVARMGRAGTVGERSIGYPDAGAYGLGVIFTE
FT                   ISNDIK"
FT   gene            115780..117213
FT                   /locus_tag="CPF_0096"
FT   CDS_pept        115780..117213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0096"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82626"
FT                   /db_xref="GOA:A0A0H2YNY6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNY6"
FT                   /protein_id="ABG82626.1"
FT                   /translation="MEHVIKKGENAQEVKYNKWAILFCVVTMTFMSCIDGSIVNVALPK
FT                   ISYDLNKPILDTQWIVTTYLMVISALVLLCGRIGDIKGKCKVFKVGVLIFTIGSFFSGL
FT                   SKTLPLLIVSRAIQGVGGSCAMATGMGIITAFFNEKERGKAMGLSASAVAMGVMVGPAL
FT                   GGILVSIRWDLIFWINVPIGIIAFLLSMVYLPKMETNSKEKIDIRGTIVFAIFIVSSML
FT                   SITKGEVLGYTDKYIMLGFIVSIVSFTVFIYLQKTVESPVLDLNLFKTKLFSLSIVCSA
FT                   LSFLAISSMNIIIPLYLEQALQMSSLHAGLFLMIYPLCLSIVAPLSSSLSDRFNGRLIS
FT                   LIGISLLTVALFFMGRININSTLIYLGTCCAIMGVGNGIFKSTNNALVMEKVPKHRLGI
FT                   AGSVNSLVSNLAMAYGFTFATTILYGRMSYRLGYKVTNYIPGHEEAFLYGLDCVFFSAT
FT                   IMCLIASVVAFIRYRRKDI"
FT   gene            117490..117762
FT                   /locus_tag="CPF_0097"
FT   CDS_pept        117490..117762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVG5"
FT                   /protein_id="ABG84904.1"
FT                   /translation="MSKKVEELKNEVMADVEKSCVEDIKAHMIDKIEEDVKVLDEDSKA
FT                   YKEDEKEAAKLGKAINKELDREIKEEAENAKEFAKELKADIESRE"
FT   gene            complement(118161..119114)
FT                   /gene="ldh"
FT                   /locus_tag="CPF_0098"
FT   CDS_pept        complement(118161..119114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="CPF_0098"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84272"
FT                   /db_xref="GOA:Q0TUX8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUX8"
FT                   /protein_id="ABG84272.1"
FT                   /translation="MIREKTNKISIIGAGFVGSTTAFALMQDGLASEIVIVDINKDKAH
FT                   AEAMDLAQGAAFVKSVDIKSGDYADTKDSDIVIITAGVGPKPGETRLDIINKNLKIFQS
FT                   IVPEVVKYSPNSILLVVSNPVDILTYITYKLSGFPKERVIGSGTVLDTSRLKYMLSEHF
FT                   DIDARNVHTYIIGEHGDSEITAWSLTNIAGANVEEYCKTVCANCDGSFKKELPEKVKNA
FT                   AYEIINSKGYTNYAVALAVTRIVEAILRDENAILTVSSLFEGQYGIDNVYLAMPTIVDR
FT                   SGARQILDVPISNEEKENLIKSAEILKGHIANSELD"
FT   gene            119740..120915
FT                   /locus_tag="CPF_0099"
FT   CDS_pept        119740..120915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0099"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82828"
FT                   /db_xref="GOA:A0A0H2YPT9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPT9"
FT                   /protein_id="ABG82828.1"
FT                   /translation="MIKIKKNINKDAEKKYEYRFYRYLGLVLIILFSCIVTVSNLINPG
FT                   ETKKLISELVRKGYSDFFQYELQNSDKSLQEIYDSYSKNENIEVYKLMALNTIYFGGDR
FT                   NRYLEPYIRPYIDKYNLSQNDRLKLYEDVNKEIKNIENKYIFKLIVKRFSPYILAIAFV
FT                   TLIMGSASFIRKRNNVERIIINILIFLAGIYICYLSSISVKHGIWINLAIMLALAEFII
FT                   ENKTKLLEYIGGSIILIILVLSILGKFEYKSNELDKYDVNKLVLVNNFQGANFANEEHD
FT                   IQRSGRALYSEIKKENMILIDNSNENINNLIENKEKIIFNNKENNKPVFYMCLYNNIPV
FT                   YRLALVKEGQIVKIYEGVLNPYMRSTLMKLERGKGHKKNKVCNIEMLKTIN"
FT   gene            121034..121474
FT                   /locus_tag="CPF_0100"
FT   CDS_pept        121034..121474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNJ7"
FT                   /protein_id="ABG82297.1"
FT                   /translation="MLFYGVISVEYKKEQFNEKVLTNHITKEQWIDILKNSNLIGLRDM
FT                   KILLNLYGSNGQPLKTSLIGEHLEFGDISTRIQKMCKRIEEELGIGLDEKSEIGSWKYK
FT                   FRHWFIMLNGSKIYDEKEEKNYFTWTLKKELKEAIDSLLGKE"
FT   gene            121682..122422
FT                   /locus_tag="CPF_0101"
FT   CDS_pept        121682..122422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0101"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84570"
FT                   /db_xref="GOA:A0A0H2YV90"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV90"
FT                   /protein_id="ABG84570.1"
FT                   /translation="MNRKEIKSIAKSKLKGRWFNIVLLTLIIAIIEFGASEIIGRTEGI
FT                   TSNILNIANNFLLMPAITASGIIYTIKFVKSNEVVALSYAIPSVKTWGRFIMSMIVTMI
FT                   FSIPILLVVFLGNIFLVLSITSLHSAMLNGQISMNPMIGIWGVIFLIVILVLILAAVVG
FT                   ILLFPLPYLMAEDTCGIWEAVKRSFKIMNGHKWELFIMGLSFLGWLILSALTLGIGLLW
FT                   LLPYIQVTLRIYYLSITGRESEIN"
FT   gene            122534..123406
FT                   /locus_tag="CPF_0102"
FT   CDS_pept        122534..123406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0102"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84093"
FT                   /db_xref="GOA:A0A0H2YSU3"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSU3"
FT                   /protein_id="ABG84093.1"
FT                   /translation="MTRKEIKSLSQDKLRGRWTNFLLLVLIVLGVQGLVTYFISNVESI
FT                   GLSSILNLGNSFLLGPFLESLLVVFVIKLVDRDDKVGLKESIPSCKVWRNFIKKFLALI
FT                   LFELPISLIASIIAVVSFISIISNHFYEYLFMASMNYEDILSQYIGIFIIIILIVATYN
FT                   IIVSLFFFPVKYIIVEEPELGIWEAVGKAFKMMKGHKWELFVLILSFIGWAILAVLPIV
FT                   LGSIIIVLMNLSVYILPIFSIGLIWFFVYRDTIYRVYYLSISERALEIGKDELNQDIEV
FT                   EEEDFEFRD"
FT   gene            complement(123542..124864)
FT                   /locus_tag="CPF_0103"
FT   CDS_pept        complement(123542..124864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0103"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82325"
FT                   /db_xref="GOA:A0A0H2YNM5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNM5"
FT                   /protein_id="ABG82325.1"
FT                   /translation="MSNFNETPRGSRIHISLFGKTNSGKSSIINALTGQNISLVSDFKG
FT                   TTTDPVYKAMELLPLGPVVFVDTAGFDDEGEIGKLRVEKTEEVVGKTDVALITLSLSEI
FT                   LEAIKSNIEFKDMLSKEILWLNKLKKAKKPAILVINKCDLVPNNLIESKIDLKDIDKTT
FT                   LSNKDCFVDSNLNNSLKEIGELLGIPCVAISAKNNLNINELKKELVNVSPSSITESPII
FT                   GDKIKAGDKILLVAPQDIQAPKGRLILPQVQVLRDILDYGGIPTMVTLDKLDEGLKIFN
FT                   GKPDLVITDSQVFKQVNAKLDRSVPLTSFSILMARYKGDLDKFYSGAKAIKNLKAGDKV
FT                   LIAEACTHHQLKGDIAREKLPTWLEETCPGIIVHNCSGKDFPKNLNEYSLVIHCGGCMF
FT                   NKAEIMNRIGICDYALVPITNFGTSIAEINNILDRVMEPLK"
FT   gene            complement(125634..125918)
FT                   /locus_tag="CPF_0104"
FT   CDS_pept        complement(125634..125918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPP5"
FT                   /protein_id="ABG82770.1"
FT                   /translation="MAVDQNSLERRTCCNIHKIVLTLEKGFSSMESLKYAVITHLQNEG
FT                   YRCNDTKNNIGDYPLLKINANDFLLTIKDIDENSLNFEDCSEVVLVPHH"
FT   gene            complement(126126..126362)
FT                   /locus_tag="CPF_0105"
FT   CDS_pept        complement(126126..126362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83945"
FT                   /db_xref="GOA:A0A0H2YSG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSG1"
FT                   /protein_id="ABG83945.1"
FT                   /translation="MIILGVGYLIKFFIIDKLIVGDKIFNYAHFTFLILPLPFSLPIFS
FT                   GKHCPEYEELINNTVILSTMLCISFFIIFILLI"
FT   gene            complement(126740..128161)
FT                   /locus_tag="CPF_0106"
FT   CDS_pept        complement(126740..128161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0106"
FT                   /product="putative thiazole biosynthesis protein ThiH"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82637"
FT                   /db_xref="GOA:A0A0H2YPZ6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPZ6"
FT                   /protein_id="ABG82637.1"
FT                   /translation="MLKDNEKYNALDFIKDDEINSLIAKGKELVSDKELVREIIEKSKS
FT                   AEGLTPEETAVLLNLEDKELIEEMFKAARQVKEKLYGKRLVVFAPLYVSNYCVNNCTYC
FT                   GYKHCNDELKRKKLNKEQLIEEVKVLESLGHKRIALEAGEDPVNAPLDYILDCIKSIYS
FT                   IKFDNGSIRRINVNIAATSVEDYKRLKDAEIGTYILFQETYHKPTYERLHVSGPKHNYN
FT                   YHTTAMHRAREAGIDDIGMGVLYGLYDYKYETLAMLMHAMDLEETTGVGPHTLSVPRIR
FT                   PAENVSLENYPYLVDDEDFKKIVAILRLAVPYAGLILSTREEPGLRDEIIALGVSQVST
FT                   GSCTGVGGYSESYIDPEEKPQFEVGDHRSPVEMIESLMEAGYIPSYCTACYREGRTGER
FT                   FMDIVKSGELYKICEANALITLKEFIDDYGTDRTREIGDKLIKKSIDEIDNESFRKSVE
FT                   EKINKISNGTRDLRF"
FT   gene            complement(128267..128518)
FT                   /locus_tag="CPF_0107"
FT   CDS_pept        complement(128267..128518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAC39225.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83095"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR57"
FT                   /protein_id="ABG83095.1"
FT                   /translation="MSTRIAVVGIVIESLDNIKEVNSILSEYDKLIVGRMGLPYKEKNI
FT                   RVISIVVDGTTDEISAITGKIGKLKGVSVKAAISKTSF"
FT   gene            128962..130527
FT                   /locus_tag="CPF_0108"
FT   CDS_pept        128962..130527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0108"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D97239; match to
FT                   protein family HMM PF06207"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84401"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTJ5"
FT                   /protein_id="ABG84401.1"
FT                   /translation="MKKNKLITAMILAGAISIGSFTTVFADTKEVVTLGANLNSSQKQE
FT                   MFKEFGVKPNDVKVITMNVNEIREQLGLPKIVGEFKGNAYSSAFVKLEEKGYGIKVKTN
FT                   NLTEVTKTMLSNALLTSGVTDADVIATAPFPVTGTSALAGVLQAFEKATGENIPVENKE
FT                   VARQELSITNNLAKAKNSEGQDIGRDGASAIVNQAKEEVIKDKPKNDKEVGEIVNNITN
FT                   NYNIKLTPTQEQELVALLANINSLGLDYSKLKGELDSLSNNIQEALKENGQELKESGTL
FT                   DRILNKILGVCTDIKNWFVAHFGDGEVTINGVTYDKDGNMINKDQLNNIGTSISDEDND
FT                   TSNNESKNNIEDKSQKSDSKEKETDKANSNNQEDSNSQGEQESNGNGSLNNDTKSNKES
FT                   KNKDAQGAKESKNSKPNKNSVSSSKNNSNKNNSGSSNNSKDKSKETIKLEDGNVIPKYN
FT                   SKGEEYNPVTGGYGHMQETEDAGKDSDQTIDYIIVDGKKVPLHDEQGREYNPETGRYGD
FT                   PDDN"
FT   gene            130674..130901
FT                   /locus_tag="CPF_0109"
FT   CDS_pept        130674..130901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC14097.1; match to
FT                   protein family HMM PF07872"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83758"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTB3"
FT                   /protein_id="ABG83758.1"
FT                   /translation="MAKAILTKKSLVLKYQKGVDDSGSPKFSTQKFSKIKVDAEDEKLY
FT                   EVGKALADLLSSRVNSVLKEDDFKFVDDTQ"
FT   gene            131194..131418
FT                   /locus_tag="CPF_0110"
FT   CDS_pept        131194..131418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK76917.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82201"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNA6"
FT                   /protein_id="ABG82201.1"
FT                   /translation="MEKELYLVLSFKNAGGSITKITLKNIKEDVTEEEVQNLMEKIVTA
FT                   NIFVSKGGDLVSKVKGEIVEKTTESFEMS"
FT   gene            complement(131476..132369)
FT                   /locus_tag="CPF_0111"
FT   CDS_pept        complement(131476..132369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0111"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="identified by similarity to SP:P36548; match to
FT                   protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83408"
FT                   /db_xref="GOA:A0A0H2YSG0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSG0"
FT                   /protein_id="ABG83408.1"
FT                   /translation="MLLGCGLNSTKPNINKDSNSINNSNEENNDTEKNNSNNENNNTEK
FT                   NDSKEGNIDQEKEKNKIDSNTDKEADKKNEVEPYCENEPNKANKDIAIVIDPGHSSTIS
FT                   NETEPECPGSQKRKLKDTLGATGVQSKIPEYTITHGVAEELKKLLISEGYNVIMTKDSP
FT                   DKQLSNIERTTIGNDNNANLIIRIHCDGVDSPKACGASILVPATKGNVTKDISDISYSY
FT                   GEKILTAYTKYTGLKNRGVVVRDDLTGFNWSKVPIVLIELGFISNPNEDSYLSDPDNYI
FT                   KIATGISNGINYCFAK"
FT   gene            complement(132430..133599)
FT                   /locus_tag="CPF_0112"
FT   CDS_pept        complement(132430..133599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84278"
FT                   /db_xref="GOA:A0A0H2YTD6"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTD6"
FT                   /protein_id="ABG84278.1"
FT                   /translation="MKFCTKCGNKLSDSMKFCNKCGAKVKSVDKDTKNNSDTEDTKDKK
FT                   DIPNSKNNIDKTIILDAPKIKKEINTNINENIKNNFKPLHDSNFNNKEEYLDASFDDDL
FT                   DENFNDESYHNEDIDNFKHSNTKKKILISIFTLVAFVIIGTSIYFLRSPLLYKYYYNSA
FT                   LKSSSVTEKLSYYNSALKYSKNDDLLNSIYTTLKSDSDFVDNSSILTNLNTSEKDNLMS
FT                   KLYVNKATVDFKNKNYTDCDSDLDLATKYGYNKENFSQYDDLQKKLNESKNSSSNDKVD
FT                   NIYSFTNENPSKFSGNIYDYPYDFIMPYSNSSYLSASDLSKYNKSTLALMRNEIYARHG
FT                   YVFNTNPFKAYFNSKSWYHPDSSFKGDDSELNDYEVKNVQTIKSVENSK"
FT   gene            complement(133611..134861)
FT                   /locus_tag="CPF_0113"
FT   CDS_pept        complement(133611..134861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97297"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82972"
FT                   /db_xref="GOA:A0A0H2YRD4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRD4"
FT                   /protein_id="ABG82972.1"
FT                   /translation="MNFCNKCGSKLINGICPNCSKIKKNKKKSKIIIISLVFIVVIFSG
FT                   VFFYLKSTVKSEKEIALSFSNSISSSNPEELSKILYCNDSSLPINKSNSTILIDYFNQN
FT                   PSKFSSINDDFKKGNYKDTDSPLSIEEVRKDFFLIPVYKVVVKPSFIKVKTDLKDAKVQ
FT                   IGDETFGDLTKKDELGPLMPGNYTIKSEISNSYLNKSENIEVNTFKSSNQEISIFDNFI
FT                   KVNITSDIPDAELYVNNKDTGVKIKDAKTFGPIDPNSIIYGVSTDGDKKIISNKYDVNS
FT                   SSNININFAEAKASEANFKKDLYVLLRNYSSDFAYAVNTNSFNYIENYLEFDSPIYKKQ
FT                   KKVVPEIHSKDIRENFESTEILNYTFNNDTNTGEVTCNEIYSIGKGINVPKRQEFKNTY
FT                   TFKKLANGSLVLTDIKD"
FT   gene            134977..135777
FT                   /locus_tag="CPF_0114"
FT   CDS_pept        134977..135777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0114"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to PIR:C97028"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83590"
FT                   /db_xref="GOA:A0A0H2YSC3"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSC3"
FT                   /protein_id="ABG83590.1"
FT                   /translation="MFCSKCGKEIPNESVFCPECGNKCKGSSKSIPIDVNEHKGYIIKS
FT                   LCHPITSVKEHVFGVSSKIQLIYIAIITLIIPLVKTLLFKAFSFNLVKSVVGIILEFSN
FT                   INTWDFNNMIKAKSQFDMIMENVFPTGNIYFLNLGSYIINYALILGIIYIIFKFLVKED
FT                   INKDSLVNIMFVVSIINVFILIISSIALVLGGAIWMIVSIFSSILSVVLLYALFNTLIK
FT                   SKNKFIYIYSLTCMVVYSINAWFVFNNVSSIIYQIYYNLERYFI"
FT   gene            135917..136597
FT                   /locus_tag="CPF_0115"
FT   CDS_pept        135917..136597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0115"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84051"
FT                   /db_xref="GOA:A0A0H2YSR0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSR0"
FT                   /protein_id="ABG84051.1"
FT                   /translation="MESKKIFIIEDEEKIREELTKFLEKYGYIVESSEDFENIVDTSLR
FT                   CNPNMILLDINLPYYDGYYICREIRKKSQVPIIVVTSRQSEMDELMSMNLGADDFVTKP
FT                   YNTQILLARIASIMKRTYSGIEGETEIFNCRELKYNMSTSEVSFKGEVEELTKNESKIL
FT                   NILIRNKGKIVSRDNIIKSLWQSNEFIDDNTLTVNVNRLRRKIEGIGAEGYLQTKRGQG
FT                   YILS"
FT   gene            136594..137607
FT                   /locus_tag="CPF_0116"
FT   CDS_pept        136594..137607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0116"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84699"
FT                   /db_xref="GOA:A0A0H2YUG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUG0"
FT                   /protein_id="ABG84699.1"
FT                   /translation="MNLRDFIKERIVFIIINSLILLFTALLLMVLKVDSFAILFIVIIN
FT                   EAGILIYHIFDYLRKKQYYNEIKENMESLDKKYLISEVIEEGTFTESKLIYDVICKGNK
FT                   AMNDEIGEFKRGINDYREYIELWVHEIKTPIATCKLLIENNESPLTESIGEEVCKLENY
FT                   IDQALFYTRSNTLEKDYIIKEMSLSSCVNKVLNNNADSLIKKRVKISLGDLEKQVYSDS
FT                   KWIEFILGQIISNSIKYMNKEHKELKIYCNENSKYVILNIEDNGAGISEKDISRVFDKG
FT                   FTGENGRKFGKSTGIGLYLCKKLCKKLGLDIKLISEEGKFTRVSIIFPINRMMIFE"
FT   gene            137659..137856
FT                   /locus_tag="CPF_0117"
FT   CDS_pept        137659..137856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82791"
FT                   /db_xref="GOA:A0A0H2YQX3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQX3"
FT                   /protein_id="ABG82791.1"
FT                   /translation="MGKKFLVVVIVCIFIRCLLNLIEAIMLNIEFLKNINFYYIKTFVN
FT                   AFLVIILIGYYIYLYKNYER"
FT   gene            138387..139157
FT                   /locus_tag="CPF_0118"
FT   CDS_pept        138387..139157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0118"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84549"
FT                   /db_xref="GOA:A0A0H2YTY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTY3"
FT                   /protein_id="ABG84549.1"
FT                   /translation="MGKEVLKVSNIEKYYGKKGNVTKAINDISFTVSEGEFVGIMGASG
FT                   SGKTTLLNCISTIDKVTSGHIYLEGEDVTSFSSKKLAKFRREKIGFIFQDFNLLDTLTA
FT                   YENIALALTIQRVNNKEIDKRVRLVAEALNISNELNKYPYEMSGGQKQRVASARAIVTN
FT                   PSLVLADEPTGALDSKAATMLLESLEDLNKNLNATIMMVTHDAFTASYANRILFIKDGK
FT                   IFNELIKGTDSRKEFFNRIIEVITLLGGDSNNVF"
FT   gene            139147..141174
FT                   /locus_tag="CPF_0119"
FT   CDS_pept        139147..141174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0119"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84002"
FT                   /db_xref="GOA:A0A0H2YSM6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSM6"
FT                   /protein_id="ABG84002.1"
FT                   /translation="MYFKLAFKNIKKSYKNYVIYFLTLIFGICIFYTFNSIESQSVMME
FT                   LNEQKQSAFMMAEQLMGYFSVFIAFVLGFLIVYANNYLIKRRKKEFGIYMTLGMENGSL
FT                   SKMIFLETLFIGAISLGIGVVLGIMLSQALSVLTAYMFQVDLTKFQFVFSPLGFKRTVL
FT                   CFSIIYLVVLIFNFISVRKIKLIDLLTASKRNENPTIKNLWVSVILFLVSVGILVTAYY
FT                   KVIHDGIAFASFNALGLPILLGCIGTFIFFYSLTGFFLKVIQGNKKFYLRDLNMFVMKQ
FT                   ISSKINTTFVSLSFICLMLFLAICTFSGGLGINRAINADLKDLTKFDVTFWSNSGENIE
FT                   KLLKEKNIDISNIAKEDSNMVMYDSEVKYSNFLSKEGMTAMKNYFPVANDNDILVIGEK
FT                   GYNNTLKLLGKEPVNLKENQYLAVGNIDEMKKWVNESLENGNMDQMKKLVNKSSENGKK
FT                   INISGKTLEPANKKYENINLYNFTMKGDILIFVVKDSLLEGLKPVSSRFNMMLKDNSNT
FT                   KEELESIRDQLVESQVYSITKKEIYDNAAGLGATMAYLGIYLGLIFIITSAVVLAIQQL
FT                   TESTDNVERYRLLKEIGVDQKMINKAIFTQVGVYFMLPLSLAIVHSIVGLKISSTIVGV
FT                   FGNASIMPNIIITAIIFVIIYGGYFLATYLGAKKNINERS"
FT   gene            complement(141583..142152)
FT                   /locus_tag="CPF_0120"
FT   CDS_pept        complement(141583..142152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0120"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82830"
FT                   /db_xref="GOA:A0A0H2YPG5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPG5"
FT                   /protein_id="ABG82830.1"
FT                   /translation="MVKQKEKNLESNRPLILAVMFLINFFIFILFIHNFNIFIYAYIFI
FT                   FNIFSLINLIFMKKLYSFIDLYTALSISSFSLFLFLSGLYKLNEILSMNKFINLSILFI
FT                   IIYILIIILSINYIKNFYNSKSYKNKILRNYPNYGLIVVGSLLGLFLSKLNLNQDLIIA
FT                   LGMVLLSCGFAVCYSHFYKFFYNSSH"
FT   gene            142244..142456
FT                   /locus_tag="CPF_0121"
FT   CDS_pept        142244..142456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F69799"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83231"
FT                   /db_xref="GOA:A0A0H2YQQ0"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQQ0"
FT                   /protein_id="ABG83231.1"
FT                   /translation="MEQLNRKEIIELVNIIRNPKEEWSEAMIDELIFKLKRNVIYPNPS
FT                   DLIFYTELSAEEITDKILDYKPILL"
FT   gene            142898..147187
FT                   /locus_tag="CPF_0122"
FT   CDS_pept        142898..147187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0122"
FT                   /product="Cna protein B-type domain protein"
FT                   /note="identified by match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82513"
FT                   /db_xref="GOA:A0A0H2YNN8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNN8"
FT                   /protein_id="ABG82513.1"
FT                   /translation="MNIIKKNFRYQVFALFLILPFITNMFSSLFVVYAKDVNFFTDDLY
FT                   FSSDNKIISSQNSSPIKVKVNSLLNFELSSDNLEDSTVEVILPKGISLNEKETIKFSNN
FT                   SVVKETTKDSLEKLIFKFDQQKRKINFVLNINQTGSFEFFAQTHRKNGKYYKSYSVKIN
FT                   SEDLNNNFSNEKKADINVETKENTSFYNSSNNIIANEVKENDLSKSVEKKGINVDLTYE
FT                   PMNSEIYSGETGVYQLNFKVTGSTINIGKATLEISLPNTNGGETALGSSLDELEIEGVK
FT                   PRYDKDLNKLVYEFTSLKSGQSYRTVVKIITTNGIVGNDSKMVSKATLIKNDSPTISSG
FT                   DVVINVKSETPVSITKSYIGVKDKSPDYNPKPGDIIAWKVNASVKYKKTGLAFIKPGTN
FT                   ITISDAIQPELTYNSTTSSVNPESNNNILTWNFKAPDIESQKKLADLENDIWTTSFIVY
FT                   TKVKDTVKDYLIVSNKVDFSLTNISNLPVQNSSNVAYATIAKGGVNISPVYGNFYTGVN
FT                   TGPANGFGALANVLSPNPEPVVTDTANLGFQLQYRIVPGRYWNVNKNMPKPSPPNPEND
FT                   SIVTDSKGKFYPLNIFSLLKNGYKNISLYRIIDTNLNLQGIDFYVPKKRAQTDEPMGYF
FT                   SKIPDTTVVMEVNSKDNFISKEVSYDNISFSSNGNGYKHLTREELGLSPNDKVLSYTVK
FT                   YENKDNSVIAGNFQVNVNDYYGIKQGYVGKVTNTSYFSATLSDGTLFYRKPNPDLDDKS
FT                   TVGPRSAIVVAQEKYNPVARLEAYLQKASGNVVTLGGNRLQVNFFNDYSSQADMSEPLM
FT                   VSVLLPKGVFVNTKNPDEKMSYFDRKGNEVKDGGRYVVIDNYNGTGQQLIRATWDKKLL
FT                   HPNEYLNFAVNVNITVDTPQQSKVIAYGTSGNQVLEAPVTSDHYSIKENDSDDINGDND
FT                   TMQIRIKTEQDYQVAGNKNLIITKEVKGNLDKDYSKFGHVNIGKQFSYRLTLNNTTGEN
FT                   IQKLGFIDVLPSVGDLGITDNVSRGSMFTPTLVGEIVVPDSWKGKTTVYYSTAKNPSRS
FT                   DLYKYVDYPANAVRPVNPPNAENPEWKTANQVSDWSEIHSFKIELNQGANWVPGQNLSM
FT                   TFNMQAPVNPDKSLLDKNIPELERAAWNSFAVTTNGLLAVEPQRVGIVIVDSEVTINLN
FT                   KVDASNGNVLPGAHFKLLNENKENISELETNDKGNLTFKNINSGTYYLEETKAPLGYKL
FT                   NNKKYKIIISKDGQVTVDNIDDNLNILSSKINEISLVMKNNELLGSIKIKKVDRDDTKK
FT                   VLEGASFAIATSEEDALNKRFIKVSNNGELVYPNDKRYNDQLKNYEVISDKNGLATFSN
FT                   LKLNESNGNIYYLVETKAPKNYELLDTYLKVTATEEGAESLILVKNKRNLVMPSTGSNL
FT                   ILVYIISGLFITITMLFIFFKKSRRYI"
FT   gene            147208..149112
FT                   /locus_tag="CPF_0123"
FT   CDS_pept        147208..149112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0123"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83827"
FT                   /db_xref="GOA:A0A0H2YS84"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS84"
FT                   /protein_id="ABG83827.1"
FT                   /translation="MKKRKLLIMIGLATSIFTLEALPMGLPVANSTVYAAEQIAPTTQN
FT                   LSVQKVMYEGVKPSITNDGEEKQLPVGAEKFNPEKYGDVKFTLVDITSYFNNKGEKGIQ
FT                   EELNGLTAEQYSDWINTHKEANTTPVTHSVNTEGKVNYDNVLATNKDGTGHVYAILETK
FT                   SAKGLIEQIAQPIVVSLPMTNVVGNGWLNTINLYPKNKVKSLSFKLTKYGEEISDTNKL
FT                   ADATFDIYSGVPGSGTKLNKDVLTTNKDGVITVDNLTKGDYYFVETSAPKNYVIGSNAL
FT                   NDNNNKLKFSIGDDGVDKNSLHIEFINYLKPESNKEVTNGTAPRTNESSFTIGDTVDYE
FT                   NTIRVPKDIAGGKIVNGDNTETTSAYSVFNYKDIAGTGLSYFGQAKDVNITTQDGTKLE
FT                   LNTDYTYEGLQNGFKINFIMNNGKVSAKVASLAGQNLKVSYPMILNDKALIDGPVENSF
FT                   DLSWNNSPNPDSKVNHETGKVPVFTGGAKFVKQDKSSKAALKGAKFVIMNKEGKYFDGW
FT                   EDANNDGVKDAKWSDTQPTSGEGVFVSGDNGQFLIKGLAYGTYKLKEIEAPEGYQLLTN
FT                   TQEFEISKDTYSGGFSTITNTKKSAMPLTGSTQLIVTVLAGAVLIVSSGVYYRKRKMN"
FT   gene            149168..150046
FT                   /locus_tag="CPF_0124"
FT   CDS_pept        149168..150046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0124"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83352"
FT                   /db_xref="GOA:A0A0H2YR24"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR24"
FT                   /protein_id="ABG83352.1"
FT                   /translation="MVSKRKLKNKIFDYIFLFIAVIGIALMLYPFYSDYKLGKSQKMQI
FT                   EKYESKVSQMSDEEKKKILKTYEEQNGNNTEVTSEDPFNKSDSVSSIDLVKVQLPDVIA
FT                   ILEIPKINLKVQVYPTTNEMVLREGIGVLDGTSLPTGGNGNHSVLTGHSGLSLENMFTN
FT                   LHELELGDHFYINILGEVHDYEVDKIQTVLPDDTSHFDKVPDKDYITLVTCTPLGVNSH
FT                   RLLVRGHRVDDSLSNNKNINSSKIPNLDKKDHFRFGSVKTIIVTTIIVLLFLFVFLFIL
FT                   RRKKEKNNIDK"
FT   gene            150467..150793
FT                   /locus_tag="CPF_0125"
FT   CDS_pept        150467..150793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTB7"
FT                   /protein_id="ABG84255.1"
FT                   /translation="MSKYIYDENVFLKIDNFDNIYFEEKDSVLNIRLVKIEDGLVKEFF
FT                   EDDLKFDLSKYNNTKKELNKSLVYELKNEFLDFMDNEKEKIFDVIINLKELKEELCSKQ
FT                   ISLV"
FT   gene            151037..152053
FT                   /locus_tag="CPF_0126"
FT   CDS_pept        151037..152053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0126"
FT                   /product="C4-dicarboxylate transporter family protein"
FT                   /note="identified by match to protein family HMM PF03595"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85015"
FT                   /db_xref="GOA:A0A0H2YV46"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV46"
FT                   /protein_id="ABG85015.1"
FT                   /translation="MKKYLDKLQNMPIGISGTCLAFITLSNSWNLKGINYFKPIAIFLA
FT                   VCMLSLMILRLIRFPKVMYEELKNPVTGTFYPTMGMVVWLVSGFFYPYFPVVCSWLWIA
FT                   AVIYHYGIVIFYTIIRIKERKFENIMPTCFIVYTGMITGSVASKGMDGVIPQIPQIAHF
FT                   MLMFGFIFYTILLPLVLYIVFKSEILDDHKLPTVGIICSPAPLGVVGILTIEPNPNPYM
FT                   LAWLIITGLILLVVVYGYILKLFKEGFKPSYAAFTFPLAIATLSAFKLSTYFTGLGYAK
FT                   MANLFKFLGDVEIFIATYVIFFMLLNFLNMFFKAISPKLGEYVEEEEELIGGTLYSK"
FT   gene            152568..153587
FT                   /locus_tag="CPF_0127"
FT   CDS_pept        152568..153587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0127"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84711"
FT                   /db_xref="GOA:A0A0H2YUH2"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH2"
FT                   /protein_id="ABG84711.1"
FT                   /translation="MRNKILKKSKSILPGLFICLIIGIIAEFLGKSFPTVGAATFAIFM
FT                   GIFLGNTLFKSDKYDEGTKFSEKDLLNYSIVLMGASLNIIDIMALGFNGVFYIAILMTL
FT                   TICTTYFIGRKLGFGEKYSLLMSAGNAVCGSSAIGSVSPVIKAKDSDKVIAITIVNVTG
FT                   TILMILLPLITSILYNNDVLQSSALMGGILQSVGQVIGSAKFIGDPVVELATVFKIIRI
FT                   IFLVVVVLVFAKIEVNEENKEEIAHHHKPTHKVRIPWFIIGFFIICILNSIGIIPGILG
FT                   RTFKWISSNFEIIALAGIGMRVKIGDLVKEGPKAMLYGGLVGVCQIIFALSLINIFIK"
FT   gene            153788..153940
FT                   /locus_tag="CPF_0128"
FT   CDS_pept        153788..153940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82274"
FT                   /db_xref="GOA:A0A0H2YPL4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL4"
FT                   /protein_id="ABG82274.1"
FT                   /translation="MIGEVLSFGYDQCAKLGYAMGFGAMEGLVIYLGLLAIIVLKLFNS
FT                   KSKAN"
FT   gene            complement(154296..155189)
FT                   /locus_tag="CPF_0129"
FT   CDS_pept        complement(154296..155189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0129"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83053"
FT                   /db_xref="GOA:A0A0H2YR26"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR26"
FT                   /protein_id="ABG83053.1"
FT                   /translation="MNSKFKGIIFMILASAAFATMNLLSKLAVGVNSYQKTFLTNVVAT
FT                   LIVCFIIAYKKGSFFGKKESRKYLLVRGVTGTLSILTNYYALDKMFLSDATILTKLAPF
FT                   FTIIFSYLLISEKITKKQFTLLIVAFAGSLFVIKPQFSTAIIPSLIGVASAAFAGIAYT
FT                   MIRVIGDKEDFWTIILSFTSIATIVMLPSMFMNTDNLTLQNILLLVSAGIAFTLGQVAL
FT                   TIAYKNAPASEISMYDYIGLIIAAIYGFMFFKEIPDFLSFTGYIIIVGSSLLNILGNKK
FT                   TSNKEINEDSSLVSTD"
FT   gene            155518..156756
FT                   /locus_tag="CPF_0130"
FT   CDS_pept        155518..156756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0130"
FT                   /product="cinA family protein"
FT                   /note="identified by similarity to SP:P46323; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   PF02464; match to protein family HMM TIGR00199; match to
FT                   protein family HMM TIGR00200"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83069"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUU6"
FT                   /protein_id="ABG83069.1"
FT                   /translation="MKAEIMAIGTEILLGDIVNTNAQFLAKELANLGIGVYHQSVVGDN
FT                   SERILEAFDNAFKNCDTIITTGGLGPTKDDLSKELAAKYFNMEMCLREELLCDLEDYFK
FT                   KNNLEMTENNKKQCYFPKEAIILPNPNGTAPGAILEGENNKRIILLPGPPREMEPMFTN
FT                   HVVPYLSKFTDSVLVSKILRVFGIGESKMEDLVCDLLDNENPTVAPYAKNIDVILRITA
FT                   KGKNKEEAEKLISPMEKEIRKRLGDNIYGEGEVTLEEVVGKLLVDKKMTVSTAESCTGG
FT                   MVASTLINYPGISEVFMEGAVTYSNEAKMKRLGVKKETLEDFGAVSEECAREMAKGIAK
FT                   NAGTRIGISTTGIAGPGGGTEEKPVGLVYAGLCIDGITKVKKFNFKADRQKVRTRTMMN
FT                   VLDWLRRELEKID"
FT   gene            157407..158333
FT                   /locus_tag="CPF_0131"
FT   CDS_pept        157407..158333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0131"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84423"
FT                   /db_xref="GOA:A0A0H2YUX3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUX3"
FT                   /protein_id="ABG84423.1"
FT                   /translation="MKPIFKVSLYFLIVLVLSIVGPMFVTPVLYKIGLVPPLVLMVIHI
FT                   IFFIVPAIIYIIVTKSNYKKVFSFKKPKGKDVFFSILIAALALPIMTFFSYTSSFFYTN
FT                   DVALVLDQMRAYPLWLMILVVGVTPAITEEITIRGIALSGFEFKSKNVAAIMTGIMFGI
FT                   LHLNAHQFLYATAMGIILAYVVRATGSIFLSMLIHFLINSWNLIQQRIVSQGITTEDLV
FT                   HSMDSIKNIPMELKIGVFLYYLIAAIVAAFLISYLIRKMEKRNFDITLDELDVATRVSY
FT                   KEERVINAPFIISVIVFIVYTFFIMKG"
FT   gene            complement(158524..158793)
FT                   /locus_tag="CPF_0132"
FT   CDS_pept        complement(158524..158793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:158692..158694,aa:Sec)
FT                   /locus_tag="CPF_0132"
FT                   /product="HesB-like domain protein"
FT                   /note="Selenoprotein. identified by match to protein family
FT                   HMM PF01521"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83718"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRY0"
FT                   /protein_id="ABG83718.1"
FT                   /translation="MKVKIHPNTLDKVKDMLDNSDKDAIRIKACSSGUAGLNIEVVLDE
FT                   QRENDDVVMDNGIKIVTDKKISHFFTDATLEYKNTILGKKFKIY"
FT   gene            159162..159749
FT                   /gene="rbr"
FT                   /locus_tag="CPF_0133"
FT   CDS_pept        159162..159749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr"
FT                   /locus_tag="CPF_0133"
FT                   /product="rubrerythrin"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84689"
FT                   /db_xref="GOA:A0A0H2YUC7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUC7"
FT                   /protein_id="ABG84689.1"
FT                   /translation="MKSLKGTKTAENLMKSFAGECQARTRYTYFSSTARKEGYVQISNI
FT                   FLETAENEKEHAKRFYKFLKDDLQGEAVEINAAYPVELPTDTLTNLKFAADGEHDELSN
FT                   LYPSFADVADEEGFPEVAAAFRMIAKAETAHYNRFMKLAKNIEEGKVFKKDEVVLWKCG
FT                   NCGFIWEGAEAPLKCPACLHPQAYFEVFKETY"
FT   gene            complement(159913..160458)
FT                   /locus_tag="CPF_0134"
FT   CDS_pept        complement(159913..160458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34821.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82290"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNA8"
FT                   /protein_id="ABG82290.1"
FT                   /translation="MLYYLVALFDKVSYAIIKPLQESISNEYKLYENLPMLHITLAVIE
FT                   DPDMDKLNEVVKNTLKSYKKFEVHLNGLIKFGEPYRSVNLKVDEESGVIKKLSRELYEN
FT                   LSKEGFKLTSNPDTWQLHVSLANPYFAQRVWGEDEFESAYTKLQDYNFDRELLIDEIQF
FT                   WRPINDENKMVVFSYPLH"
FT   gene            160888..161013
FT                   /locus_tag="CPF_0135"
FT   CDS_pept        160888..161013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83565"
FT                   /db_xref="GOA:A0A0H2YRD8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRD8"
FT                   /protein_id="ABG83565.1"
FT                   /translation="MVESRVSRLNKKKSSKMSVLYNIVGICFLALILFVGSQMFL"
FT   gene            161277..162833
FT                   /locus_tag="CPF_0136"
FT   CDS_pept        161277..162833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0136"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84048"
FT                   /db_xref="GOA:A0A0H2YSN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSN4"
FT                   /protein_id="ABG84048.1"
FT                   /translation="MSILIVKNMNHGFGDRAIFEDVSFRLLKGEHVGLIGANGEGKSTF
FT                   MNIITGKLMPDEGDVQWSNKVRVGYMDQHAQLEKGKTIREVLREAFQYLFDMEVEMNGL
FT                   YERMGEMSEDEMTKALERTATIQDMLDHNGFYMIDAKVEEVAAGLGLRDVGLDKDVTDL
FT                   SGGQRTKVLLAKLLLETPDILLLDEPTNYLDEEHIAWLKNYLIGYENAFILISHDIPFL
FT                   NSVVNVIYHVENRALTRYTGDYDNFMRVYEANKKQLEAAYERQQAEIAKLEDFVARNKA
FT                   RVATTGMARARQKKLDKMDRIELAAEKPKPEFNFKQGRTSGKLIFEARDLVIGYDEPLS
FT                   KPLNIRMERGQKIALVGANGLGKSTLLKSLMGLIKPISGEVETGDYQSIGYFEQEIKEA
FT                   NYNSCIEEVWQEFPGYTQYEVRSALAKCGLTTKHIESSVAVLSGGEQAKVRLCKLINKE
FT                   TNILILDEPTNHLDVEAKDELKRALKEYKGSILLVCHEPEFYRDLVTDVWSCEDWTLKI
FT                   V"
FT   gene            complement(162871..163032)
FT                   /locus_tag="CPF_0137"
FT   CDS_pept        complement(162871..163032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83304"
FT                   /db_xref="InterPro:IPR038733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS67"
FT                   /protein_id="ABG83304.1"
FT                   /translation="MGNLVNRGRLATSIDKDLLRKLNLLKEQTRIDRSKLLDEAIELLL
FT                   ERHNFKEN"
FT   gene            163213..164763
FT                   /locus_tag="CPF_0138"
FT   CDS_pept        163213..164763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0138"
FT                   /product="site-specific recombinase, resolvase family"
FT                   /note="identified by similarity to SP:P17867; match to
FT                   protein family HMM PF00239; match to protein family HMM
FT                   PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84335"
FT                   /db_xref="GOA:A0A0H2YTE7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTE7"
FT                   /protein_id="ABG84335.1"
FT                   /translation="MKRLACYIRVSSNKDDQQSSLIQQETLLREKFKQEDLIIYSDTGT
FT                   GVSFNREGFKRLMYDAGLNICKLNDGRITFEADNIRKPIFDEIVVINTSRFSRNIAIID
FT                   ILRVLWDYKKINVHFLDNCKNSNNPNDMTVLKMFFSMAENESMETSNRTKRGNEISILD
FT                   NTIRNNSIFGWDFDREKNYLKINKKEAEIVRFIFKTALTNGLKMTAKIVNEKGYRTKKN
FT                   RLWSSSTIKTLIVNPKYKGYNVRNKYSNENMFTGVKSKYVKKENWIIQKNNRIEPIVSE
FT                   ELWEEVQRALESRCLHGNRGINSNTYDTKGKVKCKKCGANYCRAVERKISEKPKRNQYL
FT                   ICSNKKKNGKVSCDAENINIGILDDYIEKERKNYYEKIRLKYMTEIVYLKEELEEKERL
FT                   SKKEINEEQERLNKELIDLKLKENEILDKFIKGKELIDIKILADNLKLIDEKIKEIKSK
FT                   ILNLEEIESYKIRNKLEIKDIEEKIKCLPLEEMTRENFLKKIDRIIVGGKDDLNIIYY"
FT   gene            165074..166159
FT                   /locus_tag="CPF_0139"
FT   CDS_pept        165074..166159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0139"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by similarity to SP:P23737; match to
FT                   protein family HMM PF00145; match to protein family HMM
FT                   TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82654"
FT                   /db_xref="GOA:A0A0H2YQK2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQK2"
FT                   /protein_id="ABG82654.1"
FT                   /translation="MSKIAISFFAGAGGLDIGIHEAGFDVKLSVELEEKYCVTLKQNNP
FT                   TFNVVNGDIMDYSKEKIYSDAGLNYNDEIDLIFGGSPCQSFSTAGKRQAFSDERGKAML
FT                   KFIELIEEVKPKAFLLENVKGLLSATLKHRPLNQRGKDFPPLDEDEENGSALRYLLNQV
FT                   KDYNVVYKVLNSAEYGVAQKRERVIFVGIRKDLNKVYEFPNPTHGVGRKYPFVTVNDVI
FT                   QELGDIKHNYVKYSEERLKYMKLIPKGGGNWRDLNEDIVEKAMGGAYKSGGGKTGYFRR
FT                   IKANEPSPTLLTSPIQKSTNIGHPYEDRPLSIEEYIAIQGFPKGYKINGTINNKYTQIG
FT                   NAVPVKLAKVLGEKLIDILYE"
FT   gene            166247..167071
FT                   /locus_tag="CPF_0140"
FT   CDS_pept        166247..167071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0140"
FT                   /product="putative type II restriction endonuclease"
FT                   /note="identified by similarity to SP:P25257; match to
FT                   protein family HMM PF09520"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82590"
FT                   /db_xref="GOA:A0A0H2YNV7"
FT                   /db_xref="InterPro:IPR019045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNV7"
FT                   /protein_id="ABG82590.1"
FT                   /translation="MNIETKNKVEEHLREVMKRILEKRTIQEPFNEEDIKNKNPFGYRL
FT                   VPIEVWKGSKFERSFVTSLGQGIFEQIAKIIAEGSGAIAENQYTKSIKLNSWQLEKIDN
FT                   ILEKQRKQRNASKKKVKDNSNKVKTINEELEFLRELETDRYQEVSVLFDLYIKRENGME
FT                   EYYSLKTVKPNLDQTETAKKDMLRLMTAEENSEAYFALPYNPAGEGEIYKLAHSIPYKL
FT                   FDMDNDSNVLIGKKLWDKIGQDDDTYDELLEIFNKVGEEYVYKIKKEYLGID"
FT   gene            167148..167462
FT                   /locus_tag="CPF_0141"
FT   CDS_pept        167148..167462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB62471.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV93"
FT                   /protein_id="ABG85005.1"
FT                   /translation="MSSDLDRIKITKFLQWNDRNGYYTDEECHLEEEPRMTYKEAVKYF
FT                   FGVLNDDFYYNIVDNIFELTYEEAIKYAKDNGFYNNTYEKLMLLVENENPTEEFYISLI
FT                   "
FT   gene            167674..167946
FT                   /locus_tag="CPF_0142"
FT   CDS_pept        167674..167946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0142"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85042"
FT                   /db_xref="GOA:A0A0H2YV75"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV75"
FT                   /protein_id="ABG85042.1"
FT                   /translation="MINNFIAKYKRRKGIFMWWIIGIVIAIAVVGALAESNDLSSKIML
FT                   FSGFLLVLGLITSSFFEFMGFVAELSGFVLIASLVFKVFRKIFLT"
FT   gene            168292..169326
FT                   /locus_tag="CPF_0143"
FT   CDS_pept        168292..169326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83782"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS28"
FT                   /protein_id="ABG83782.1"
FT                   /translation="MKNKKYKVKVDKHYLRKAITGSENYGQAISYLVDNSIKAYESIHD
FT                   NSDYCDITIEIFENLILIKDNSGGFKESISDEDIFRIGEDSGIGIKKAVFKFGNAINLE
FT                   SNAKYGFRRLLLDFDMDESELFFSSEKHKANIETTFGTTIYITDLEEDVKNDIINKIVF
FT                   YEVIEYLSKIFSKKLSNTNLRITIKQGEDKKIISPYLINGEFIAKKEIDNLIINLYKKD
FT                   DKDKYEKKGFDLYINDYIVYKRKELDKLTESGYHYKNCIAEVMAYGDRNYILQNIREIE
FT                   KLTKEFIKDNSSYFKAKETCVQFYADSNMIEELKEKCDLKTAKEVGEKGFENLCNKYNV
FT                   KKRA"
FT   gene            169590..170042
FT                   /locus_tag="CPF_0144"
FT   CDS_pept        169590..170042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPF5"
FT                   /protein_id="ABG82210.1"
FT                   /translation="MGFDENLIEKYLRKWQERLRLKDWDIKLQLINQEWNKTGDIKIDM
FT                   TDKKAIVMINNYNPKENNLEPVIIHELLHLKLWGMDQMIEQLMYLVFGKDENDPKFDFA
FT                   YTQFMNTLESTVEDLSKSFLTLDGEDKKISFERVQKQVDDELKKYK"
FT   gene            170504..171064
FT                   /gene="kptA"
FT                   /locus_tag="CPF_0145"
FT   CDS_pept        170504..171064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kptA"
FT                   /locus_tag="CPF_0145"
FT                   /product="RNA 2'-phosphotransferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by similarity to SP:P39380; match to
FT                   protein family HMM PF01885"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83861"
FT                   /db_xref="GOA:Q0TUT1"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUT1"
FT                   /protein_id="ABG83861.1"
FT                   /translation="MKNNDSKISKYISLILRHKPEEIGLKLDEHGYLGVLDLIEGLNKS
FT                   YEGFSMDDLERIVREDSKGRYSFNEDKSKIRANQGHSIKVDLGLEPIKPPKVLYHGTGR
FT                   KYLESILKNGLIKKERNYVHLSKDIETASIVGKRHGDLVILEVDSESMFNDGIKFYLSK
FT                   NNVWLCNYVPKKYIKELNLEEVF"
FT   gene            171485..173662
FT                   /locus_tag="CPF_0146"
FT   CDS_pept        171485..173662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0146"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05737;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82814"
FT                   /db_xref="GOA:A0A0H2YQZ1"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQZ1"
FT                   /protein_id="ABG82814.1"
FT                   /translation="MKNSKNFNIFTLWSVVISMIVIMIFPGSIVLGEESKSVQNDGAVE
FT                   ITSTTFESNTVAKDISNNLRIDYKILNKDKLKDGDKIVISLPDIFKDIEPKCPDQHFKD
FT                   FDVKDGVVTLTFNENVEKAVTGYMIIRFVGNSNIRKGVSYPISIDLNGKPSTVYITGEE
FT                   YSHPSSGGQYPLMYKTADLPTAATDKEQGREYYGEIVDRNKPIKYFVEINLGDGVNPNT
FT                   RSYLSNADFFDNIPKGMALDVNSICIKRMGYYDERSSDVTKDFWESNRIKADTKHLEIN
FT                   FGDIRYERYTVIYETRITSTESGYLNDAKLYYDDDKELPSKHYSKLSKDAGALNVYKYV
FT                   DKTKVKNNPNDQKIKYDIKFDSYGYFFKDTLNIIDKLDPRLSDIKITATDQFITDFDEN
FT                   TKELVIKNSNGDIDAKKPAYITIEASMKNVGPGEVVKNIAYVNGNPTNEVSTRKNPIVE
FT                   FILSAEYDDPSLLEGAVFKLTTKEGETVRDIYNEEIKTFTFENGEPVSFELPDGVYNLE
FT                   QIKAPEGYELNKTPIQFIVNEDSKVVKVPWEGNPIKTTVNLAIHKINEKGVPILGANFK
FT                   LFKEENPKKPIKFAYNKNLKVYELDPMGGGKLIPSKDGASFKINNLPYGKYILKEVKAP
FT                   KGYKLSDDIYITLDFEESFYRVGKQGEKIILNKNTETNTYDISVENVPRIILPETGGSG
FT                   TSKFSFIGITLLAAVLSLVSTTEFVLKEREN"
FT   gene            173666..175234
FT                   /locus_tag="CPF_0147"
FT   CDS_pept        173666..175234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0147"
FT                   /product="putative surface protein"
FT                   /note="identified by similarity to GB:AAO49409.1; match to
FT                   protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84125"
FT                   /db_xref="GOA:A0A0H2YTP3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTP3"
FT                   /protein_id="ABG84125.1"
FT                   /translation="MKNNILKKFSFIMVFIFVFITTSIPVFAATPSISKDAPIKGSITI
FT                   SKKGATFTAYKLLDATKSGDAYEYSVNSDLKDFFNNSNYGSYSQESIQKLSGEEVKEFA
FT                   VNLHKYILDNKKSGQELTDGQKNTVDLGYYLVTETSSDSEGAAVASTPIIVSVPQVSGD
FT                   SWNYDVTINPKDNTPILEKNIVKENQRVKTSSENIGDVVKYEVKASIPVYQKNAQNIMY
FT                   KFTDTMSKGLTYDEKTGFKVTSGDKVFDKDNDYTVDVKKQRDGSTVITINFNYDNIKAY
FT                   AETGITLNYQATLNKDAVISNKENLGNTNNIQLDYTNNPHVKDSYKKLTDKVTTYTFGF
FT                   GITKVDSELNSKLLQGAEFSVKDAGGKTVAKYTYDEKGQVVSLSGNGVTNSKGITTFVG
FT                   LKEGKYLITEEVAPSGYSLLKNPVEVTITANKDESGNYTGAATIEISNGNKAGQIINDI
FT                   SENDGNILFNVQIENHAGFSLPSTGGLGNTGFIKIAIILLSIVCVLSILGLGYTKFENS
FT                   RKTKN"
FT   gene            175661..176482
FT                   /locus_tag="CPF_0148"
FT   CDS_pept        175661..176482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0148"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83485"
FT                   /db_xref="GOA:A0A0H2YS45"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS45"
FT                   /protein_id="ABG83485.1"
FT                   /translation="MKRLKRIYFSILILITLIALGFLLYPSFSNYINNKFAVSTISDYT
FT                   EKINNVKDEEVDDLIKNINKYNYDLFNGTAENELPDYLNIHEGDVLGYIEIPSINIKLP
FT                   IYYGSSVDILKKGVGVLEGTSLPVGGENTHSVLSAHTGLANQKLFTDIDKLKDGDVFYL
FT                   HILKKDLAYKVNQIKVVHPDEIDDLKISEDKDYVTLLTCYPYGINTERLLVRGERTDLS
FT                   ERTEVQVQKEISTFNHSNENLILIVIILISVLIIIFLLFLIMKFKGKNKSR"
FT   gene            176551..177462
FT                   /locus_tag="CPF_0149"
FT   CDS_pept        176551..177462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36679.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83186"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQE6"
FT                   /protein_id="ABG83186.1"
FT                   /translation="MISREKYVTSSLELHLFFMRVMKEHAIFLEAGLGPKNSKLAKELD
FT                   KCKGNLEKLLFDVVKLSKGRVRQSIVDSGEVFTDYTLETEKKTEHYTGININSKITTME
FT                   KDLMCAPKKGIDSKVASCVKDINNKAIKLIDELIDLKMKILDDVLCCKIFTSNYPSLVE
FT                   HTIEEAKLYRSYIDDIECNRDIDEVNISKTEAFWNEIMMEHSLFIRGLLDPSEYELINT
FT                   AHEFAFEFNELIQQLNNVTNVTIDNVTHETLKETTRLRDFKEEGTKGIMNCNIKSLILP
FT                   LLSDHVLREANHYIRILRCYEK"
FT   gene            177937..178614
FT                   /locus_tag="CPF_0150"
FT   CDS_pept        177937..178614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0150"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84887"
FT                   /db_xref="GOA:A0A0H2YUT9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUT9"
FT                   /protein_id="ABG84887.1"
FT                   /translation="MKKKSLIILSIIVLIFVCITLYLTREHIMVFYKLITNGEVVKSYL
FT                   ERFGPWAAVIFFVFQILQVVIFFIPGEVIQAAGGYIFGALGGTLLSFFGIAVGSAILFY
FT                   ICQKFGKKLVQRFVPKDMYDKLEKILNSPKFKLILVILFFLPGAPKDSLIMVCALSNIT
FT                   IGHFIIFSMIGRIPALVASSFMGANLAEGNIVGVIIIGVIALIACALGVIFRKDVFKYM
FT                   EKL"
FT   gene            178898..179554
FT                   /locus_tag="CPF_0151"
FT   CDS_pept        178898..179554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0151"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAB53818.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82550"
FT                   /db_xref="GOA:A0A0H2YPS9"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPS9"
FT                   /protein_id="ABG82550.1"
FT                   /translation="MNKEKLKSVFTSKIAIGIICFIIGGIALGNSNSGVNLTKERYDQL
FT                   LEFEKVALQKEGEAVETLNEELTEENLDNKINEKTEEDKRPLSIGETAYINDENGVKSM
FT                   AITIDNVKLTDERNQFSEKEAEKVVVIEYTYENIADEENLYVFDSNFKVYDASGNVLET
FT                   YPAGAEKYPQAISKGKKCTANMSFALNNESNNLEIEFYDNMFNGKASEVFNISAE"
FT   gene            179631..180182
FT                   /locus_tag="CPF_0152"
FT   CDS_pept        179631..180182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC70304.1; match to
FT                   protein family HMM PF08719; match to protein family HMM
FT                   TIGR02464"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83553"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS96"
FT                   /protein_id="ABG83553.1"
FT                   /translation="MRYSIEGVCEKFKSGEKLEFLFFWGHTKNKNEKITKACFSQWYLS
FT                   DFTVNGVLYNCAEKYMMAEKARLFKDYETLEEILSVENQKEIKDLGRKIKNFNEELWNR
FT                   EKYEIVKSGNLAKFSQDENLKEFLLSTGDKIIVEASPYDSIWGIGMGAKDENIEDPTAW
FT                   KGENLLGFALMEVRGLLNAM"
FT   gene            180208..180372
FT                   /locus_tag="CPF_0153"
FT   CDS_pept        180208..180372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT34"
FT                   /protein_id="ABG84207.1"
FT                   /translation="MFLLLKLDSVFLNYENILILKRACIKTTLNKNYKFLQRFKDSLNI
FT                   FVIFLIVFI"
FT   gene            complement(180384..181850)
FT                   /locus_tag="CPF_0154"
FT   CDS_pept        complement(180384..181850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK05345.1; match to
FT                   protein family HMM PF05043"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84833"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUP5"
FT                   /protein_id="ABG84833.1"
FT                   /translation="MFKEDLLETSEKIQYNIFKKVYVNNGKINKNDLCSDLNISLPTLK
FT                   THLKKIEYLLNKYYKSKVKISSSKDFIFLKYETGVSLHSLTTYYIESSLKYKLLKFFFI
FT                   KHTKKFTGIQICNYFNISLATLNRKILECNSLLKEFDISIKNYELTGSQLQISYFYYLL
FT                   FWNNRIDISSVVSANHNITEVIEKTFNITLKISEKYPLYTWLKILMIRKKFFVEDFFKD
FT                   EFTKKNLSILENTEIFIELKNFFEKDSLSKSSSTYLAYSTLCFILSFNIIPYEVIKEFS
FT                   TVNESTPFKIFSLMTEEMSNLYTTHPNNFNNEVKLHLLSLCFKSYFFKGIFYSNNKIVT
FT                   NYYLNEFTSDSREKFVNDLLLKINSLYKVKYSFDPDYFKLCIILTLNYLNGVSKHSLTI
FT                   GILSRIDSLILNTTIDYLRKFLRRKFDVIVEVYDEYKKENYDLVITNFDPKYIPKNYNN
FT                   IYIFSNLAVQYDLGNIVKILNEIEKTKFEG"
FT   gene            182521..183552
FT                   /locus_tag="CPF_0155"
FT   CDS_pept        182521..183552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0155"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82567"
FT                   /db_xref="GOA:A0A0H2YQC5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQC5"
FT                   /protein_id="ABG82567.1"
FT                   /translation="MQVLIGAGLLLIVLGLFTLFSYKAPHGMKAMGALAGAACASFLVE
FT                   AFHSSFFGNVLNIEFLKKVGDANGSLGGVAAAILVPLALGVSPVYSVLIGLSCSGLGIL
FT                   PGFIAGYLMSFVVKFLEEKLPSGLDLIVIIVVATPLTRIIGDFTAPVVDSTLLKIGQVL
FT                   IASANSNPITMGIILGGIITVVATAPLSSMALTAMLGLTGAPMAIGALSVFGSSFLNFV
FT                   LFQKMKFGSKKDTISVAIEPLTQADIITANPIPIYVTNFIGGALCGIIIVLMGLTNMSP
FT                   GTATPIAGFAVMFAYNPAFKVLMASLACVVVSAGSGYLGYLLFKNYKIHTVDEIRGNDL
FT                   EVE"
FT   gene            184140..185642
FT                   /gene="pfo"
FT                   /locus_tag="CPF_0156"
FT   CDS_pept        184140..185642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfo"
FT                   /locus_tag="CPF_0156"
FT                   /product="perfringolysin O"
FT                   /note="identified by similarity to GB:ABG67694.1; match to
FT                   protein family HMM PF01289"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82518"
FT                   /db_xref="GOA:Q0TUS0"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUS0"
FT                   /protein_id="ABG82518.1"
FT                   /translation="MIRFKKTKLIASIAMALCLFSQPVISFSKDITDKNQSIDSGISSL
FT                   SYNRNEVLASNGDKIESFVPKEGKKAGNKFIVVERQKRSLTTSPVDISIIDSVNDRTYP
FT                   GALQLADKAFVENRPTILMVKRKPININIDLPGLKGENSIKVDDPTYGKVSGAIDELVS
FT                   KWNEKYSSTHTLPARTQYSESMVYSKSQISSALNVNAKVLENSLGVDFNAVANNEKKVM
FT                   ILAYKQIFYTVSADLPKNPSDLFDDSVTFNDLKQKGVSNEAPPLMVSNVAYGRTIYVKL
FT                   ETTSSSKDVQAAFKALIKNTDIKNSQQYKDIYENSSFTAVVLGGDAQEHNKVVTKDFDE
FT                   IRKVIKDNATFSTKNPAYPISYTSVFLKDNSVAAVHNKTDYIETTSTEYSKGKINLDHS
FT                   GAYVAQFEVAWDEVSYDKEGNEVLTHKTWDGNYQDKTAHYSTVIPLEANARNIRIKARE
FT                   CTGLAWEWWRDVISEYDVPLTNNINVSIWGTTLYPGSSITYN"
FT   gene            185837..186295
FT                   /locus_tag="CPF_0157"
FT   CDS_pept        185837..186295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTN9"
FT                   /protein_id="ABG84120.1"
FT                   /translation="MKLAEALILRADLQKELMSLKNRINQNLLVQEGEKPSENPYTLYD
FT                   EILLKVSELEGLILKINKTNSNYITSNNESISDLIVKRDMLGKKISILKEIAEEATVKV
FT                   NRYSQTEIKIFSAMKVDQLQREINKYSKEYRELDTKLQGLNWTIDLME"
FT   gene            186367..186585
FT                   /locus_tag="CPF_0158"
FT   CDS_pept        186367..186585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD62162.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTW4"
FT                   /protein_id="ABG84525.1"
FT                   /translation="MLVAFIKEVINPNLGKKVIIHVSRSRYLFYNLCSNKLHGYYLRIT
FT                   IYNHMTINNKRGWGKGIQFKEDRVMIH"
FT   gene            187354..188841
FT                   /locus_tag="CPF_0159"
FT   CDS_pept        187354..188841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0159"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82837"
FT                   /db_xref="GOA:A0A0H2YPP7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPP7"
FT                   /protein_id="ABG82837.1"
FT                   /translation="MSERKRSLSSGALMLMTFTAVFSFGNIIDSSVNIGLATIPSYIFG
FT                   TVFYFLPFALMIGEFASASSDSESGINSWIKKSLGARWAFLGSWSYFFVNLFFFTSLLP
FT                   KILIYASYTFVGRNVFDGKTVLISVISIVLFWAVTIISTKGVSWISKITSISGVARIIL
FT                   GLGFIVLSFGVILFLGKAPAQEFTAETIMPKFNWSYFMVLAWILQAVGGAESIGVYIKD
FT                   VKGGNKTFIRTMVISTAIVGGLYALGAVSVGLVVPSEVLQGNFSNGLFDAFAILGANYG
FT                   VGNIITNIVGFIMMLASLGSLVLWTAAPVKVLFSEIPEGIFGKWIAKTDKKGTPVNALY
FT                   VQAVIVTVLLLVPALGIGSVDSLLEMLINMTASTSLIPVLFFLVGYIVLRAKKDHMERS
FT                   FKVGSKNFGIAIGVLLLALFVFVFVISSIPAPQDFAAYFNGTLAEGATNPVFILLYNVL
FT                   GLVFFLGFAEICWRKYEKKVGKAVANEWDQEEVSEIA"
FT   gene            189000..191069
FT                   /locus_tag="CPF_0160"
FT   CDS_pept        189000..191069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0160"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF02449;
FT                   match to protein family HMM PF08532; match to protein
FT                   family HMM PF08533"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83924"
FT                   /db_xref="GOA:Q0TUR6"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUR6"
FT                   /protein_id="ABG83924.1"
FT                   /translation="MKNYGPISSKVTKMLHGADYNPEQWIDMPNIWGEDVRLMKLSHTN
FT                   VVAVGIFSWTMLEPEEGKFNFEWLDEIMDLMHKNGNYVILATPSGAKPIWMAHKYPETL
FT                   RVAQNRVRNLYGERHNHCYTSPIYREKIAIIDRLLAERYKDHPALILWHISNEFEGQCY
FT                   CPLCEEAFRDFLREKYDNDINKLNKAWWTKFWSHTYASFDEIEAPAPHGEPALHGLNLD
FT                   WMRFVTHQTLDYYKHERSILKEITPDIPVTTNFHDYISLFRGIDYWKFAPYLDVVSWDN
FT                   YPYWHGERTDDHEGSRIGFVHDLNRAILNGKPFMMMESSPSSTNWQPVAKLRRPGMHVL
FT                   SSLQAVAHGSDTVQYFQWRKSRGSSEKFHGAVVDHCGHENTRVFRDVTKVGEILSKLDD
FT                   VIGTSVEPQVAVIYDWENYWAINDAQGPRIEQKDYFETCQKHYKAFWDMSIPTDVINMD
FT                   CDFSKYKVVVAPMLYMVRPGVGERLEEFVKNGGTLVTTYWSGIVDENDLCFLGGFPGPL
FT                   KKVTGIWAEELDALYDEDVNYVSVEEGNSLGMKGEYEARIFCDLIHSEGAEVLATYKTD
FT                   FYKGMPALTCNNFGEGQAYYIAFRNNDEFLSDFYSSLAKKLTLKRAIEIDLPKGINAQV
FT                   RMDEKNEFVFFMNFSSEEKTIDIKDLDLTDMVTGEKVAKEMEIEPYGVRIVRRK"
FT   gene            191622..192863
FT                   /gene="arcA"
FT                   /locus_tag="CPF_0161"
FT   CDS_pept        191622..192863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="CPF_0161"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84531"
FT                   /db_xref="GOA:Q0TUR5"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUR5"
FT                   /protein_id="ABG84531.1"
FT                   /translation="MRDDRALNVTSEIGRLKTVLLHRPGEEIENLTPDLLDRLLFDDIP
FT                   YLKVAREEHDAFAQTLREAGVEVLYLEVLAAEAIETSDEVKQQFISEFIDEAGVESERL
FT                   KEALIEYFNSFSDNKAMVDKMMAGVRKEELKDYHRESLYDQVNNVYPFVCDPMPNLYFT
FT                   RDPFATIGHGITLNHMRTDTRNRETIFAKYIFRHHPRFEGKDIPFWFNRNDKTSLEGGD
FT                   ELILSKEILAVGISQRTDSASVEKLAKKLLYYPDTSFKTVLAFKIPVSRAFMHLDTVFT
FT                   QVDYDKFTVHPGIVGPLEVYALTKDPENDGQLLVTEEVDTLENILKKYLDRDIKLIKCG
FT                   GGDEIIAAREQWNDGSNTLAIAPGEVVVYSRNYVTNEILEKEGIKLHVIPSSELSRGRG
FT                   GPRCMSMPLIREDL"
FT   gene            192972..193967
FT                   /gene="argF"
FT                   /locus_tag="CPF_0162"
FT   CDS_pept        192972..193967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="CPF_0162"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84847"
FT                   /db_xref="GOA:Q0TUR4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUR4"
FT                   /protein_id="ABG84847.1"
FT                   /translation="MAVNLKGRSFLTLKDFTPAEIRYLLDLSHDLKAKKRAGILGDSLK
FT                   GKNVVLLFEKTSTRTRCAFECGAAEEGAHVTFLTNSQMGKKESIEDTAKVLGRMYDGIE
FT                   FRGFKQSTVEELAKHAGVPVWNGLTDADHPTQILADFLTIEEHAHKPLSEIKLVFTGDT
FT                   RNNMSYALMYGAAKMGMHFVALGPDSLKPDEDILKEMQEYSKETGATIEFSSNVDEAVK
FT                   GADVIYTDIWVSMGEDESLYPERVKLLTPYKVTREMMNKTGNKNTLFMHCLPSFHDEDT
FT                   EVCKDMMDRLGLDIREVEDEVFRSKNSVVFDEAENRMHTIKAVMVATAGR"
FT   gene            194112..195548
FT                   /gene="arcD"
FT                   /locus_tag="CPF_0163"
FT   CDS_pept        194112..195548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="CPF_0163"
FT                   /product="arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845; match to protein
FT                   family HMM TIGR00905"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83089"
FT                   /db_xref="GOA:A0A0H2YR52"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR52"
FT                   /protein_id="ABG83089.1"
FT                   /translation="MAEQHNEPKKLGFAQLAALIVGSMIGGGAFNLPSDMARGAGTGAV
FT                   IIGWIITGIGMIALAFVYQSLANRKPELTGGVYSYAKAGFGEYIGFNSAWGYWLSAWIG
FT                   NVSYSVLLFGAVGYFLPMFGAGNNVASIIGASVLLWAFTLLILNGVSGAALINLITTIA
FT                   KLVPIFLFIVISLFMFNFDKFTFQFWGTSDLGGIVTQVKSTMLVTLWCFIGIEGAVVVS
FT                   GRAKKQSDVGKATVLGLIGTLIIYMLITLMALGVMDRVKLSGLENPSMAYVLEFAVGKW
FT                   GAVLINLGLIISLFGSLLGWALLAAEIPYVAAKDGVLPKVFAKLNKKGTPSGSLIITNL
FT                   LVQAFLILTLVASSTYQALYSVASTAILVPYLLSAMYGFKLALTGETYDKNPTGRTRDK
FT                   IFGGIATVYAIWLCYAAGLKYLLLCFILYAVGIIFFYIGKKQNNKDAEVFVGKEKILAI
FT                   IVLVIAIIAIVMLFNGTITI"
FT   gene            195609..196553
FT                   /gene="arcC"
FT                   /locus_tag="CPF_0164"
FT   CDS_pept        195609..196553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="CPF_0164"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84009"
FT                   /db_xref="GOA:A0A0H2YTB6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTB6"
FT                   /protein_id="ABG84009.1"
FT                   /translation="MKIVLALGGNALQKDSKDKSAEGQLETCRQTAISVADLIEDGHEV
FT                   SIVHGNGPQVGQILASIELAHQVDNGNPLFPFDVVGAFSEGYIGYHLQNTIREELLKRG
FT                   IEKSVDTITTQVIVDKNDPGFKNPTKPIGSFYTKEEAEKLEKDKGYTMKEDAGRGYRRV
FT                   VASPKPVDIVEKEAIKTMVDSGFIVIACGGGGIPVVEDGDRLEGVPAVIDKDFAAEKLA
FT                   EILDADALLILTAVDRVCVNFNKPDQKALKEINLEEVDKYIEEGQFAPGSMLPKVEACK
FT                   KFVLSGDKKVAIIASLTNAKAALRGESGTKIVK"
FT   gene            196626..197081
FT                   /gene="argR"
FT                   /locus_tag="CPF_0165"
FT   CDS_pept        196626..197081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="CPF_0165"
FT                   /product="arginine repressor"
FT                   /note="identified by match to protein family HMM PF01316;
FT                   match to protein family HMM PF02863"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82752"
FT                   /db_xref="GOA:A0A0H2YPN0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPN0"
FT                   /protein_id="ABG82752.1"
FT                   /translation="MSNLEKSLRHEVILDIIESKCICKQEELIIELKECGINVTQATLS
FT                   RDLHEMNIIRKSFENHEHRYIVTKEDKFIKKFKNIFKSSVRSISMQEYFISVNTLDGMA
FT                   SLIGEFIDRLGDGRIAGTVAKKNHILVLCRSVNATQQIFKELDSLRV"
FT   gene            197623..200937
FT                   /gene="colA"
FT                   /locus_tag="CPF_0166"
FT   CDS_pept        197623..200937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="colA"
FT                   /locus_tag="CPF_0166"
FT                   /product="microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="identified by similarity to SP:P43153; match to
FT                   protein family HMM PF00801; match to protein family HMM
FT                   PF01752; match to protein family HMM PF04151; match to
FT                   protein family HMM PF08453"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82419"
FT                   /db_xref="GOA:A0A0H2YPK1"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPK1"
FT                   /protein_id="ABG82419.1"
FT                   /translation="MKKNLKRGELTKLKLVERWSATFTLAAFILFNSSFKVFAADKKIE
FT                   NSNNGQITREINADQISKTELNNEVATDNNRPLGPSIAPSRARNNKIYTFDELNRMNYS
FT                   DLVELIKTISYENVPDLFNFNDGSYTFFSNRDRVQAIIYGLEDSGRTYTADDDKGIPTL
FT                   VEFLRAGYYLGFYNKQLSYLNTPQLKNECLPAMKAIQYNSNFRLGTKAQDGVVEALGRL
FT                   IGNASADPEVINNCIYVLSDFKDNIDKYGSNYSKGNAVFNLMKGIDYYTNSVIYNTKGY
FT                   DAKNTEFYNRIDPYMERLESLCTIGDKLNNDNAWFVNNALYYTGRMGKFREDPSISQRA
FT                   LERAMKEYPYLSYQYIEAANDLDLNFGGKNSSGNDIDFNKIKADAREKYLPKTYTFDDG
FT                   KFVVKAGDKVTEEKIKRLYWASKEVKAQFMRVVQNDKALEEGNPDDILTVVIYNSPEEY
FT                   KLNRIINGFSTDNGGIYIENIGTFFTYERTPEESIYTLEELFRHEFTHYLQGRYVVPGM
FT                   WGQGEFYQEGVLTWYEEGTAEFFAGSTRTDGIKPRKSVTQGLAYDRNNRMSLYDVLHAK
FT                   YGSWDFYNYGFALSNYMYNNNIGMFNKMTNYIKNNDVSGYKDYIASMSSDYGLNDKYQD
FT                   YIDSLLNNIDNLDVPLVSDEYVNGHEAKDINEITNDIKEVSNIKDLSSNVEKSQFFTTY
FT                   DMRGTYVGERSQGEENDWKDMNSKLNDILKELSKKSWNGYKTVTAYFVNHKVDENGNYV
FT                   YDVVFHGMNTDTNTDVHVNKEPKAVIKSDSSVIVEEEINFDGTESKDEDGEIKAYEWDF
FT                   GDGEKSNEAKAAHKYNKTGEYEVKLTVTDNNGGINTESKKIKVVEDKPVEVINESEPNN
FT                   DFEKANQIAKSNMLVKGTLSEEDYSDKYYFDVAKKGNVKITLNNLNSVGITWTLYKEGD
FT                   LNNYVLYATGNDGTELKGEKTLEPGRYYLSVYTYDNQSGAYTVNVKGKLKNEVKETEKD
FT                   AIKEVENNNDFDKAMKVDSNSKIVGTLSNDDLKDIYSIDIQNPSDLNIVVENLDNIKMN
FT                   WLLYSADDLSNYVDYANADGNKLSNTCKLNPGKYYLCVYQFENSGTGNYTINLQNK"
FT   gene            complement(201085..201543)
FT                   /gene="mscL"
FT                   /locus_tag="CPF_0167"
FT   CDS_pept        complement(201085..201543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="CPF_0167"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84102"
FT                   /db_xref="GOA:Q0TUQ9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUQ9"
FT                   /protein_id="ABG84102.1"
FT                   /translation="MWKEFKEFAMKGNVIDLAIGVVIGGAFGKIVTSLVNDIIMPVVGS
FT                   LVGKVDFSNLYINLSGQQFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIFIVIKQI
FT                   NKLKNFTKKKEEVKVEATEKDCPYCYTKIDIKATRCPHCTSVLEEATN"
FT   gene            202287..202910
FT                   /locus_tag="CPF_0168"
FT   CDS_pept        202287..202910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0168"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83603"
FT                   /db_xref="GOA:A0A0H2YSY0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSY0"
FT                   /protein_id="ABG83603.1"
FT                   /translation="MNSVKYFNSIAKEWNKMRVDYFKDELREMAIKSVDISNKVIADLG
FT                   AGTGFISLGIAKKANIVFSLDSSKNMLKELYSSAKENEINNIYPIKGELENLPLFDDSI
FT                   DLIFMNMALHHVANPDKAIKEMNRVLKSNGKVVITDVLEHKGEWAREEMFDTWLGFNYD
FT                   QLINWFEKAGFKNISIKNTGLVARGESSFGEVIEPGIFMAIAKK"
FT   gene            202974..204128
FT                   /gene="metC"
FT                   /locus_tag="CPF_0169"
FT   CDS_pept        202974..204128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="CPF_0169"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by similarity to GB:AAF14695.1; match to
FT                   protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82803"
FT                   /db_xref="GOA:A0A0H2YPL9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL9"
FT                   /protein_id="ABG82803.1"
FT                   /translation="MKKNSLLIHGGISIDEKTGAVNIPIYQTSTYKQRSFGENSGYEYS
FT                   RTGNPTRESLEKLIADIEYGKRGFAFASGLAAITAVLSLFKSGDKLLITNNLYGGTFRV
FT                   IDKIFSNFGIGYEIIDDFTNIEEKIDDSVKAIYIETPTNPLLDVIDIKIASDRAKKYNL
FT                   LTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVVKDEELGEKIHFIQN
FT                   STGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGIENVYYPGLKTHIGH
FT                   DIQKKQASGFGGIISFTLNKKYNYEKFFNSLELITFGESLGGVESLACHPASMTHAAMP
FT                   LELRERIGITDRLIRISVGIEDKEDILEDIQQALVKAGDKNEIL"
FT   gene            204115..205023
FT                   /locus_tag="CPF_0170"
FT   CDS_pept        204115..205023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0170"
FT                   /product="cysteine synthase family protein"
FT                   /note="identified by similarity to SP:P37887; match to
FT                   protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83632"
FT                   /db_xref="GOA:A0A0H2YT07"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT07"
FT                   /protein_id="ABG83632.1"
FT                   /translation="MKYYNDIRDLIGNTPILKLNNISTKEGVNIYAKIEGTSPGGSCKD
FT                   RVGIYMVEKAEKEGKLKSGSTIIEATAGNTGIGIALAAINKGYKIIFIVPNKFSIEKQK
FT                   IMKALGAEIINTPKEEGMEGAINLANSLLSEIPNSLSLNQFKNEANPLAHYETTGRELY
FT                   DGLDGQIDYFVAGAGSGGTISGVLKFLKENISEVKGILADPVGSIIGGGQCGTYKIEGI
FT                   GNNFIPETMDMSLVDDVIKVNDEEAFDAVKLLAKKEGLIVGSSSGAAFAAVLKLAEKIE
FT                   EGNIVTIFPDRGDRYFSTDLF"
FT   gene            205108..205563
FT                   /gene="luxS"
FT                   /locus_tag="CPF_0171"
FT   CDS_pept        205108..205563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="CPF_0171"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83205"
FT                   /db_xref="GOA:Q0TUQ5"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUQ5"
FT                   /protein_id="ABG83205.1"
FT                   /translation="MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPNK
FT                   ELLSDKGMHTLEHFLAGFMREKLDDVIDISPMGCKTGFYLTSFGDINVKDIIEALEYSL
FT                   SKVLEQEEIPAANELQCGSAKLHSLELAKSHAKQVLENGISDKFYVE"
FT   gene            205912..206886
FT                   /locus_tag="CPF_0172"
FT   CDS_pept        205912..206886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0172"
FT                   /product="putative esterase"
FT                   /note="identified by similarity to GB:AAC45283.1; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84920"
FT                   /db_xref="GOA:A0A0H2YVI0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVI0"
FT                   /protein_id="ABG84920.1"
FT                   /translation="MWFKKLYVGTIDLLSAIVEKIAKCNLACKIYKAVFQLGVFPKPKN
FT                   FDKIVSNLVIEKDIAYESSILEGNKLDVYYPKNLNKKAPILMWIHGGGYIANSKETVKN
FT                   YMMTLANKGFVVFNIDYALAPKYKYPSQILQCNEALKYVFENAEKFNGDRENIFIGGDS
FT                   AGAQMASQLAAIISNEEISNKMNLKPSITNKFLRGVILFCGLYNMDSLRATKFPGIKTY
FT                   MEALTGESNFENYERIDELATIKYITPNYPSTFITVGDIDPFVDQGKELASSLRALGVK
FT                   VVSRFFENKGLWHEYQFKFSVKEARKTFKSVIEFLNDNSKSMN"
FT   gene            complement(207270..208061)
FT                   /locus_tag="CPF_0173"
FT   CDS_pept        complement(207270..208061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84288"
FT                   /db_xref="GOA:A0A0H2YTE6"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTE6"
FT                   /protein_id="ABG84288.1"
FT                   /translation="MKRYARIYVQFLKQYLKTLLEYKEDFIYGILGFFLVQATSIIFIS
FT                   LIFNNVPTLSGWSFYEIIFIYGFSQIPRGIDHIFTDYLWIFSGRSIVRGEFDRYLLRPL
FT                   NPLFQVIAERFQPDGFGELVVGFILVVYSAIKLSVNITPLWIIGFIIAIMGGTLIYTGV
FT                   KLATASIAFWTKTSFRHVQMAYGLSDFSKYPISIYPGAIKFLLTFIIPFAFTGYYPGTY
FT                   LIGKESFFMGVILTLIVGILSIIVSYRIWLKGVSSYESSGN"
FT   gene            complement(208066..208884)
FT                   /locus_tag="CPF_0174"
FT   CDS_pept        complement(208066..208884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0174"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83318"
FT                   /db_xref="GOA:A0A0H2YRM3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM3"
FT                   /protein_id="ABG83318.1"
FT                   /translation="MDFFKTIRVYSSFAKGTFKALSSYKANLLMGLIGQLIMISVTYFL
FT                   WIAIYSSSQEGIMNGFTLKEMLTYVMITLLIGIVTSNDISQEISFEVRDGSISTNLIKP
FT                   INYRLRIIFIGIGNFIFFFLTLFLPGAILISTYAILNGININLASILIFSISIILGCLI
FT                   NIYYSYIFGLLSFKFYNIWGISQIARAIIMLVSGAMIPLTFFPEIVQKLFNFLPFSSII
FT                   YTPAMIYLNKLSYAQIAKSLGLQLIWVVILMVLSKIMWNKVIDKLTIQGG"
FT   gene            complement(208887..209912)
FT                   /locus_tag="CPF_0175"
FT   CDS_pept        complement(208887..209912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0175"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84148"
FT                   /db_xref="GOA:A0A0H2YTR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTR0"
FT                   /protein_id="ABG84148.1"
FT                   /translation="MIKVENLTKEFKIRKKESGLKGAFKSLFSSDFDSKTAVSNISFEI
FT                   KSGEIVGYIGSNGAGKSTTIKMMTGILTPSSGQVLVNGRVPYKEREKNAKDIGVVFGQR
FT                   TQLWWDLALSETFTILKDIYSIPDEVYEKNMNFLNKVLDLEEFMTRPVRTLSLGQRMRG
FT                   DLAASLIHNPKILYLDEPTIGLDVVVKEKVRTAIKEINKEFGTTVILTTHDLSDIEELC
FT                   KRIIIIDKGTKIYDGSLDDIKKKYGYMTTLEIQSKKDFKTLLNIKEILKSESNIPIETF
FT                   SSDDLSEHIESGKLIITFNKNKITSSKIISKVIERVDVLDFLLKESSIEDIIKKIYRNE
FT                   V"
FT   gene            210223..210891
FT                   /locus_tag="CPF_0176"
FT   CDS_pept        210223..210891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0176"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83175"
FT                   /db_xref="GOA:A0A0H2YQD4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQD4"
FT                   /protein_id="ABG83175.1"
FT                   /translation="MKLDRKDIIDIFNFRFATKEFTGEIIPKEDMEMIAETARLSPSSF
FT                   GLEPWKFLIVENKELIKEISEVSWGFQRQASTTSHIVIALTKAGSEVKYDSDYIRNLWI
FT                   NTKGVSEEFFEGIKDVLKNFQVGKLEADETNEKLLEWSKRQTYIALGNMMTAAAMREID
FT                   SCAIEGFDKEKVEEILAKKGILDKEKYELTYLIAFGYRKEDPNRKKSRLPKSEVIQWVE
FT                   "
FT   gene            211176..211841
FT                   /gene="nanE"
FT                   /locus_tag="CPF_0177"
FT   CDS_pept        211176..211841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanE"
FT                   /locus_tag="CPF_0177"
FT                   /product="N-acetylmannosamine-6-phosphate epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="identified by similarity to GB:AAD28762.1; match to
FT                   protein family HMM PF04131"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84369"
FT                   /db_xref="GOA:Q0TUP9"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:4UTT"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUP9"
FT                   /protein_id="ABG84369.1"
FT                   /translation="MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQ
FT                   GVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRP
FT                   NGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDF
FT                   ELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDILK"
FT   gene            211878..212744
FT                   /gene="nanA"
FT                   /locus_tag="CPF_0178"
FT   CDS_pept        211878..212744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanA"
FT                   /locus_tag="CPF_0178"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /note="identified by similarity to GB:AAD28763.1; match to
FT                   protein family HMM PF00701; match to protein family HMM
FT                   TIGR00683"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84330"
FT                   /db_xref="GOA:Q0TUP8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUP8"
FT                   /protein_id="ABG84330.1"
FT                   /translation="MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGST
FT                   GENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVT
FT                   PFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFT
FT                   AADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFEAAQK
FT                   GDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEMIAKAK
FT                   EINKKYF"
FT   gene            212848..214365
FT                   /locus_tag="CPF_0179"
FT   CDS_pept        212848..214365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0179"
FT                   /product="sodium/solute symporter family protein"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83346"
FT                   /db_xref="GOA:A0A0H2YR20"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR20"
FT                   /protein_id="ABG83346.1"
FT                   /translation="MQGFTKFDLVVLVVYLGAVLYAGLKFSKKEMKGKEFFRGDGTIPW
FT                   WVTSVSIFATLLSPISFLSLAGNSYKGTWIMWFAQLGMFVAVPLTIRYFLPVYSRLDID
FT                   TAYEYLEIRYKDKGLRILGAIMFIIYQIGRMAIIMYLPSMVLANLTGINVYLLIVAMGV
FT                   IAIIYSYTGGLKSVLWTDFIQGCVLIAGIVFSLIFLISTINGGFGAIMHELTEGGKFLS
FT                   SQEPIFNANIFKTSVFLLIVGGGLNTFSSYISSQDIVQRFTTTTDIKQLKKMTYGNLVL
FT                   SLFVATVFYLIGTALYVFYNQNPQLLQTAQQDQIFASYIAFQLPVGITGIVLAAIYAAA
FT                   QSTLSTGLNSVATSWTLDIQNFITKDMSMEKQTKVAQYISLGVGIASIIMAVILANGGV
FT                   NSAYEWFNGFMGLVLGVLAGIFVLGIFFKKATKAGAYAGFIASAIAVVVCKYGGFDVSI
FT                   WSYSIISIGVSVIVGMIVSLMTQSQLVDKKTLNEATVYYNESEIANS"
FT   gene            214476..214928
FT                   /locus_tag="CPF_0180"
FT   CDS_pept        214476..214928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0180"
FT                   /product="conserved hypothetical protein subfamily"
FT                   /note="identified by similarity to GB:CAG20668.1; match to
FT                   protein family HMM PF04074; match to protein family HMM
FT                   TIGR00022"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82662"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPA5"
FT                   /protein_id="ABG82662.1"
FT                   /translation="MIFGNLINLESYDYLPKLVKEALLHAKNNNVIEFEPGTHEIKGEE
FT                   LFFNRVNYTTKNKEDRFWEGHKKYIDVHVVFSGRERIDLNFKENLEFKEFVEKDDFLSF
FT                   DGKENSTVVLEEGDFLICYPEDIHMTCLKADNEPSDVKKAIYKVIL"
FT   gene            215084..215971
FT                   /locus_tag="CPF_0181"
FT   CDS_pept        215084..215971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0181"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84621"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUX8"
FT                   /protein_id="ABG84621.1"
FT                   /translation="MGLFAVIDIGGTSIKYGVINEDGTLLETNDRDTEAYKGGLSIIDK
FT                   VKDIIHEIKINNDISGICVSTAGMVCPKEGKIVYAGPTIPNYTGVEVKKILEEEFNLPC
FT                   FVENDVNCAALGEFFGGAGKGTHSMACLTIGTGIGGALIIDGKVLHGFSNSAGEIGYMM
FT                   VNGENIQDIASASALVKNVALRKGVEPSSIDGRYVLDNYENGDLICKEEVEKLADNLAL
FT                   GISNIVYLINPEVVVLGGGIMAREEVFRPLIENSLRKYLIESVYNNTKIAFAKLKNTAG
FT                   MKGAYYNFKENFNK"
FT   gene            216162..217001
FT                   /locus_tag="CPF_0182"
FT   CDS_pept        216162..217001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0182"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83985"
FT                   /db_xref="GOA:A0A0H2YSL4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSL4"
FT                   /protein_id="ABG83985.1"
FT                   /translation="MGILEQLENPKFKATKSEKTLIEYIKSDLDNIIYKSISIIAKESG
FT                   VGEATITRFTKKLGFNGFQDFKVTLAKEISNKKNTSIINLHVHRDESVTETANKMLKSS
FT                   INILEQTVKQIDLDLMCKCRDLIMNAKRVYFIGIGYSGIAATDINYKFMRIGFTTVPVT
FT                   DSHTMVIMSSITNDDDVIVAISNSGTTKEVIKTVKQAKENGTKIITLTEDSDNPLRKLS
FT                   DYELTYTSAETIFETGSISSKIPQIFLLDLLYTEVIKEMFSEAVEKKIKTTSAILND"
FT   gene            complement(217188..217577)
FT                   /locus_tag="CPF_0183"
FT   CDS_pept        complement(217188..217577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0183"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82674"
FT                   /db_xref="GOA:A0A0H2YQ27"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ27"
FT                   /protein_id="ABG82674.1"
FT                   /translation="MKKGNVRTLDGIIYSLFIFMTIVTLFIIYRDIPSNAVLNFVTAYA
FT                   IFAILIPLYILVRVLFTVKHFTFEEVKKEGVKFLMFFIGIMMLNLVGDFLLPLPDLKLS
FT                   KMLPSSLGFAFGITCFDIVLSKRTK"
FT   gene            217840..222723
FT                   /gene="nagH"
FT                   /locus_tag="CPF_0184"
FT   CDS_pept        217840..222723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagH"
FT                   /locus_tag="CPF_0184"
FT                   /product="hyaluronoglucosaminidase"
FT                   /EC_number="3.2.1.35"
FT                   /note="identified by similarity to SP:P26831; match to
FT                   protein family HMM PF00404; match to protein family HMM
FT                   PF00754; match to protein family HMM PF07554; match to
FT                   protein family HMM PF07555"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83307"
FT                   /db_xref="GOA:A0A0H2YRL1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="PDB:2LS6"
FT                   /db_xref="PDB:4TXW"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRL1"
FT                   /protein_id="ABG83307.1"
FT                   /translation="MNKNIRKIITSTVLAAMTISVLPSNLVVFATDGITENFYEIYPKP
FT                   QEISYSGGEFQISDEINIVYDDGIDTYTKKRVDEVLEASNLEATVSNEIVPGKTNFLVG
FT                   INESGGVVDNYFNKNIPHDESFFDEKMDANIVSVKDGVIGVIAEDTDSAFYGVTTLKHV
FT                   FNQLEEGNEIKNFRADDYAEVAHRGFIEGYYGNPWSNEDRAELMKFGGDYKLNQYVFAP
FT                   KDDPYHNSKWRDLYPEEKLSEIKKLAQMGNETKNRYVYALHPFMNNPVRFDTEENYQND
FT                   LGVIKAKFTQLLENDVRQFAILADDASAPAQGASMYVKLLTDLTRWLEEQQSTYPDLKT
FT                   DLMFCPSDYYGNGSSAQLKELNKAEDNVSIVMTGGRIWGEVDENFANNFMNNISTEGHP
FT                   GRAPFFWINWPCSDNSKQHLIMGGNDTFLHPGVDPSKIDGIVLNPMQQAEANKSALFAI
FT                   ADYAWNIWDNKEEADENWNDSFKYMDHGTAEETNSSLALREISKHMINQNMDGRVRPLQ
FT                   ESVELAPKLEAFKQKYDSGASIKEDALELIEEFTNLQKAAEYYKNNPGNERTRDQIIYW
FT                   LNCWEDTMDAAIGYLKSAIAIEEGDDEAAWANYSEAQSAFEKSKTYGFHYVDHTEYAEV
FT                   GVQHIVPFIKSMGQNLSVVIGSIVDPNRIIATYISNRQDAPTGNPDNIFDNNASTELVY
FT                   KNPNRIDVGTYVGVKYSNPITLNNVEFLMGANSNPNDTMQKAKIQYTVDGREWIDLEEG
FT                   VEYTMPGAIKVENLDLKVRGVRLIATEARENTWLGVRDINVNKKEDSNSGVEFNPSLIR
FT                   SESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKN
FT                   GGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNME
FT                   NINKWLTFSEFAIVSDELESAGNKENVYTNTELDLLSLAKEDVTKLIPIDDLSLNHGEY
FT                   IGVKLNRIKDLSNINLEISNDTGLKLQSSMNGVEWTEITDKNTLEDGRYVRLINTSNEA
FT                   VNFNLTKFEVNSNEVYEPSLVDAYVGDDGAKKAVDGDLKTRVKFLGAPSTGDTIVYDLG
FT                   QEILVDNLKYVVLDTEVDHVRDGKIQLSLDGETWTDAINIGDGVENGVDDMFSTPLKNG
FT                   YKHGNQSGGIVPIDSAYVEGDNLNQKARYVRILFTAPYRHRWTVINELMINNGEYIPTV
FT                   NDPTYISNPIEERGFAPSNLRDGNLTTSYKPNTNNGEISEGSITYRLSEKTDVRKVTIV
FT                   QSGSSISNAKVMARVGDGSENVTDQWIQLGTLSNSLNEFINRDYNNIYEIKIEWTDVAP
FT                   NIYEIITLNQEFEFPVNDSLKAKYDELINLSGDEYTLSSFETLKEALNEARNILDDSNS
FT                   SQKKIDKALENLNKAEERLALRATDFEDFNKVLTLGNSLVEGEYTAESWALFSEVLEAA
FT                   NEANKNKADYTQDQINQIVIDLDASIKALVKETPEVDKTNLGELINQGKSLLEEAVEGF
FT                   NVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINSSKESLEGAIARFNSLLIEESTGD
FT                   FNGNGKIDIGDLAMVSKNFGSTNTSLDLNKDGSIDEYEISFINHRILN"
FT   gene            223602..224345
FT                   /gene="cbiM"
FT                   /locus_tag="CPF_0185"
FT   CDS_pept        223602..224345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="CPF_0185"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="identified by match to protein family HMM PF01891;
FT                   match to protein family HMM TIGR00123"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83027"
FT                   /db_xref="GOA:A0A0H2YRI3"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRI3"
FT                   /protein_id="ABG83027.1"
FT                   /translation="MSKKNQVFIGFLLMFLLIPRSVSAMHIMEGFLQPKWCIAWGVITI
FT                   PFIVLGLFSIKNKVGNNPRLKILLAMAGAYAFVLSALKLPSVTGSCSHPTGVGLAAILF
FT                   GPTAASVLGLIVLLFQALLLAHGGLTTLGANTFSMAVVGPLVSYGLYKLVKKLNGPTWL
FT                   GVFLASALGDLATYMVTSVQLGLAFPAEVGGVMASVMKFMGIFAVTQVPLAISEGILTV
FT                   IIFNTIENYAKEDLMELNIFSKGVK"
FT   gene            224345..224656
FT                   /gene="cbiN"
FT                   /locus_tag="CPF_0186"
FT   CDS_pept        224345..224656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="CPF_0186"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02553;
FT                   match to protein family HMM TIGR01165"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84248"
FT                   /db_xref="GOA:A0A0H2YUH9"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH9"
FT                   /protein_id="ABG84248.1"
FT                   /translation="MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQ
FT                   IDENYEPWFSPLFEPASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR"
FT   gene            224640..225410
FT                   /gene="cbiQ"
FT                   /locus_tag="CPF_0187"
FT   CDS_pept        224640..225410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="CPF_0187"
FT                   /product="cobalt ABC transporter, permease protein CbiQ"
FT                   /note="identified by match to protein family HMM PF02361;
FT                   match to protein family HMM TIGR02454"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84632"
FT                   /db_xref="GOA:A0A0H2YUY7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUY7"
FT                   /protein_id="ABG84632.1"
FT                   /translation="MINIDKYAYASKLKNINPAEKMFFALITLCVCLWANNFIVSMLII
FT                   SIMTFLITKVGRTKIRVFIKLMMVPIAFLIIGILTIVVSYSLKQDTFLVSFKLFNGWIG
FT                   VSKSGIIQGLNMFLKVMGSLSCLYFISLTTPMIDVISVLAKLKVPSFLIELISLVYRFI
FT                   FIILETSEMMFISQNSRLGYRDIKTSYKSLGALASTLFIRSFKRANDLYTALEARGYNG
FT                   ELKVLEEQVQKRNYIYIITIIINLIFIGIAIFIK"
FT   gene            225425..226282
FT                   /gene="cbiO"
FT                   /locus_tag="CPF_0188"
FT   CDS_pept        225425..226282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="CPF_0188"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q05596; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR01166"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82220"
FT                   /db_xref="GOA:Q0TUN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3GFO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUN8"
FT                   /protein_id="ABG82220.1"
FT                   /translation="MEDYILKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVGK
FT                   STLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDV
FT                   SFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVL
FT                   ILDEPTAGLDPMGVSEIMKLLVEMQKELGITIIIATHDIDIVPLYCDNVFVMKEGRVIL
FT                   QGNPKEVFAEKEVIRKVNLRLPRIGHLMEILKEKDGFVFDELDLTIGQARKTINSWKNK
FT                   IFND"
FT   gene            226838..227035
FT                   /locus_tag="CPF_0189"
FT   CDS_pept        226838..227035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPI7"
FT                   /protein_id="ABG82402.1"
FT                   /translation="MILKIKKGEYDKMFTNELKDLLAGLYQKYGCTQEVLQLSNIIDEI
FT                   IVKEQRERLKEYYKSRKNNI"
FT   gene            complement(227239..228102)
FT                   /locus_tag="CPF_0190"
FT   CDS_pept        complement(227239..228102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0190"
FT                   /product="5'-nucleotidase, lipoprotein e(P4) family"
FT                   /note="identified by match to protein family HMM PF03767;
FT                   match to protein family HMM TIGR01533"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83229"
FT                   /db_xref="GOA:A0A0H2YQI1"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQI1"
FT                   /protein_id="ABG83229.1"
FT                   /translation="MRNSKITAIVLSAIIGIGVGTGGTLVYENNQEAKQISKLEQTTKA
FT                   NAVEEIVKGNVLATLWQQNSGEVKALRYEAYNSGKRYVDELVKEPTAKPYAVTLDIDET
FT                   IIDNSPHAGYEIKHNELFSKENFGEWVQMADAAAIDGAKDFTDYAKSKGFEVFYVSNRS
FT                   EEKELDATIKNMQKLGFVNSDKDHILLKTDTSSKDARWDKIKENYNLAIYCGDNLGDFP
FT                   DGYDNKSNEQRREIVDKEAQFFGTKYIVLPNPTYGDFENAVYGYDFKKSPEQKLEDRLN
FT                   SIKSFK"
FT   gene            complement(228325..229524)
FT                   /locus_tag="CPF_0191"
FT   CDS_pept        complement(228325..229524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0191"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84750"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI2"
FT                   /protein_id="ABG84750.1"
FT                   /translation="MNKLKIVSLFMSSFLMISAFSAPLITKANPEVNKLQEEKKQITEE
FT                   KEIKKGKLDEIKDSIDAKQAELNSAQAKVTEYEEKIKTLNNEISSTDSEISKVEKSIEE
FT                   NTTEIEKAKKEQELKQEILGERLRNVYKSNLNDKFLYMILESKNFGELFSNIANIRTLV
FT                   KTDNKLIEEIEALKNELEVRQAELETSKSTLASKKAELLSKEKSLNEVKAEHENTLNTY
FT                   KSQLNELEELEAEKNAELKELADREDEIEKEIQSYFTKTPSTASPTSNSSSGFIRPVAS
FT                   STITSSYGPRVHPVTGQYKVHTGVDFAASTGTPFVAAKDGVVTAAEYHPAYGNMVIIDH
FT                   GGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPHAHFEIRINGQHVNPMDYI
FT                   "
FT   gene            230210..230866
FT                   /locus_tag="CPF_0192"
FT   CDS_pept        230210..230866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0192"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82672"
FT                   /db_xref="GOA:A0A0H2YPB3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPB3"
FT                   /protein_id="ABG82672.1"
FT                   /translation="MARKSSKKYLKEANAQIILFVLIMIIMRMVVLNFMSEISGIEFDE
FT                   LSKARIYNGDITATLFLESLVNFFGNFILETYKGIILLAIINVFIASYILTKKDFTGNS
FT                   YFNMVIAYLFSAIITVFLLLAGIILFFGIMQCMVVINSLKIDVSSEILWLAISVLVGVV
FT                   FIKYFRKSVVFSLFAFLIISVYASYYTDIGKKAINTDYAQYSLEEFANNLNLVGE"
FT   gene            231430..232947
FT                   /gene="rrsD"
FT                   /locus_tag="CPF_3007"
FT   rRNA            231430..232947
FT                   /gene="rrsD"
FT                   /locus_tag="CPF_3007"
FT                   /product="16S ribosomal RNA"
FT   gene            233133..236037
FT                   /gene="rrlD"
FT                   /locus_tag="CPF_3008"
FT   rRNA            233133..236037
FT                   /gene="rrlD"
FT                   /locus_tag="CPF_3008"
FT                   /product="23S ribosomal RNA"
FT   gene            236090..236207
FT                   /gene="rrfD"
FT                   /locus_tag="CPF_3009"
FT   rRNA            236090..236207
FT                   /gene="rrfD"
FT                   /locus_tag="CPF_3009"
FT                   /product="5S ribosomal RNA"
FT   gene            236219..236294
FT                   /locus_tag="CPF_0193"
FT   tRNA            236219..236294
FT                   /locus_tag="CPF_0193"
FT                   /product="tRNA-Phe"
FT   gene            236809..237438
FT                   /locus_tag="CPF_0194"
FT   CDS_pept        236809..237438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23932.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82373"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNT8"
FT                   /protein_id="ABG82373.1"
FT                   /translation="MKDIVIIGTENIGKEVVKIIEAINSKRNTWNVLGFISLKKDEAGS
FT                   NIEGYSVLGSIDSMFNYFEGRKKDKFYFFKKLESQNELFTIIAIDNCKLKKEIENKLKN
FT                   KIKFATIIHPDVTFFNKQEVGEGTIIYPGLISVGRFKLGKHVILKQKCSLGNNIEIGDY
FT                   SFISFNSNIDSNVMVKEGSYIEANTTILANSNIDKNTYIKEGSILY"
FT   gene            237945..238214
FT                   /locus_tag="CPF_0195"
FT   CDS_pept        237945..238214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97348; match to
FT                   protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82817"
FT                   /db_xref="GOA:A0A0H2YQG8"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQG8"
FT                   /protein_id="ABG82817.1"
FT                   /translation="MNAEKKKALQCLKTAKGQIEGIIRMIEDERYCIDISNQVMASQAL
FT                   LKKANKLILQQHMHNCVKSAFENNESKDEKIEEILSVLNKLIDK"
FT   gene            238273..238425
FT                   /locus_tag="CPF_0196"
FT   CDS_pept        238273..238425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTT0"
FT                   /protein_id="ABG83954.1"
FT                   /translation="MFLEFQFSLVESLKANLGCSILINYSNDLLNFIKVKLFRSVVFGD
FT                   SNFFI"
FT   gene            239731..240312
FT                   /locus_tag="CPF_0197"
FT   CDS_pept        239731..240312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0197"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82608"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPX2"
FT                   /protein_id="ABG82608.1"
FT                   /translation="MENLLKDYSNEEVLKALKIVTELKLEREQGDLPEFIRGRVSEVSE
FT                   DEFDLIQAYNYYMRELRRGSVLLSEEETEKCGFNSRLAIDVELKDLIIFLNTQPNIKTL
FT                   YSCSGHQFVRGQITFEGLLKFPQVDDFKIEYADERDETKVSFDIPERSYDYLNKLRKLY
FT                   NYFYLINYNNLKTLTRDEVSAIKIKENCTA"
FT   gene            complement(240450..242825)
FT                   /locus_tag="CPF_0198"
FT   CDS_pept        complement(240450..242825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0198"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83399"
FT                   /db_xref="GOA:A0A0H2YQW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQW9"
FT                   /protein_id="ABG83399.1"
FT                   /translation="MDNPIFFHIFNDDKNKLETQRIIKLSIFIVFSIFFILLIDLSYKV
FT                   LIRKNIEFIPGNSMPSFSLSLSLILGTMAYISSLIYYSSTKKDDFFIISLIYMNLSVEL
FT                   LITKGHNLIIFDKFIFIHAIFRIILLFYVAFNKKGISPLITKHKIITSIVVFLFSVITP
FT                   MINYRIFSNNLFAKDIYFYATLMTMIIILYIIACIFLSKKSLDDCELIYSFIIASILLI
FT                   ALRGLYWICEVLLPNITLLKTNNVVLLLTILSFLLAISGVFNEITAKNKRSSLLQNELQ
FT                   VFYHLVEFNTSSSIILYDNKKKVIYTNKTIRERYCKSTKLKDQLKEVEKLFVDSIFIDD
FT                   SEKNATKALFNKGNWEGKLILKNGKIVSAYIQILNVENKNYFAVNLKDITEEYTLTKNI
FT                   KRNEQLLSCINNNVQDLIISVDNNGLITYVNDSVLKTLNYTYEEIIGMPIINLLGKNDE
FT                   ILNQLKLEDEEDSIKCKLVGKHSFVYVESIIRTLNDNNEIPYGKVIVAKNLTSKKRLEN
FT                   LAIKFKEAKAYEQIRNEFFANISHELRTPLNIIYSTIQLLNSKHETDPMDFNNFYDKYK
FT                   QGLKINCYRMLRLINNLIDVSKIEVGFLKADFTNRDIVFLVENIVSLVIPHSENKDINI
FT                   IFDTNVEENIIKCDPVKIERLILNLLSNAIKFTQNHGEIFVDLNISKDWVKISIKDNGI
FT                   GIPKEMQASIFDRFVQADKSLKRRNEGSGIGLSIVKSIAELHDGKIELISDGIKGSEFI
FT                   VWLPNVKLNYTEESNNLVDYITDDKNIELELSDIYEVH"
FT   gene            243192..244250
FT                   /locus_tag="CPF_0199"
FT   CDS_pept        243192..244250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0199"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83195"
FT                   /db_xref="GOA:A0A0H2YQM2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQM2"
FT                   /protein_id="ABG83195.1"
FT                   /translation="MNTVLKQRKRLDYLDIAKGLLIISVVLCHSPFENAYYLYWFHMPA
FT                   FFIISGMLYKRGMNIKEQAIKFFVPYAIFSLIDISFNYIMYYHGNFSLGDLIHEIIKYA
FT                   YGGKATWGVFWFIPVMFVTKVVFDQLNKRLTSKKLAFVCILSYILAHIYSMSFIPSSVT
FT                   EITENQFVFWNLDTVLITLPYYALGYYITKLNIQRVFKETSTLILSSIGVVAMFILNSS
FT                   IGIYYYLNIKYSYYKDPIFDILMPVTITIFILSLSYQISKFKYKKLFTIIGANSLVIMY
FT                   LHKQVATLFMDVFNYGYIMFTIIGVCLPLLMMVLINKSIVSKFLFNGDLTFYRKIKDIK
FT                   DIEPKDIIIDNK"
FT   gene            244351..244578
FT                   /locus_tag="CPF_0200"
FT   CDS_pept        244351..244578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO91513.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNW4"
FT                   /protein_id="ABG82413.1"
FT                   /translation="MLRREKACIKEFYLNNRRGLVDTNGCVYLDGRYAGILKPSGAIYI
FT                   EGRRGFIKKNGDIYLDGILIGTLNNYSIVY"
FT   gene            244718..245599
FT                   /locus_tag="CPF_0201"
FT   CDS_pept        244718..245599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0201"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82526"
FT                   /db_xref="GOA:A0A0H2YQ88"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ88"
FT                   /protein_id="ABG82526.1"
FT                   /translation="MAMERKNFNNYKEVSLLIMLIPMLFILIDTLGRMNSKINNKNLFE
FT                   IIFNEIFLYREVIVKFIIAIVVIFVITKIKIIKEKFILGDFKIIIGYTTLGVISYKFFG
FT                   SAYGLSKSLDVYVMCIIAMIFILSGIREIMSSIDNININIEEKSNFERLVYTRVKYLGI
FT                   IYFIIFAILIAIENLNSIMSSDFIVSLISNYNQHYNNMARVISVLGVVLIVALILIIKK
FT                   SFSNLNLCYEEYIYIIKHKTVTEEIKKDIDFVNLKVEANKKYINNKFKKLEDKKAQVLL
FT                   KGIFDLFKDNKH"
FT   gene            245609..247825
FT                   /locus_tag="CPF_0202"
FT   CDS_pept        245609..247825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU71"
FT                   /protein_id="ABG84372.1"
FT                   /translation="MLRGESMESKKSTNFDFILKTSIESYYDLLKNAEKAWETHAALTY
FT                   IALRMVVEDLLIKLEEKYEINRDKEANFKNTLNNLKEYVPSWIIEYGEYIRIKGEKSAN
FT                   KEIDSNLEENSTLLALKKVHEILIWYLKNVTKEMSLEADYSFITPESIKESECDLAIDK
FT                   KVLENKEKFIISLEKQIKTNSDDEKKQEELEELLRNVKEEKKELTEKLEKKELELQEVL
FT                   NSFKELQVKLTTYIEKDQSAEESNNKYPDFYKGFLSLQGYELRVVYAFLKSLSLGSIFL
FT                   NKSKSIFLKSQRKEFLKFIEKEVEDLKKYSDGILKLKLYYILLKLTNTPVASVADKETF
FT                   DKSLDSIVEKAYFIIESRNGFNGKVDKLEAIINYYLIVIMNSLSAEINHEEDNKDKVSD
FT                   IIYEVLRTIPLDERKIILNKMNFTDISEGAIKENIRLNQVEFLKAALDCGISESSEFVI
FT                   RSVFSIYVAFQKDFDFYEFRTRHDMLRAYIGPLLLVILLKEFKISRENLVPIFVMEISI
FT                   SNKILRKERREKIYYNQLVQAWLEEKEKYDKILSEKNNLEKNLKEVQEARELLLTNERK
FT                   FVAEKDNTENAIKSQWDMFKEKALQSEEIKSFNSYEEYIRAINQKNLIEVSEEHSLKDR
FT                   GIIKNFFSLDTWKYKLNKLEISKNIKVLEEKLIEEAKESGVFENELLTIRELEKILADK
FT                   ESGLEDIRVDLKENSVENEKLNRLISNSNKLMEKFKEDNFDFAK"
FT   gene            248306..249076
FT                   /locus_tag="CPF_0203"
FT   CDS_pept        248306..249076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT00"
FT                   /protein_id="ABG84129.1"
FT                   /translation="MKRFLAVGIIGVLVAGISVFGIEEFKHKRVKGLEAKVFQAKTYIN
FT                   HGDLVNAEIMLNIIKEENLDLKDKNVQEDILEIENSIDSNKDSFRDKPIKNLEDLSVDQ
FT                   KKVELLNIYLENNEFSPDVRSIESAGKEYYIQFRKSKKLPLDKNKDFSNKKGYILKPIR
FT                   TSKRFFEDTCLIFDVEKPYYINKNIYYKFVEMPVSSYFGEDDKEIWYFADLNFNIISKE
FT                   NLEFYMNNKDVLDSNNNILSNYNLTNYIEDEYLY"
FT   gene            complement(249255..250070)
FT                   /locus_tag="CPF_0204"
FT   CDS_pept        complement(249255..250070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0204"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83153"
FT                   /db_xref="GOA:A0A0H2YR91"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR91"
FT                   /protein_id="ABG83153.1"
FT                   /translation="MKFDLSKMYEKLLSWITTNGFKLVIGLILLYIGWKIINKVIKILA
FT                   NIMKSRNVDPTLTSFAEAFSEVSLKVLLVITLMSYVGFDIAGLAALIASAGLAVGLALQ
FT                   GSLSNFAGGVIILLLRPFRVNDFIEASGYSGTVERITVFYTHLVTPDNKEILIPNGTLA
FT                   NGSLINYSSKDTRRVDLVFSVGYDDDIIKVKNVLWDIINKNELILKTPEAFVGISQHAA
FT                   SSIDFTVRVWTKQEDYWKVHFSLLEEVKLRFDEENITIPYPQMDVTLTK"
FT   gene            complement(250644..251288)
FT                   /locus_tag="CPF_0205"
FT   CDS_pept        complement(250644..251288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0205"
FT                   /product="heme oxygenase"
FT                   /EC_number="1.14.14.18"
FT                   /note="identified by match to protein family HMM PF01126"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84805"
FT                   /db_xref="GOA:A0A0H2YUM0"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUM0"
FT                   /protein_id="ABG84805.1"
FT                   /translation="MNSFMMDIKNNSNDLHAVAEKTGFLKRLLEGKASTESYAEYLYNL
FT                   YEVYNAIEVNLEKCKDNKVVKDFVLPEIYRAEAILKDLKFLLGENLNTMKPLASTRAYV
FT                   ARINEIGETAPELLVAHAYTRYLADLFGGRTIYGMVKDLYKIDEEGLNYYKYETLSDGP
FT                   EMKGFVMNYHNKLNNIELNEEMKERFINEVANSYVYNIAISNELDFIRFNR"
FT   gene            251689..252912
FT                   /locus_tag="CPF_0206"
FT   CDS_pept        251689..252912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0206"
FT                   /product="putative nuclease SbcCD, D subunit"
FT                   /note="identified by similarity to SP:P13457; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84867"
FT                   /db_xref="GOA:A0A0H2YUV9"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUV9"
FT                   /protein_id="ABG84867.1"
FT                   /translation="MRILHTADWHLGKNLEGLSRMDEQERFLEDFVHIVKDNNIDLVII
FT                   AGDVYDSSNPPARAEKMFYDTLKKISANGERMTLVISGNHDNPERLVAAGPLAREHGIV
FT                   MVGTPKSIVEVGEYGRNKVLNSGEGFIELDINGEKSVILTVPYPSEKRLNEVLYGAMDE
FT                   TCERIKSYSDRIKLLFDSLKGNFKEDTINLVVSHLFATGAENTGSERNIELGGSFIVDK
FT                   ECFPEEAQYIALGHIHKPMILPGTNKKIRYAGSPLQYNKKEISFEKKCFIVDVKANEEA
FT                   NIDEIKFDVYKPIEVWKCDSIDEAIYKCEENKDRECWVYLEIKTDRYIREDEIKAMKKL
FT                   KGDIIEIIPKITLDEEENDERSFSEKSFEELFTDFYEKERGVKPEEDLLELLLNIVKEE
FT                   GDEENETN"
FT   gene            252899..256417
FT                   /gene="sbcC"
FT                   /locus_tag="CPF_0207"
FT   CDS_pept        252899..256417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="CPF_0207"
FT                   /product="exonuclease SbcC"
FT                   /note="identified by similarity to SP:P13458; match to
FT                   protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83165"
FT                   /db_xref="GOA:A0A0H2YQC4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQC4"
FT                   /protein_id="ABG83165.1"
FT                   /translation="MKPIRLEVKGLNSFIDKQVVEFDKLTERGLFGIFGPTGSGKSTIL
FT                   DGITLALYGDIARKSSNYINTNCDGVYVSYEFQITGNEVKRYRVDREFKRDNKSGGIRN
FT                   KSSKIIDITGGVENVLEEKAKAVTSKCEEIIGLKLDDFMRTVVLPQGKFSEFLKLEGKE
FT                   RRNMLERLFNLRKYGDDLSSKLSFEIRKEKDKMNVLEGQLKGYEGISEEALKAKEEEIK
FT                   EINLSIKSKEELLNKIKKEFEEAEKVWNTQKELYDKRIEEESLVSRSEEIKSFKERVEI
FT                   SNKADKVIVFINNLEDILKEINKEDLKFSELNKKLEELINLREENKLKFEEVAKKKEEK
FT                   LPDLRLKKEKLLESQKEREILFQIKADGVKLKEACKKIFEDRSKCDTKLNSIEENEKRL
FT                   NEELKEKEERKEELFVHEEFKNKINSGLFILNSYESLDKQFNEIKSEEAELKRYIKELT
FT                   EDKEKSEKDLKVKIESLGKTRDKLESLLKETPGDSNSILEKQIKLGEYREKLNKYKEIK
FT                   NSLEESLKTKNNFEEKLKGFENQKLLLEKEVRELKEYINKVKVEELAHKLRENLVDGEC
FT                   CPVCGSTHHELNKVEKINLDESNQKTTLLESKEEKLKELILEFSKIEATLEYENKKIEE
FT                   LNISIEEVGEVNEERLKSLEEEFNTLKDKIEEFNLKKENLEKNLEKLKEEKNNLENIFN
FT                   KAEVILCEKIVREKEIASKVKELDKELKLKISELNSIKNELKIEDIKLENELILKKEKE
FT                   KNLLEKEIRILRTQLEESNKIKDELREKRDELKENYLSQKSLLDGKVEVYREKERMIKG
FT                   ALKGLIDEALPIEKIDIKGLLEDLQLEIDYIEKAYLNLSEEKEKLEKAFNNMNQEMAVT
FT                   KERVNSLNLRKENEEKKVNLALEEEGFKTILEVKGGILFKDEKEKLKILIEEYHNNFIK
FT                   VRANIELLIKKLNGKSLTEEEWTRVLQEKNNTEKELKEVEEIKIRLVTESESIKKKLEE
FT                   QRDILHIKAKQEHKLALLSDLEKLFKGKKFVEFIAANQLKYISIEASKKLKDITNGVYG
FT                   LEVDENGKFIIRDYKNGGAERDASTLSGGETFLASLALALSLSSQIQLKGTAPLELFFL
FT                   DEGFGTLDDNLLDVVMSSLERLHHERLSVGIISHVESIKNRVPVKLILTPAEAGIGGSK
FT                   VKIERS"
FT   gene            256823..258019
FT                   /gene="ackA"
FT                   /locus_tag="CPF_0208"
FT   CDS_pept        256823..258019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="CPF_0208"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82527"
FT                   /db_xref="GOA:A0A0H2YNY0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNY0"
FT                   /protein_id="ABG82527.1"
FT                   /translation="MKILIINCGSSSLKYKLIDMANEKDIIEGIVERIGLDQSRLVQKN
FT                   ELREKYILEKEIKDHKEAIDIVLNTLVDSKVGVIESIDEITAVGHRVVHGGERYSSSII
FT                   INEEVIKYLEECSKLAPLHNPANIIGIRACQSLMPNKEMVAVFDTAFHGTLPEKAYIYA
FT                   IDYALYKDHKIRKYGFHGTSHKYVSHKVAETMGKDIKDLKIITCHLGNGASISAIKGGE
FT                   CIDTTMGFTPLAGIPMGTRSGNIDPSIIPFLVEECGYTIEEVSESLNKKSGVLGISGVS
FT                   SDFRDIEDAASTGDKRAQLALDIFHYRIRAEIGSFIVNMGGVDVIVFTAGVGENSPETR
FT                   EECLKDLEFLGLTLDKEKNKVRGKLAEISQADSKIKAYVVPTNEELMIAKETVELIGK"
FT   gene            complement(258066..258824)
FT                   /locus_tag="CPF_0209"
FT   CDS_pept        complement(258066..258824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0209"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84437"
FT                   /db_xref="GOA:A0A0H2YUC5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUC5"
FT                   /protein_id="ABG84437.1"
FT                   /translation="MIFLKSVLIDFYNCCEIPIRAVDNNMNILSEVGYSSFYDYIFNDL
FT                   NLNSKFERSYLKHDHNDSLIITFENNISFYSLFNYKSIDKDLIFIIGPLYLKEDLKNSN
FT                   DDLELYKIPLKTKSCLKYYNSLLKIILDEKLKDNFSISYSPYVGRAIDFIEKNYAEEIT
FT                   IDSLCTEFKINKSYFCNIFKSETGQTFINFLNNYRIEKSKDLLKDLDLSLLDIAHKVGF
FT                   SNQSYYCTVFKKFTGLTPLKYREDNYKKGL"
FT   gene            258971..261202
FT                   /locus_tag="CPF_0210"
FT   CDS_pept        258971..261202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0210"
FT                   /product="cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF05031;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82492"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNM9"
FT                   /protein_id="ABG82492.1"
FT                   /translation="MGRKKINKILGYALVTSMLVGVGADTVYAATNINSGTAIVRSEGL
FT                   RDGIYEANNVTSYVEEGNSTGENMARNAVGEKTKFRIEDGKTLMTVYFNSSLYGFMNNI
FT                   EVSAGGEALKIEENKDDKSITFEVPSPDTKVKIGLFITMMGRKVELFLVNDMNTVNLLD
FT                   EAPTINNAKDISVTQGDAIDLLSGVIGTDKEDSNLKVEISGDTSFIKDGKAEIPGLYPI
FT                   TYKVTDSSGQFDEKTVNVTVNKKTTLGDGSYTLKNTVQYVGQGNMETGNSMARKVLSDD
FT                   SRIDISNGKNTVTLTFNSELYAFLKNFNVTVDGEKVEAEVNKDNRTIKFNIPDLNSDIV
FT                   VSTLVSMMGKEVSFKTTLNYDTAKKLEDNLEDNNKPGNEDSENIPGGNENSGNQDNSGN
FT                   TNSGSNGSANEDKENESEGSSGEIVDANQLKNGIYNIKNDVSYIGDGNQDVGNDMARKA
FT                   LSKNSKLEVKDDKKILTLKFNEEQFSFFKDFRITVNGKDVVATPNEADRTISFEIPSLD
FT                   ADIVVTAFVSVMGRDVSFKTILNKGTLELVSGEDKPAIEEENKSEESNGTSSSNNGSSA
FT                   NEGNSTVTENKVTKGKLYTIENKVVHKSQTGVDMARKYLNKISDLEEIDGKTYLTLTFT
FT                   GQEFMKDHKITVNGKDANYKVVSKNGDSIKLRFEIPNLDADIKVSLYVIPMGRNVEFNV
FT                   ELLKDTKKFVKDFTVSSLPQTGSPIGGNSVALLGMAMMGASMFIRKREE"
FT   gene            261265..261912
FT                   /locus_tag="CPF_0211"
FT   CDS_pept        261265..261912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0211"
FT                   /product="putative iron transporter"
FT                   /note="identified by match to protein family HMM PF05031"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83763"
FT                   /db_xref="GOA:A0A0H2YRW1"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRW1"
FT                   /protein_id="ABG83763.1"
FT                   /translation="MRFLKPVLLVMLTIFISLTGVFGSVDVLANENLENGIYDVKNDVY
FT                   HDSDIGMSMSRSYLNDTMQLKILGDETEYTIGFSGTEYMENFRILVDGNDGNAEIVEED
FT                   KENGTIKLKVKVPNKDSELEAKIYVGPMERDVQFKVIPKFDTLTLVEKLEAPKVENKES
FT                   SNENLSDETGKSEDAISEATGLANNKNMFIYIGGGIIIVALIVSLVIFKRKK"
FT   gene            261914..262477
FT                   /locus_tag="CPF_0212"
FT   CDS_pept        261914..262477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0212"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83509"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRG2"
FT                   /protein_id="ABG83509.1"
FT                   /translation="MRNKLAKGLFILGLVIVSTVLIGKLYKSSVEKKTLEEFKEKFNYS
FT                   EEEKKKTLEEIKNGDGIALIDIEKIGVHTVIAEGSTLDVLENNIGHFENTAMPGENGNF
FT                   SIAGHRNTINNEVFRNIDKLQVGDEIKITTLTDIFQYEINEIFVTSPSDTDVLNQNLDE
FT                   KTMTIVTCTNRGKDRYIVKAKLIG"
FT   gene            262491..263378
FT                   /locus_tag="CPF_0213"
FT   CDS_pept        262491..263378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0213"
FT                   /product="putative iron chelate uptake ABC transporter,
FT                   solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01497;
FT                   match to protein family HMM TIGR03659"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82876"
FT                   /db_xref="GOA:A0A0H2YPX7"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR019957"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPX7"
FT                   /protein_id="ABG82876.1"
FT                   /translation="MFLKKGIALSLICLLGFGVMGCSNNSGESKESLKKENGEEIVVAT
FT                   SVAVTEILDELGVKVSGVPTSSYDLPESTKDAVKVGNPMNPDLEIIKSLNPDVVVSVDT
FT                   LGEDYKKLFTDNNIPSEFIDLTTLEGLKTSISTLGERFNKTEKANEILNELKVKEDEFV
FT                   NLSKEEKKNVLLVFAAPGSMMIATPSSYIGNLVDKVGANNIVKDDKKPFVSYSNEEIVK
FT                   LNPDMVLVMTHGMPEQAKKMAEEKFASDPAWSRIEAVKEGKVYYLENGYFGMSANLKVI
FT                   ESLDKLGEIIYGEK"
FT   gene            263365..264351
FT                   /locus_tag="CPF_0214"
FT   CDS_pept        263365..264351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0214"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83540"
FT                   /db_xref="GOA:A0A0H2YRI5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRI5"
FT                   /protein_id="ABG83540.1"
FT                   /translation="MVKNNKLKSLYIGLSILIVLILMIVSLKLGSIDISFGELIKGLLS
FT                   GSNEGNIGIIKDLRMPRVIIAALVGGNLALAGVLLQAVIRNPLADPQVTGISSGACLVS
FT                   LIFIIFMPASGSIRPIVGFFGGLVSCIVVYLMAYKKELDTMRIVLAGAAINALLGGLSQ
FT                   ILTIGSGVGAGNIQSWISGSLAATSWDEVKILFLYSIIGMGFALILAKSCNVIVLGNKN
FT                   AKSLGFNSDLQMILITVVAVFLGSVSTAIVGIISFVGLVVPHICRILIGSDHRYLIPFS
FT                   IFVGGALVLLADTIGRMLVKPYEIPAGIIMAVIGAPFFLYLLRRSDM"
FT   gene            264352..265131
FT                   /locus_tag="CPF_0215"
FT   CDS_pept        264352..265131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0215"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82223"
FT                   /db_xref="GOA:A0A0H2YN45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN45"
FT                   /protein_id="ABG82223.1"
FT                   /translation="MIRGEKLSFNYKGEKNIINDLNIDIKEGEITTIIGPNGSGKSTLL
FT                   SLLCALNKSKTGHVYLGDINMNNLKYKDIAKILATVHQQNSVPKDIKVEELVAYGRYPH
FT                   KGYFKSNNKEDKNIIKWALECTGLDDLKHKGVMNLSGGERQRAFISMALAQKPKILFLD
FT                   EPTTYLDIFHQIEILEIVKKLNKYNGLTVVMVLHDINQAIKYSHNIVVMKDGKIVKEGK
FT                   SENVIDENLLKEVYKVNGVINKCKETGETYFIPKTIC"
FT   gene            265173..266900
FT                   /locus_tag="CPF_0216"
FT   CDS_pept        265173..266900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0216"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84338"
FT                   /db_xref="GOA:A0A0H2YTI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTI5"
FT                   /protein_id="ABG84338.1"
FT                   /translation="MIDKRLLNLCKESKKYIGLTVLMNWISVICNLMTIIVIGFSIQEL
FT                   FSLGNIENLNKKVLILVGLLGVRFCVNLLSGHFSYKSSEMVKITLRDKIYEKLLKLGMR
FT                   YDKVDSTSSIVQMAVEGVEALEVYFSKYLPQLIYSILAPLTLFCALAFISFKAALVFIL
FT                   CLPLIPISIILIMKIAKKILKEYWGQYSDLGNTFLENLQGLTTLKVFDMDNERHELMNE
FT                   EAESFRKITMKVLSMQLNSINVMDLIAFGGAALGSIVALLQFRAGTVSLGGMIVILLIS
FT                   AEFFIPLRLLGSYFHIAMNGIAAADRIFKVLEADESKVSSDSNLNEISNISLENVSFSY
FT                   DGKREVLKDISLSINKGDYVAIVGESGSGKSTIASLILNNYKASKGKITLNGTDINNID
FT                   FSKLYNRVSIISTNSYIFNGTVRDNLLIAKKDATLEEINYALKKANLLDFVNSKKEKLD
FT                   LEVGEGGSKLSGGQKQRLALARTILANREVIIFDEATSNIDVESENMIWKSINEISKEK
FT                   TVIVISHRLANVKNADRIYMLDKGVLVEEGSHKDLMERKNKYYGMVNYQNELEVGGVI"
FT   gene            266901..268589
FT                   /locus_tag="CPF_0217"
FT   CDS_pept        266901..268589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0217"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84748"
FT                   /db_xref="GOA:A0A0H2YUH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH0"
FT                   /protein_id="ABG84748.1"
FT                   /translation="MRKSGFSIMKRLIVELKPLAPVMFITVFMGVLGFLAAIGITVLGS
FT                   VAISSLIDSTISFSFKTALILMIVLGILRGPLRYGEQLSGHYIAFKILVILRDKVFSAL
FT                   RKLAPAKLEGMEKGNLISMITSDIELLEVFYAHTIAPISIAIITNTIMGLILLSINVKV
FT                   GIVGIIGYILIGFGVPYISSSFGKEAGVQYREAFGKTNSYILDSLRGIKEVLIFNNGNE
FT                   RRGNIKKFSEELNEKQKVIKKHEGIIRAFSDLIIMLTILIALYVAYLEVLKGTMTIGGL
FT                   IIVVTLIASSFGPVVALSNLSNNLLLTFASAQRIFNILDEKPSVEEVLGEGMKVGNNIE
FT                   YKDVSFAYKGKENVLKDVNIDIKLGDKIAVIGESGTGKSTFVKLLMRFWDVTKGEISLG
FT                   NKNVKEIQTKELRKKMALMGQETSLFNMSIEDNIKIGKLDATLDEVKEAAKKAGIHEFI
FT                   MGLEDGYKTKVGELGGNLSSGEKQRIGLARVFLRESEIVILDEPTSNLDTLNEGIILKS
FT                   IRTYLKDKTLILITHRKSTTRVCEKVFRINKGNLIQCEEVKHELA"
FT   gene            268576..268971
FT                   /locus_tag="CPF_0218"
FT   CDS_pept        268576..268971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS11534.1; match to
FT                   protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84298"
FT                   /db_xref="GOA:A0A0H2YTF8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTF8"
FT                   /protein_id="ABG84298.1"
FT                   /translation="MSLLKIFYVILGFISLGLGLIGIILPILPTTPFLLLTAFCFVKGS
FT                   DKFDKWFKGTKIYKNHLESFEKNRAMTLKTKLTILLTADIMLLFPLILSKSIHLKIFIV
FT                   ILMMFKFYYFIFRIKTVKVGEVVEQNR"
FT   gene            268946..269251
FT                   /locus_tag="CPF_0219"
FT   CDS_pept        268946..269251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO79602.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83452"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSK2"
FT                   /protein_id="ABG83452.1"
FT                   /translation="MRLLNRIDKEKEIITLMIKLYCKKKHGSLNGELCNECRELEEYAH
FT                   KRLTYCKFGNEKSSCKKCPIHCYKKDMREKVKEVMKFSGPRILIYNPKEYIRHIFK"
FT   gene            269379..269564
FT                   /locus_tag="CPF_0220"
FT   CDS_pept        269379..269564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0220"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82259"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN86"
FT                   /protein_id="ABG82259.1"
FT                   /translation="MGNIDKDRIVCRCKKVSEGTVIEAIKNGADTYEKVKKETGANTYG
FT                   CFACRLEIKKLLEENK"
FT   gene            269876..271321
FT                   /locus_tag="CPF_0221"
FT   CDS_pept        269876..271321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0221"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83206"
FT                   /db_xref="GOA:Q0TUK6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUK6"
FT                   /protein_id="ABG83206.1"
FT                   /translation="MKPNIVLIMVDQMRGDCLGVNGNEFIETPNLDMMATEGYNFENAY
FT                   TAVPSCIASRASILTGMSQKSHGRVGYEDGVSWNYENTIASEFSKAGYHTQCIGKMHVY
FT                   PERNLCGFHNIMLHDGYLHFARNKEGKASTQIEQCDDYLKWFREKKGHNVDLIDIGLDC
FT                   NSWVSRPWGYEENLHPTNWVVNESIDFLRRKDPSKPFFLKMSFVRPHSPLDPPKFYFDM
FT                   YKDEDLPEPLMGDWANKEDEENRGKDINCVKGIINKKALKRAKAAYYGSITHIDHQIGR
FT                   FLIALSEYGELNNTIFLFVSDHGDMMGDHNWFRKGIPYEGSSRVPFFIYDPGNLLKGKK
FT                   GKVFDEVLELRDIMPTLLDFAHISIPDSVEGLSLKNLIEERNSTWRDYIHGEHSFGEDS
FT                   NHYIVTKRDKFLWFSQRGEEQYFDLENDPKELTNLIDSEEYKERIDYLRKILIKELEGR
FT                   EEGYTDGNRLLKGHPVSTLKHIR"
FT   gene            complement(271479..272816)
FT                   /locus_tag="CPF_0222"
FT   CDS_pept        complement(271479..272816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0222"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00881"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83833"
FT                   /db_xref="GOA:A0A0H2YS89"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS89"
FT                   /protein_id="ABG83833.1"
FT                   /translation="MFGFFSPAPAIPRLPKDKVSSAYKAYRIRMFLMIFIGYTGYYLVR
FT                   KNFAVASPYLIDNYGFSKTQIGLISMGLAVSYGLSKFILGNLSDKSNVKKFICFGLIAS
FT                   SVLSVLMGFARTVPIFLILMVFNGFFQGMGAPPCSIVLGKWFSQKERGLKMGIWNTSHN
FT                   IGGGLIAPIATLCLLIFGQNHFQSIFFVPAIICTIVALFCYVIGADTPASVGLPPVEEY
FT                   RNDYPEVKAEVNPTTLSSKEIMVKYVLKNKYVWYLALANIFVYLIRQGVVNWIPIYLKE
FT                   SKGFSAANANWAMFLFEYAAIPASILLGWLSDVVFKGKRAPLSILCMIGVIFATVAYWQ
FT                   TSSTLVTMISVAFIGCFIYGPQLLIGMNLIDVVPNFAVGSATGFSGLCGYLLGEFMADF
FT                   VLGMIADSFGWNGAFIFIIVGAFIALLLLALTLKIKKNPQVEDKIA"
FT   gene            complement(273017..274036)
FT                   /locus_tag="CPF_0223"
FT   CDS_pept        complement(273017..274036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0223"
FT                   /product="putative iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YW39"
FT                   /protein_id="ABG84970.1"
FT                   /translation="MKKFLNKKITIILTIIILLLIAKLHIIKKEKALSTSNMNHIVVYG
FT                   SLREEEGKYLLEKFKNKYDCTYEYIKLPTEEAVQRILDTRDNPQGDIFIGGSCDGYEIL
FT                   KKYDALEEYNSPWANNIPAKYKDLRGYWTGFQITPLSIGINKSLWQTHFGGSVPYPKKI
FT                   EDLLNPEFKDKIILPNPQTSGTGYTLMASLYQELGKEKFETFIAKLNDNVSSSTISGFN
FT                   SIQRVASGEYLITVNFLSDQLIANRSSDNIISIVPENAGWNVDSIALIKNSKHEKIAKS
FT                   FIDFVLSKETSSDLSKFSKAISTKNFDTNQFKIYDKYNFYLAAEDREKIMQILYKNKE"
FT   gene            complement(274017..274805)
FT                   /locus_tag="CPF_0224"
FT   CDS_pept        complement(274017..274805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS44277.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82713"
FT                   /db_xref="GOA:A0A0H2YPE1"
FT                   /db_xref="InterPro:IPR025031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPE1"
FT                   /protein_id="ABG82713.1"
FT                   /translation="MSKNFKNTLAIYLFFIVIILATYIYYSSNIYDSLTVVKSSQENKG
FT                   DLNIKIPDKIILSNPYLGTTVISNKSELNELLQYFNKICLTNSTKENALPLENTLFISG
FT                   EIHYLNGDKTPFEISNILKLDGESYSNNSSLINMLRNNLKDAFYTVNNLESILSSPDNL
FT                   ITYKEDGTMKNLSKDSKSLLLEDFKSLRLMNDNKDFLKTDLSEIPKHHLTLYRYAKEGD
FT                   ISINTFYIDVYKDYVIIQYLGDENGKNIYLKGNLNEEIFK"
FT   gene            complement(274798..276228)
FT                   /locus_tag="CPF_0225"
FT   CDS_pept        complement(274798..276228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0225"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82744"
FT                   /db_xref="GOA:A0A0H2YP95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP95"
FT                   /protein_id="ABG82744.1"
FT                   /translation="MKNNKIQINLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLIN
FT                   NSIEYLLDKSRTTESYILNLLSSNDSGDKEDIIRDNAPFIASTLSEKYNVRIQIISNSA
FT                   QIIYDSSSDEVSLFGSDINESLDGQTAYIVEKIDNVPTLFLSSPIFYKGKEYGAIRLIL
FT                   INTEAYEILRNTLTIFIISGLIAIVIAIFLINTFAKELVSPLMILKQKSKNISEGKFKE
FT                   ELHITSGDEVEDLANTFNIMSENLDKYINEIKSAKLHQKKFFDNVSHEFKTPLTAIIGF
FT                   SEIIPKLNDKEKIVQSSALIEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYIDVKSLIE
FT                   DCLKILKIKLDNYDIKVYRNYESFFIYGDHDKTKQVFINIIDNAIKYSGCETLSISTKR
FT                   SPNKMEVIIEDDGTGFIIKDEYVNPKGNGLGIKICKDIMQSQNYGFNIESELDVGTKVT
FT                   LSFSIGKNNEIKEEDFNE"
FT   gene            complement(276218..276889)
FT                   /locus_tag="CPF_0226"
FT   CDS_pept        complement(276218..276889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0226"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83543"
FT                   /db_xref="GOA:A0A0H2YST3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YST3"
FT                   /protein_id="ABG83543.1"
FT                   /translation="MKILVVDDEVSILQLIKMNLEIEGHVPITAENALDALELVIKEKP
FT                   DIIILDAMLPDISGFNLIPKIKNIDDIPIIMLTAKSDINDKLLGLQLGADDYITKPFNS
FT                   TELILRINIVGKHISSDSKKKVKDLTVGDLTLLLDERKALIKSEYINLTFKEFEVLRCL
FT                   CQNKNKVFSREELLNKVWGYDFEGTTRAVDILIQRLRKKLGPCQNYIKTLYKAGYKLDE
FT                   K"
FT   gene            277181..278380
FT                   /locus_tag="CPF_0227"
FT   CDS_pept        277181..278380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0227"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84409"
FT                   /db_xref="GOA:A0A0H2YU98"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU98"
FT                   /protein_id="ABG84409.1"
FT                   /translation="MLSYEFLFDLALILISTKLFGLITKKVRMPQVVGALVAGVILGPA
FT                   VLNVLSETEFIQKLAELGVIVLMFTAGLETDINQLKKTGKASFIIAVLGVIIPLAGGFF
FT                   IASIFNKGNDVNTILQNVFIGIILTATSVSITVETLKEMGKLNTRAGNAILGAAIIDDI
FT                   LGIIALTITTSLADPSINVIIVLAKIVMFFIFAGFAGYLFHWAFIKLDERYQRDLRRFV
FT                   IIAFVFCLLLSFCAEEFFGVADITGAFIAGLVISDSNRSKYLNSRFETLSYMLLSPIFF
FT                   ASIGIKVQLTAMTKTIFIFAILLLIVAILSKVLGCALGAKLCKYSNREAIQIGTGMISR
FT                   GEVALIVANKGIAMGLMLPEFLAPVVIVVVVTTIVTPILLKVVFNNKSKSVDLNVKANV
FT                   "
FT   gene            278633..279160
FT                   /locus_tag="CPF_0228"
FT   CDS_pept        278633..279160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN80"
FT                   /protein_id="ABG82328.1"
FT                   /translation="MSKEIIDIEVEEFIPFNDAADMKEFRKFLKQYGIEDALEDTTLDY
FT                   TKKKLEMLLALAEDGEDEELAEHKNILKKLLNNLKGEKVKREAMKALYEVYREYEDLTG
FT                   KECEDLIDSKELDKKIKEALKEYKKYEHFKTHEEQIAEKWIRELKKEAIEYKKQYKELK
FT                   KDIRRDLKRLEK"
FT   gene            complement(279286..279361)
FT                   /locus_tag="CPF_0229"
FT   tRNA            complement(279286..279361)
FT                   /locus_tag="CPF_0229"
FT                   /product="tRNA-Met"
FT   gene            279534..280310
FT                   /locus_tag="CPF_0230"
FT   CDS_pept        279534..280310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT68"
FT                   /protein_id="ABG84205.1"
FT                   /translation="MFTKGFDEAYNRALELQKLFYGEKEKYNEELKNENRDIKHLVNKI
FT                   NEEKIYILETLVPKYAKNMSILERQSIKATLGEEVSSEYIINDYNIRPIKELLLIDYDE
FT                   KSIIKNIKNPFIKVFKINKINKNLDEETMEIQSARDEMKKISQCAQDDKLKLIRIYKLI
FT                   CSATNLGEAIEERFRDFIPMIQSSRLIYGDCNIEKRSYRIGNVMKCYDGIMQFLVKICE
FT                   TKYRSAEGKRVKYIKDSLIDEHLEELDLWKQSFNEI"
FT   gene            280728..282158
FT                   /locus_tag="CPF_0231"
FT   CDS_pept        280728..282158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85009"
FT                   /db_xref="GOA:A0A0H2YW69"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YW69"
FT                   /protein_id="ABG85009.1"
FT                   /translation="MSTISNILKSFLTQNILGYIGVTLILIVICLGFIYNMRVKKKYEN
FT                   LLNAFNESEWINVSNNEDQKELKFLNSELKAMADDFRKSAIKGTYNINTEVIIQKNIEK
FT                   RILKEENIANILPSISIALGLIGTFLGLTVAIMTTTGILSSGTQSMADFSRSMNMPLGS
FT                   MSSAFWTSIVGVIGSIILNCLNINLKRAKEDFYDVFEDYLDNILFSIYIKSDKDVLTDF
FT                   MNKALGSFSIKLDELFNKGINNLVEGINKNTVDMTSTFNGMNKHISDLENIVSYFRVSV
FT                   MGIKTPIKSFGEDLEKFSRVSAEFCNSVNSTNNKFLNKSTRLEESVNELSKAINDNKRE
FT                   INKLCMRLEVQSNEVRRGYNTFNDVFNIIKDEQSRNNKIISNQISKLNDGYREFERGIN
FT                   KFSSNVSNMKNEVANGIYYALQRETQELSSNIVDKLNVPLRDISLATEELSRSTNRNRE
FT                   IGKADSGWKKDSKEIGRC"
FT   gene            282161..282853
FT                   /locus_tag="CPF_0232"
FT   CDS_pept        282161..282853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0232"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83235"
FT                   /db_xref="GOA:A0A0H2YS19"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS19"
FT                   /protein_id="ABG83235.1"
FT                   /translation="MKVRRRKYKTEQEVPSYWPSFVDIMTTVTLVFFFILLTSIGISSI
FT                   FVDNIAVERETVYDKIQGELNQYAVNEEVMNFNREEGKIDIKTETFFDSDSSVLKEDGK
FT                   KLASELGDIFFKLLSNEDIKEKIDYIEIVGHTDFAGSTIHGRELSTERAISFLNEMMPE
FT                   DSELENLHGEKFKASGMSEFENYASKEERDRGYDEYNIEETKKDRRIEVRMVFSNEDLE
FT                   KAIKERKN"
FT   gene            complement(282910..283785)
FT                   /locus_tag="CPF_0233"
FT   CDS_pept        complement(282910..283785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0233"
FT                   /product="prenyltransferase, UbiA family"
FT                   /note="identified by match to protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82348"
FT                   /db_xref="GOA:A0A0H2YNB6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNB6"
FT                   /protein_id="ABG82348.1"
FT                   /translation="MIKYIIKLLRPNQWIKNLFIFGPIIFSNKFLNIDILKNNILTFIA
FT                   FCFISSTVYIMNDIVDVENDRKHPNKCKRPIASGKVSIPAAILIGIILCLTSLAIAFSL
FT                   KFSILFIIIVYLINNIFYSFKIKNLVIIDVFSIALGFIFRVLAGSFATGVLASDWIILC
FT                   TLFLSLFLGFGKRRNEVIFLGENASTHRKNLSKYNLEFLDKVINISLTCTIVFYSIYCI
FT                   LGTSIRFFIFTDILVIWGTIRYYYLMYSSSEGESPTDLVLKDKQLIYLILIWGIFCIIL
FT                   LNLNNYNFYY"
FT   gene            complement(283778..285256)
FT                   /locus_tag="CPF_0234"
FT   CDS_pept        complement(283778..285256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0234"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83664"
FT                   /db_xref="GOA:A0A0H2YSI1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSI1"
FT                   /protein_id="ABG83664.1"
FT                   /translation="MKKNVALSSFLNISLKFLFLLILVESIVHRNLYYKFSITSLVLSI
FT                   IAISLVIFVYFYLKKNYSKKLLFIILLSVGLIFRVLWFLNLDSIPVGDFNRMFICAGEF
FT                   LTGSNYMFRGTSYFARFPHMTATVLYFAIIRNFFSNPLIAIRIINILLSMFNIILLYMI
FT                   SKEIFKDEKKSFWVLLISALYPPMILYNNVYCSENLAMPLLLLSVLMFFKSINNKQNLL
FT                   YLCLSGIFLSLSHLFRPNGYVFIIAYIMYLFLYFKENITVKLKNILVVLVSFIVPFVLF
FT                   STLLIKLNITEYPLWHGTEPPSISMLKGTNITSGGKWNEEDFKVFHDCDENYEKADKKA
FT                   KEIIKDRLINTPKLDLAKFYVSKFSNFWNNGSFAGDYWSEAGLDEAYNKEDYLKMLGKE
FT                   NGNMTIRISEEGVFYIQSFYIILLALSYVGLYKNKSKRKNLIDLLYILFGGMSLQLLLI
FT                   EAQDRYSYPLSWIFIILAMTAFNPKENEEALDYD"
FT   gene            complement(285401..285733)
FT                   /locus_tag="CPF_0235"
FT   CDS_pept        complement(285401..285733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0235"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83594"
FT                   /db_xref="GOA:A0A0H2YRM9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM9"
FT                   /protein_id="ABG83594.1"
FT                   /translation="MNNIYLVFPIMTFFGALGGFFFKKGAENVDNFLSLIFNFKIYIGG
FT                   FFYVTAAILNIFVLKYLPYSIVLPLTAMTYIWTMILAKIALGEKITSNKIIGTILIILG
FT                   SLLIAI"
FT   gene            complement(285726..286064)
FT                   /locus_tag="CPF_0236"
FT   CDS_pept        complement(285726..286064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0236"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82802"
FT                   /db_xref="GOA:A0A0H2YQY2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQY2"
FT                   /protein_id="ABG82802.1"
FT                   /translation="MKNKNLNKGIILIFFSALCTSFGQLFWKIGVDSNLFLLIIGFVLY
FT                   GIGALSMILALKFGDLSIIHPLMCTSYIFALINGSLFLKEHISLVQLLGIIVIITGVIF
FT                   IARGKSYE"
FT   gene            complement(286074..286709)
FT                   /locus_tag="CPF_0237"
FT   CDS_pept        complement(286074..286709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0237"
FT                   /product="HAD-superfamily hydrolase, subfamily IB"
FT                   /note="identified by match to protein family HMM TIGR01488;
FT                   match to protein family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84843"
FT                   /db_xref="GOA:A0A0H2YVD1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVD1"
FT                   /protein_id="ABG84843.1"
FT                   /translation="MNTTKIALFDVDKTLIHGDSMFYLLKYTIKKKPYLSFHLPILFIK
FT                   LLGYKAKIITTTKAKESMFYTLNYLCEGDLSDFFNTMIKPKIYKDALTKIKDLKSKGYY
FT                   ILLISASPECYLKYFEDEDFIDGVIGTKFEFINGRFINKISGLNCKGEEKVSRINTFLQ
FT                   EHDLIIDKENSVAYSDSLSDAPMFSLVKNAYLINSKSSNHEYEILKWK"
FT   gene            complement(287113..289440)
FT                   /locus_tag="CPF_0238"
FT   CDS_pept        complement(287113..289440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0238"
FT                   /product="GGDEF/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84038"
FT                   /db_xref="GOA:A0A0H2YU10"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU10"
FT                   /protein_id="ABG84038.1"
FT                   /translation="MTHRPMLNKIKLFFIVQIILSFLVLAGTLISILVIPSHLPDYFIW
FT                   AIAFSFWVFQCGFSTIFAFRYRISKSSLSTIKLSFILIGSIQILITLATNLFGIFDLPI
FT                   FNTLIIKNFQFLILSLIFIVMIYKLIKDMLKYRVLKDYIIRDSFFTFIPFAFIIYKNSK
FT                   YFISSIYFLDDSVYSLALLNINSLRIFLEGFLIILIFVKTIYLRGNKKSSFLLLIYFYV
FT                   SNLNCYIVSYFNSKLLFSHYLYQGIGIYFICPILLMLSIYHSITEQEKAPDQVLFDDSY
FT                   MNINNSWISITIGIFPVSFSAIDIISSSIASGDFNGIESLVIILLVMILLVCRDVILRK
FT                   DNLRLIASVKRANEIDFLTNMYSRNYFLKKLETINTDYALFFIDIKSFKDINNIFGHVV
FT                   GDKVLVEVANKFKELKLLLGKNVFYCRYSGNEFALISKLDQVDLILKFFRDLENIKIQH
FT                   NSDLIHINFNIGYSLNDSNINLDLLIQETDYALMRAKKLKGPNNSILMYDDNLKTDLEH
FT                   MNILKKDFKNDLLTGKFHLVFQPKVCVKTLKIVGFETLLRWKHDKLGEISPSKFVPIAE
FT                   NLGEISSLDLYVFKKSCEFQRCLIDKGIKLKCSVNLSLNTLKSYEKINEILNIYKEYKI
FT                   PKHLITAEILENVSLNNNAKTISYINLLRENGICISIDDFGTGYSSLSQISNLYFDELK
FT                   IPREFVIDARTPSKLAVIEAISILAKKLKVTSVIEGVENYEDFKLFSSLGFDIVQGYYF
FT                   SKPLTKSEIIDYIKVNINNKIS"
FT   gene            289694..290962
FT                   /locus_tag="CPF_0239"
FT   CDS_pept        289694..290962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0239"
FT                   /product="dnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83673"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT38"
FT                   /protein_id="ABG83673.1"
FT                   /translation="MIDYFKELNIQIDASDNEVKNAYFNMTKKYPPEKFPKEYRVIRDA
FT                   YETLIDKSKRDAYILETFDIEIKNILNEGIDLAKSEKYDLAALNFEKVLKKYPDNSKVK
FT                   KDLAVCLMRGRNYKKSSKILKELVIREPNNIEYYKLLINAYGDNYDLKNLESVLKKSLN
FT                   LKNVEVDFYLKLFEIYNESELRDYTKAIKVLKDGLENKNINSKKYKLYLKFLDLSDRLD
FT                   CKDDFNKGCEALSGIILKDNYEEVKSSILNLLDRILKEFHFKNGVRLTSTALVLIDEKK
FT                   DMETLEKIMDLRRSFLELSRLYEDKSINEDFKKIVFYNAVSKFLKDDIEFNRDFERINQ
FT                   NFFNNFNFENDELVKSIGKLKNDYRNVYLETRKLSDKVLGRYSKVQKIKEEKNVPKEFY
FT                   SNRREGNPVKILFRKVINSFRDK"
FT   gene            290980..291582
FT                   /locus_tag="CPF_0240"
FT   CDS_pept        290980..291582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0240"
FT                   /product="putative co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83032"
FT                   /db_xref="GOA:A0A0H2YRI8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRI8"
FT                   /protein_id="ABG83032.1"
FT                   /translation="MNYEEALKDICEEKKYIDLFEEDRGLKEIKNFIKKIAIQNENMNQ
FT                   GYIEEVYKIASSLEWITTYISKKSEEEELRSKRINKELEIREKRLVKSIISIVDNIKYI
FT                   YDFSQKSNNEVLNEAMNNLLNTVKRAMVNVDILLIDGKETFFDESLHECVSTIWNDERK
FT                   DYEINEVLKFGYIYKGKVERTAQVVVVKNKEDIEWEE"
FT   gene            291570..293297
FT                   /locus_tag="CPF_0241"
FT   CDS_pept        291570..293297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0241"
FT                   /product="dnaK family protein"
FT                   /note="identified by match to protein family HMM PF00012"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83562"
FT                   /db_xref="GOA:A0A0H2YRK3"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRK3"
FT                   /protein_id="ABG83562.1"
FT                   /translation="MGRIIGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIE
FT                   GDEIKVGKKAKNQILLKPELTVAEVKRVMGTENIIQIQGKEYRPEEISALILKKLKEVA
FT                   EYFLGEEVEEAVITVPANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDNLDK
FT                   NGNILVYDFGGGTFDVTILEMFNGVLDVKVSRGNNYLGGKDIDNKLIDHVVNEFNKSTG
FT                   VKLDTSDSRILARLKEGVEEAKKTLSTSKMAEIVLPYISADKDNNPINLEMVLTREEFE
FT                   FNVKEIIDSTEDIVNEALEDANITDNEIDTVLLVGGSSRIPYVRNMLEKRFKGKIARGV
FT                   NPDEAVALGASVQAAIKNDIPVGDSGTIIVTDTCNYTLGVALKGGIFDPIIDRDSKLPA
FT                   NVTKRYCTVMDNQTEVLVSVYEGESRYVSDNTLIDEFILSGIPKADTGKEKIDITFTYD
FT                   LNGILNVSAEILSTGDEISKIMSTKGLSKEEIQDLKEVVSSNENNNELVPWKSANLFKL
FT                   VEPNFRLAERKIPMLPSADREKLQEIMSDMKDAIVDNDKMALMKLDEELTDFLFDFVN"
FT   gene            293315..294049
FT                   /locus_tag="CPF_0242"
FT   CDS_pept        293315..294049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83634"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRR6"
FT                   /protein_id="ABG83634.1"
FT                   /translation="MKNSKEALEGAYNNALDLILNKKLKEGEKLLEKIYGSGNINIDIL
FT                   NLLGIIKYMYCDFYGAKKYWNESLKVSCEDNKASEFIEDIESDDFKLISEKYIYSLNLI
FT                   EDKNYSQAIEVLEEINKGRSELIEVKILLALLYMIIDEKNKAFKNIESALSYDISNYKI
FT                   KEIYNEIKCDLAKDEEKEESEELTFSESILNLVMILNYRINSFYEEELKYRNEEIKSLY
FT                   EEIKNMNLEIESLNTKKEKLSL"
FT   gene            294321..295094
FT                   /locus_tag="CPF_0243"
FT   CDS_pept        294321..295094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0243"
FT                   /product="putative protein-tyrosine-phosphatase"
FT                   /note="identified by similarity to SP:Q54518; match to
FT                   protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84617"
FT                   /db_xref="GOA:A0A0H2YU50"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU50"
FT                   /protein_id="ABG84617.1"
FT                   /translation="MIDIHSHIIPNIDDGSKSLEMSLEMLKRAEESGTKKIIATPHFFK
FT                   GYWTENYNSVKDKVKELNKLAKENNLNIEIYPGQEVFFNNYILEDFKLGDIGTLGESRY
FT                   MLIEFPMDKIYFQKAIDEIYELKIKGITPVIAHPERYVDFINNPEEINQFIDEGYLFQL
FT                   NGGSLTGLFGKEVKKTAELFLENNLYSFIGSDAHSNGNRNTSLKEACEVANSISRGASR
FT                   RFEANGLALLNNEKIVFQGQKVKKKKKGLFSFFKR"
FT   gene            295409..296731
FT                   /locus_tag="CPF_0244"
FT   CDS_pept        295409..296731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0244"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82531"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ93"
FT                   /protein_id="ABG82531.1"
FT                   /translation="MKNNKKISLSIVLASLITVSLVSCGSSSVKEDSTASKTKLEEKAD
FT                   GKVQYGLEELNWDPDNYKALVNVIKEYGKDSKNYDENQKPYAVFDWDNTTIMNDVEEAL
FT                   LAYQLMNLEFKMTPEELDTVMKTNIPKDNFVEKCNNKEGKPVNIDLITEDIVSDYTYLY
FT                   ENYKGFKGNKSLDEIKKEKEYEDFKAKLRYLYSAIGESFSSDVSYPWVTYLFKGMTSEE
FT                   VAKLTEKSNDYWLNEKLGVETWTSSEEIPGKAGIVSVTFDTGLRTIKEQQNLYKTLMKN
FT                   GIDVYVCSASYIDVVREFATNPKYGYELPSKNIYAMELLKTDDGKIKAELNPEYYQTQG
FT                   KGKTETIKKFLVPTHNKGPVITGGDSNGDYYMLSDFDDTKVSLIINRCKGGKIGELCDK
FT                   AIETMGKSDERYFLQGRNNNTGEFIPSEKTILLGEDTEKLK"
FT   gene            complement(296804..297214)
FT                   /locus_tag="CPF_0245"
FT   CDS_pept        complement(296804..297214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34832.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVR2"
FT                   /protein_id="ABG84806.1"
FT                   /translation="MCAVAFVLYQCNIKITEYKRQILTLNNQLSKYKDTTYKKSNNDSK
FT                   KNLIINFNKPEFKYGITLPYTSIFIAPSEESIAISKIKEKSQVKIIDEAEINNEIWYYS
FT                   LLNTESKINCNGWIKKSQFSMLMEDTNNIIGE"
FT   gene            297388..297573
FT                   /locus_tag="CPF_0246"
FT   CDS_pept        297388..297573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS44038.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPM9"
FT                   /protein_id="ABG82890.1"
FT                   /translation="MANLNELELQNLRHLIGAHCTIEKKLECYSEQCTDPTLKNMLKKD
FT                   AQDAKNSKEKLMSFLG"
FT   gene            297586..297834
FT                   /locus_tag="CPF_0247"
FT   CDS_pept        297586..297834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP11869.1; match to
FT                   protein family HMM PF07875"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82239"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN63"
FT                   /protein_id="ABG82239.1"
FT                   /translation="MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDE
FT                   VRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG"
FT   gene            complement(297919..298233)
FT                   /locus_tag="CPF_0248"
FT   CDS_pept        complement(297919..298233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0248"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM06508.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83040"
FT                   /db_xref="GOA:A0A0H2YQD5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQD5"
FT                   /protein_id="ABG83040.1"
FT                   /translation="MFIQKILSYKKIFKINMLFLILCLAINIILFKNLPNKIALQIVES
FT                   GELGNYIPKLFFIFFTPIVISLITFYNYMKTELRVSRSIVPVIVLFILNIIILITNLFA
FT                   "
FT   gene            complement(298370..299101)
FT                   /locus_tag="CPF_0249"
FT   CDS_pept        complement(298370..299101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0249"
FT                   /product="NAD-dependent deacetylase, Sir2 family"
FT                   /note="identified by match to protein family HMM PF02146"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84471"
FT                   /db_xref="GOA:A0A0H2YUF8"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUF8"
FT                   /protein_id="ABG84471.1"
FT                   /translation="MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSANGLFNEK
FT                   LNITFTPEQLVSHSFFERYPEEFFNFYKAKLIYPNAKPNDAHIALAKLEEMGKLKAIVT
FT                   QNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVKPDV
FT                   VLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYFRGKNLVLINKSSTQA
FT                   DSKADLVINDSIGKVLGKVID"
FT   gene            299317..300459
FT                   /locus_tag="CPF_0250"
FT   CDS_pept        299317..300459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ66620.1; match to
FT                   protein family HMM PF04313"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82751"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPH6"
FT                   /protein_id="ABG82751.1"
FT                   /translation="MAFKDDIQKLSVQVKERKEYITNEEMTKQALIIPFIQILGFDVFN
FT                   PIEIRPEYSADFGIKKGEKVDYALFKENEPIIFIEAKSVNENLNNHDAQLARYFNSTKE
FT                   VKLAILTNGIEYKFFTDLNANNVMDDTPFLNINLLEIKESDIESLNKLRKENFDKDSLI
FT                   TYAEELVYTSTLNESLRRLFSNPSDDFVRFIVKDFSEMRITSNVIERFRPLVKKAISNA
FT                   VLDIVSKGLYQQETLTIKKEENINNDSVNREDLSEIEIGNKVQKGIITTENELKGFNIV
FT                   KDILEKNNRDISEINYKDTTNYFSVYLRNTTRWIIRFNLDASKKNVMTKLPVEYAKNIC
FT                   PNKEIEQAPKGIGESRVYINSIDELYDLEKYLVDAYDNVN"
FT   gene            300718..301332
FT                   /gene="lacA"
FT                   /locus_tag="CPF_0251"
FT   CDS_pept        300718..301332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="CPF_0251"
FT                   /product="galactoside O-acetyltransferase"
FT                   /EC_number="2.3.1.18"
FT                   /note="identified by similarity to SP:P07464; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84539"
FT                   /db_xref="GOA:A0A0H2YTW3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTW3"
FT                   /protein_id="ABG84539.1"
FT                   /translation="MDLKEIRERMYGQKLYYCNDEDLMREQMKALELLYDFNKTRPSEQ
FT                   DKREKILKKMFAEIGDDCYIEPPFHANWGGKNVHFGNGVYANFNLTMVDDCDIFVGNNV
FT                   MFGPNVTVSAGTHPIHPELRSKQAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAG
FT                   SIVTKDIPSNVVAVGNPCRVLREINENDMKYYYRDMKIDIE"
FT   gene            301576..302058
FT                   /locus_tag="CPF_0252"
FT   CDS_pept        301576..302058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0252"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82287"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP73"
FT                   /protein_id="ABG82287.1"
FT                   /translation="MYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIP
FT                   VDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTMLRSGNCDDLIVLIR
FT                   SIYLDKKKRKLDGKKACKGDDEIMQTAEKLINEEFAVILDIRPEEVKSYIKSHIPQ"
FT   gene            302242..303378
FT                   /locus_tag="CPF_0253"
FT   CDS_pept        302242..303378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0253"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83400"
FT                   /db_xref="GOA:A0A0H2YSF5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSF5"
FT                   /protein_id="ABG83400.1"
FT                   /translation="MKELERLLGRLTIINIKEIIIILVIMIIVLIINKILINNLFKLLM
FT                   RGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGII
FT                   VSFIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFISIIIRLIILLVGIIIIANEFGLTG
FT                   FIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITFRSTR
FT                   IRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTPIESIKNSVNKIENMLK
FT                   KHDKIDKNLIIVSFNELSTYGFGVFIYFYTDEFEYLKYEKLKEEINIKILEILREENVS
FT                   LMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV"
FT   gene            303375..303998
FT                   /locus_tag="CPF_0254"
FT   CDS_pept        303375..303998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0254"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84072"
FT                   /db_xref="GOA:A0A0H2YU54"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU54"
FT                   /protein_id="ABG84072.1"
FT                   /translation="MTIKLEACVGNYKEGKRAEELGANRIELCDNLAQGGTTPSYGTIL
FT                   QCKKDINIDINVIIRPRGGNFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTLDY
FT                   ETTKEFVELAKPLSITFHMAFDEIENKVDALGKLIDLGVDRVLTKGGLDNAFKNKDTLK
FT                   ELVEHAKDKIIILPGGGVTKDNFLELKDYTNARELHGTKIVGNL"
FT   gene            304374..304574
FT                   /locus_tag="CPF_0255"
FT   CDS_pept        304374..304574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82962"
FT                   /db_xref="GOA:A0A0H2YQW3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQW3"
FT                   /protein_id="ABG82962.1"
FT                   /translation="MILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGIV
FT                   ASLIYTLVKRAKIKSDKKLIN"
FT   gene            complement(304695..306008)
FT                   /locus_tag="CPF_0256"
FT   CDS_pept        complement(304695..306008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0256"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07613"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83589"
FT                   /db_xref="GOA:A0A0H2YRM6"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM6"
FT                   /protein_id="ABG83589.1"
FT                   /translation="MLKRLPQEYLIHSILYISFIIFAFFLESPKEILNGLYNIISNSDI
FT                   LITDYISIGGFGATLINSALLGLIFIFLFYITDTKSTGKSIMSLWFLTGFGMFGKNIIN
FT                   IWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPEVHPISGAIMGALVGI
FT                   IVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIWHKGNNI
FT                   LYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSSCYFNMGV
FT                   LCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLASLISISDIN
FT                   SPVTVVCILFSTGLAPISGYYGWPYGIIAGFLHIFMVFNIGELHGGLNLYNNGLASGFV
FT                   AAIIVPVIESLQVTNTKNNLKDSSKRHPISLGIKKEAD"
FT   gene            complement(306226..306522)
FT                   /locus_tag="CPF_0257"
FT   CDS_pept        complement(306226..306522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTP4"
FT                   /protein_id="ABG84457.1"
FT                   /translation="MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMINK
FT                   NSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD"
FT   gene            complement(306730..307407)
FT                   /gene="ung"
FT                   /locus_tag="CPF_0258"
FT   CDS_pept        complement(306730..307407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="CPF_0258"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82389"
FT                   /db_xref="GOA:Q0TUH0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUH0"
FT                   /protein_id="ABG82389.1"
FT                   /translation="MAAEFNNDWDDLLKDEFEKEYYLNLRKFLINEYKTQKIHPSMYDI
FT                   FNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCY
FT                   IPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFIL
FT                   WGRNAISKEALITNSIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQI
FT                   PNI"
FT   gene            307745..310282
FT                   /locus_tag="CPF_0259"
FT   CDS_pept        307745..310282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0259"
FT                   /product="putative beta-N-acetylhexosaminidase"
FT                   /note="identified by similarity to GB:BAA32403.1; match to
FT                   protein family HMM PF00933; match to protein family HMM
FT                   PF01915; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82392"
FT                   /db_xref="GOA:A0A0H2YNF2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNF2"
FT                   /protein_id="ABG82392.1"
FT                   /translation="MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLE
FT                   EKLGQMIMPDFRMWQEEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTT
FT                   LIHDLQEVAINDEDGNLPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGY
FT                   VIGKELNALGVNVDFAPVLDTNNNPENPVIGVRSISSNPELVGKLGKNIAKGIQDQGVA
FT                   ATAKHFPGHGDTATDSHYGLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQI
FT                   EKDTFISKKDGSQISIPATLSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELEST
FT                   KMAINAGIDIILMPTILRNNEDVKKLDYIVNGILDSIKSGEIKEEEITDSAERIVKLKI
FT                   DRGIIDLKNNNASLEEKIKKAKKTVGSVENRNIERRISEEAITITKNEENILPLNPKEG
FT                   EKVLLIAPNESQIHSMKFGINRLIHENSLNNIKLDTYEYNNIGIIDDVLKEKIESSDYI
FT                   IVASLSSNANHLKPGAWNRDLPRSVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVA
FT                   YGFKGMDPTEGDTLFPTKSSGPNIPASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVN
FT                   YYDYGHGITNINSLGNVNISMNKKINLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKL
FT                   EFINGKVEFSGDLQTNIIDNNTLEVLINLEEGSLKANEVNFILEFKAIDKAELTSIEIT
FT                   SSELIDEKGRCFKQKYVISEFSIEDNKEDKPLSPDEDKEDEENNEDLGNSDDNNKDELP
FT                   QTGSGVGKEFIFGLGSLSLLAGIGLKSKRFKRK"
FT   gene            310696..312213
FT                   /gene="rrsE"
FT                   /locus_tag="CPF_3010"
FT   rRNA            310696..312213
FT                   /gene="rrsE"
FT                   /locus_tag="CPF_3010"
FT                   /product="16S ribosomal RNA"
FT   gene            312399..315303
FT                   /gene="rrlE"
FT                   /locus_tag="CPF_3011"
FT   rRNA            312399..315303
FT                   /gene="rrlE"
FT                   /locus_tag="CPF_3011"
FT                   /product="23S ribosomal RNA"
FT   gene            315356..315473
FT                   /gene="rrfE"
FT                   /locus_tag="CPF_3012"
FT   rRNA            315356..315473
FT                   /gene="rrfE"
FT                   /locus_tag="CPF_3012"
FT                   /product="5S ribosomal RNA"
FT   gene            315485..315560
FT                   /locus_tag="CPF_0260"
FT   tRNA            315485..315560
FT                   /locus_tag="CPF_0260"
FT                   /product="tRNA-Phe"
FT   gene            complement(316026..316493)
FT                   /locus_tag="CPF_0261"
FT   CDS_pept        complement(316026..316493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0261"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85033"
FT                   /db_xref="GOA:A0A0H2YV86"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV86"
FT                   /protein_id="ABG85033.1"
FT                   /translation="MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGC
FT                   TTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDETVCKLYDV
FT                   IKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN"
FT   gene            317140..317886
FT                   /locus_tag="CPF_0262"
FT   CDS_pept        317140..317886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0262"
FT                   /product="peptidyl-prolyl cis-trans isomerase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84544"
FT                   /db_xref="GOA:A0A0H2YTX0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTX0"
FT                   /protein_id="ABG84544.1"
FT                   /translation="MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLE
FT                   QAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAFYE
FT                   EHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLG
FT                   SFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNM
FT                   LIQERQQKKYLELIKELREKYGVKLA"
FT   gene            318350..319162
FT                   /locus_tag="CPF_0263"
FT   CDS_pept        318350..319162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0263"
FT                   /product="ABC-2 type transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83735"
FT                   /db_xref="GOA:A0A0H2YS01"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS01"
FT                   /protein_id="ABG83735.1"
FT                   /translation="MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPL
FT                   AMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKK
FT                   VKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAAL
FT                   SRLLSTWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYL
FT                   AVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL"
FT   gene            319180..320352
FT                   /locus_tag="CPF_0264"
FT   CDS_pept        319180..320352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0264"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83461"
FT                   /db_xref="GOA:A0A0H2YS02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS02"
FT                   /protein_id="ABG83461.1"
FT                   /translation="MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSF
FT                   EISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGM
FT                   ENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDP
FT                   DILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEV
FT                   VDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDLEVEYD
FT                   LISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNK
FT                   VNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN"
FT   gene            320366..321649
FT                   /locus_tag="CPF_0265"
FT   CDS_pept        320366..321649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0265"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82851"
FT                   /db_xref="GOA:A0A0H2YQJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQJ8"
FT                   /protein_id="ABG82851.1"
FT                   /translation="MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTY
FT                   RKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTS
FT                   EQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIK
FT                   EKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEI
FT                   RGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVA
FT                   KERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLND
FT                   ITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEY
FT                   YNYLKEEALANTWREKAAILDRLIEKNI"
FT   gene            321668..322903
FT                   /locus_tag="CPF_0266"
FT   CDS_pept        321668..322903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0266"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84807"
FT                   /db_xref="GOA:A0A0H2YUN2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUN2"
FT                   /protein_id="ABG84807.1"
FT                   /translation="MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNG
FT                   NYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLY
FT                   LVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLS
FT                   DDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEH
FT                   FANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDY
FT                   DQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVKLFEYMA
FT                   LGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQ
FT                   KAKDIKELILNS"
FT   gene            322917..324098
FT                   /locus_tag="CPF_0267"
FT   CDS_pept        322917..324098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0267"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84107"
FT                   /db_xref="GOA:A0A0H2YTM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTM9"
FT                   /protein_id="ABG84107.1"
FT                   /translation="MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDV
FT                   SFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELT
FT                   GEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAINI
FT                   NPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKG
FT                   RVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESIEFLVE
FT                   YEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKI
FT                   DSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTWT"
FT   gene            324213..325646
FT                   /locus_tag="CPF_0268"
FT   CDS_pept        324213..325646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0268"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82266"
FT                   /db_xref="GOA:A0A0H2YP55"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP55"
FT                   /protein_id="ABG82266.1"
FT                   /translation="MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELT
FT                   KVINEDGEETAYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEKIK
FT                   SILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSIKKI
FT                   KDNLYVLNLDMYSLNVAFFEAIKSINKPKFVHVYATCLNSVDYEKIKTYMDKGFKVIYD
FT                   FVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILAP
FT                   NAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWFDYKLIEQLAKEREDYEIVL
FT                   IGMDYDGSYDQSNLKDYSNISYLGMIDYKDLINYSRYFDVCIVPFIKNDITDSTSPLKI
FT                   FEYMALEKPIVTTDINECKNYESCLISKDYDEFIRNIDKALKLEVDNKEYFNILRREAE
FT                   ENTWDNRAELIKEAIKNLE"
FT   gene            complement(325782..326435)
FT                   /locus_tag="CPF_0269"
FT   CDS_pept        complement(325782..326435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0269"
FT                   /product="haloacid dehalogenase, IA family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84556"
FT                   /db_xref="GOA:A0A0H2YTY2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTY2"
FT                   /protein_id="ABG84556.1"
FT                   /translation="MLSNIKGVIFDLDGTLVDSMGVWAKIDSDYLTDLGLEVPKNLKEE
FT                   ITHLGFKEVAKYFKKRFNIASSEEEIMKTWHDMAYVEYKNNIKLKSGAREFLEQLKESN
FT                   IKIGLATSNSYPLLEVCLKSNDIFHLFDSITITGEVPRGKDFPDVYLLAAERLGLEPKE
FT                   CAVFEDILPAVKGALSAGMKVFAVEEHTVSEEEKSQIKEIVHEYIDSFNDLLVN"
FT   gene            complement(326518..327867)
FT                   /locus_tag="CPF_0270"
FT   CDS_pept        complement(326518..327867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0270"
FT                   /product="[Fe] hydrogenase"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02906"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83496"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR92"
FT                   /protein_id="ABG83496.1"
FT                   /translation="MNKKYDSLFKELISSYYSEDNFDEKLNDIVKNNFNSKEDAIDVLS
FT                   SLCGVDIDKNSDNIAYDIRKAITTHKIKKNIVDKVSVCTKNCSKESKGKCQSLCPFDAI
FT                   LTDPIDNSKYIDPNLCQNCGICVQVCESGHFLDRIELLPIIDLIKNNETVIAAVAPAIA
FT                   GQFGENVSLDMLREAFIKIGFSDMIEVAFAADMLSIKEAVEFNHHVEKTGDILITSCCC
FT                   PMWVAMLRKCYKDLVKDVSPSVSPMIAAGRVIKKLNKDAKVVFIGPCIAKKAEAREKDL
FT                   VGAIDYVLTFEELKGIFEALKIDPSSMKGVPSIEYTSRGGRLYARTGGVSEAINDVVKE
FT                   LYPDKAKIFKAVQANGVKECKELLNKVQSGELKANFIEGMGCVGGCVGGPKRIVDPSIG
FT                   KKHVDEVAYNSPIKVATHSHTMDEVLLRLGINSLKSFEDKEKISIFEREF"
FT   gene            328002..328148
FT                   /locus_tag="CPF_0271"
FT   CDS_pept        328002..328148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84180"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTT5"
FT                   /protein_id="ABG84180.1"
FT                   /translation="MKYIILTGILALIWMFYMALFTAAAKEDRYFEEEFAKSIKEEGND
FT                   NLE"
FT   gene            complement(328323..328398)
FT                   /locus_tag="CPF_0272"
FT   tRNA            complement(328323..328398)
FT                   /locus_tag="CPF_0272"
FT                   /product="tRNA-Pro"
FT   gene            328565..328855
FT                   /locus_tag="CPF_0273"
FT   CDS_pept        328565..328855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84783"
FT                   /db_xref="GOA:A0A0H2YUK0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUK0"
FT                   /protein_id="ABG84783.1"
FT                   /translation="MKISSIVMLAASFLLIVVGIVLFANKKRFEGENQAGKYSAKYIQS
FT                   NAIGNIFIGFLGTILGVLDNFVNGNSIKIAFVVIIIGGSIVQKLIGNKISK"
FT   gene            329040..330338
FT                   /locus_tag="CPF_0274"
FT   CDS_pept        329040..330338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0274"
FT                   /product="SagA protein"
FT                   /note="identified by similarity to GB:AAF86217.1; match to
FT                   protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82945"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ03"
FT                   /protein_id="ABG82945.1"
FT                   /translation="MKKKIISTVLAATMTFGVGHSVFATPLTDDQKQQMEQSQDKYADI
FT                   NSKIRELEDKIDGLSAKIEPLFFQVEKNKEEISKTEESISTVKVQIEESKKKIEKQQEV
FT                   LGQRIRATYKSGGQANYLTALLDSNGIGDFLSRVQAISKVMGMDKQVIDELTSEKEKLD
FT                   SQVKELEDKTAELNKLNSETQSKIDELNKMKAEQEGAIKDMKAEQEKVVGELAPLERQL
FT                   IEPWTSKINSNSSVNDLNQAVTALRGLRNQIKTPEVDSEAVQAIEKAKDLIETKKAEEA
FT                   VSSAPNRGGDVNSGGSSSSTSNGSSSSNSGSTVAPPSEGAASAVVSYAYQFIGRPYVFG
FT                   ATGPDSFDCSGFTSYVYRNAVGREITRTTYTQINQGRPVSRDQLQPGDLVFTNGVGHVG
FT                   IYVGGGQMIHAARPGVGVIVGPIYNFSSARRIL"
FT   gene            330533..331282
FT                   /locus_tag="CPF_0275"
FT   CDS_pept        330533..331282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23407.1; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83789"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS44"
FT                   /protein_id="ABG83789.1"
FT                   /translation="MDLTLVNENETLDDLQLDGLHLIQKKEGFRFGVDAVLLANFANVN
FT                   RKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKINNIEDKVSFVCG
FT                   DLKDKELNKLMPKFDVVTVNPPYKLNNAGIVNPEDKLAIARHEIMCNLEDVIAVSRRFL
FT                   KDNGRLYMVHRPERLADIFCLMRKYKIEPKRVRMVHPNTKKAANIVLVEGQRDGGAFLK
FT                   WEAPLYVYKDEGGYSEEIDKIYGRESK"
FT   gene            331285..332127
FT                   /locus_tag="CPF_0276"
FT   CDS_pept        331285..332127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0276"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82748"
FT                   /db_xref="GOA:A0A0H2YQ96"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ96"
FT                   /protein_id="ABG82748.1"
FT                   /translation="MSKVYLVPTPIGNLGDITLRALEVLKNVDLIAAEDTRQTLKLLNH
FT                   FEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVVVEKCIEEGI
FT                   EFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPY
FT                   RILDTIDTLKEGLGNRKVAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISGK
FT                   TDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKFSLDI"
FT   gene            complement(332413..332652)
FT                   /locus_tag="CPF_0277"
FT   CDS_pept        complement(332413..332652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0277"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83598"
FT                   /db_xref="GOA:A0A0H2YRN2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRN2"
FT                   /protein_id="ABG83598.1"
FT                   /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEQIIL
FT                   KKYEPACIFCGDARDVVNYKGKNICQKCLDELKK"
FT   gene            333343..333942
FT                   /locus_tag="CPF_0278"
FT   CDS_pept        333343..333942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK78295.1; match to
FT                   protein family HMM PF08876"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82780"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPJ9"
FT                   /protein_id="ABG82780.1"
FT                   /translation="MDINNFNSEQIKVLAEEMSKNSMVSYDDLPKYDLFLSQVIDYLND
FT                   KFTEDKFTNNIVQNYIKSEVISKPEDGKKRGYTKVHLAQLVLLSYMRPLLKTDEIKKVF
FT                   ALAFNDINDRSDDIISWETAYKMFGEVQEESIKRFLEVPLVDNDKIEEIIQVSDIKEED
FT                   RDCIVTFLTVMTLIAQASVVKKVVQKIVNGYHKEEK"
FT   gene            complement(333978..334853)
FT                   /locus_tag="CPF_0279"
FT   CDS_pept        complement(333978..334853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0279"
FT                   /product="putative aldose 1-epimerase"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85066"
FT                   /db_xref="GOA:A0A0H2YVS6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVS6"
FT                   /protein_id="ABG85066.1"
FT                   /translation="MIYTLENQHLKISLSNHGGELHSIKGKKDNTEFLWSGDEAYWKYH
FT                   APILFPIVGKVFNGKYTVDGKTYELPQHGLARVRDFEMIEQTKNSISFELKYSEDTLKV
FT                   YPFKFSLIIKYTLNDINLSIDYIVKNLDNKEMYFSIGAHPAFMCPIENDKFDDYYFEFN
FT                   EKENASIMQLVGPGYFSKEEKPYLKDENIINLSTDLFKNDALVFKNLKSNKISLKSKNH
FT                   KKYLEFDFGEFPYLGLWTKDTGAPFVCIEPWFGHADFDGFNGEFKDKAAIQSLMPNKEF
FT                   HCNYNISFFE"
FT   gene            complement(334964..335986)
FT                   /locus_tag="CPF_0280"
FT   CDS_pept        complement(334964..335986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0280"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84435"
FT                   /db_xref="GOA:A0A0H2YTM5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTM5"
FT                   /protein_id="ABG84435.1"
FT                   /translation="MSQGKHAKKNDSNSQGNTPKKKSKVKIIVLTLFFLLLIGIGLGAT
FT                   YVYSTLNKMDIKKIAQDDKSLGIDESNKDLFQDGILNIALFGVDSREHDNVGRSDSIII
FT                   ATIDTKHDKIKLTSLMRDSYVEVDGHGKTKLTHAYAYGGPTLALKTINENFGLDIKDYV
FT                   TVNFDNLAEIIDDLGGVPINIKPYEVKEVNNYAKNVAEIAGREYTPVSEGEQVLNGAQA
FT                   VGYSRIRYVGDGDYERTERQRNVLDAIIKKLSALKPSEYPETIKKLLPYVETNLTPSKI
FT                   LSIATSVASTGIPPVENMRFPLDGYCKGEMIDGVWYLTFDEAKTKEQIQDYIYKDVNPK
FT                   "
FT   gene            336162..337013
FT                   /locus_tag="CPF_0281"
FT   CDS_pept        336162..337013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0281"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83475"
FT                   /db_xref="GOA:A0A0H2YR50"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR50"
FT                   /protein_id="ABG83475.1"
FT                   /translation="MKKKSKGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIP
FT                   FLMFLMTLVGFSHLNSDAVLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIALAI
FT                   WVSSSGFKAVIKGLNKAYGVKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGD
FT                   FFMKVLEHPEFIYYIWNMLRYVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVITTLG
FT                   WISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK
FT                   DL"
FT   gene            complement(337074..338060)
FT                   /gene="galE"
FT                   /locus_tag="CPF_0282"
FT   CDS_pept        complement(337074..338060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="CPF_0282"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84560"
FT                   /db_xref="GOA:A0A0H2YV81"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV81"
FT                   /protein_id="ABG84560.1"
FT                   /translation="MAILVCGGAGYIGSHMVAELIENNKEVVILDNFEKGHEDAILSGK
FT                   LYKGDLRDRKILDKIFTENNIEAVIDFAAYSLVGESMTEPLKYFNNNVSGTISLLEAMR
FT                   DHNVKYIVFSSTAATYGEPENIPILETDKNLPTNAYGESKLLVEKILKWCDTAYGIKYT
FT                   ALRYFNAAGAHVNGKIGEDHAPETHLIPLILQVALGKRDKIMMFGDDYDTKDGTCVRDY
FT                   IHVSDLASAHSLALERLMNGGESRIYNLGNGTGFTVKEVVEVARKVTGHPIPAEVAPRR
FT                   AGDPAILIASSDKAIEELNWKPKFNSLETIIETAWNWHKNHPNGYEK"
FT   gene            338214..338558
FT                   /locus_tag="CPF_0283"
FT   CDS_pept        338214..338558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0283"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83948"
FT                   /db_xref="GOA:A0A0H2YSD2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSD2"
FT                   /protein_id="ABG83948.1"
FT                   /translation="MNKIVLLGRLVKDPELRYVEGGEKVYTKFTIAVARNFKSSTGERK
FT                   KDFIPIIMWEKKAEIACKYLKKGDLLSVSGRLITRSFEDTEGKRRYIVEVSVEDFKCVN
FT                   FNHDRVDNNF"
FT   gene            complement(338634..339833)
FT                   /locus_tag="CPF_0284"
FT   CDS_pept        complement(338634..339833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0284"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82955"
FT                   /db_xref="GOA:A0A0H2YQ11"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ11"
FT                   /protein_id="ABG82955.1"
FT                   /translation="MKHLNIKDDLFWVGALDPNLRVFDIIMYTPYGTTYNSYVVKGSEK
FT                   TAIFETVKAEFFDQYIARLKDLGVEPSEIDYIVVSHTEPDHAGSIGKILELAPKAKIVA
FT                   SPIAINYIKEIVNGDFESIPVKDGDSISLGNKTLKFMSVPFLHWPDTIYTYVEEDKTLI
FT                   TCDSFGSHYSCEEMFDDLIPNEEEYMEALKYYFDCIMGPFKPYVLKALDKIKGLDIEII
FT                   CPGHGPILRSNPYKVVNLYKEWSTPAPAKEVKKASIFYVSAYGYTKQLAEKIAEGIKST
FT                   GNLDINLFNIIEHDMTELVGEVGSSDAILFGSPTIVNELVEPVRDLMAKLNPVIHGGKI
FT                   AGAFGSYGWSGEAVPRIESRLKELRMKMPVEGLRIKFKPSEEEAQKAFDFGVEIGNALK
FT                   "
FT   gene            complement(340337..343744)
FT                   /locus_tag="CPF_0285"
FT   CDS_pept        complement(340337..343744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0285"
FT                   /product="endo-beta-N-acetylglucosaminidase"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00754; match to protein
FT                   family HMM PF00801; match to protein family HMM PF03644;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82341"
FT                   /db_xref="GOA:A0A0H2YNR1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNR1"
FT                   /protein_id="ABG82341.1"
FT                   /translation="MTNKQKMRKRRRALLCVFAAFAFSFNPLGKIAYATPKQDTSVVNY
FT                   VKTQEETSNSIQNQPISSYWYPEDLLKWSANNDKDAKFNKSTVPLAKRVEKDKLDTIND
FT                   TQNKDVKVVAISIMNANTSGNPSQGSNKFSANTFSYWQYIDKLVYWGGSAGEGLIVPPS
FT                   PDVTDSAHRNGVPVLGTVFFPMTAHGGKMEWLNKFLEKDSNGNFPIVDKLIEVAENYGF
FT                   DGWFINQETEGTEQEPLTPEHAKLMQELIKQFKAKSNGKFEIMWYDSMTKDGDMDWQNA
FT                   LTDKNEYFLLDGDKNKVADSMFLNFWWTYNSLKDKDLLRVSNEKAKEIGINPYDLYAGI
FT                   DVQANGYKTPLRWAHYQRDDQAPFTSLGLYCPSWTYFDAKTPEQFQENESRLWVNEHGD
FT                   PSKATNAQGVDWRGISTYSVEKSAVTSLPFTTNFNMGNGYDFYVDGNKVSTQDWNNRSL
FT                   NDIMPTYRWVISNEENNNVKADIDYTNAYYGGNSIKLSGYLAEGKASTIKLYSSDLTLP
FT                   EGVQFTTTAKANGNTVDMDLVLTFHDGTETTISADKKLGTDWTKLTYDVSPYVGKSIKT
FT                   ISYKLSSPVCVDNFSANLGNITIEIPNSSSKVNISNSKLNDVDFKDGIYAGARLSWSPE
FT                   GNSSDVHHYEIYRVMNDGTKVLLGATPNTSYYVSDLRRNDKETNTNFEVIAVNKNYNRG
FT                   NSQSINMEWPAYPAPTASFKVSNTLIAPGQSVTFTNTSSEVTEEIQWKFPGAKVESSTE
FT                   QNPTVTYEKEGVYPVTLTAKNSSGENVETKTELITVTNAAKDGLVNLSLNKSATASSFV
FT                   NENEAPQYALDGNVKTKWCAVGSAPHTLTIDLGDIKTIGELEISHAEAGGESSGMNTKA
FT                   YSLEVSNDGENFTPVLNVDDNTKAISNDAFPVTKARYVRLNIIQPTQGADSAARIYEVA
FT                   VKGLDGNVDLPPVINPDDSNKPVDPDNPNNPDKPNNPESPDNPGNTDKPVNPDQPGDSE
FT                   KPENPNKPGDTENSGEKPSEPSALVSKEITENSALLSWKAPEKVDLIKEYVIYQDGKEI
FT                   GRVPADKTPLEFLAKDLKPNTKYNFQVSSIDKNGKESDKISLEVTTNKKDNGNLPNTGS
FT                   PIGAGALATTGIALSSAGVYLTLKKKRK"
FT   gene            344115..344420
FT                   /locus_tag="CPF_0286"
FT   CDS_pept        344115..344420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:A96960"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84243"
FT                   /db_xref="InterPro:IPR017016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH5"
FT                   /protein_id="ABG84243.1"
FT                   /translation="MKIVKNLYKEINLEDKCYKFCYRLIESCFKGTTVYGIEVERKDFK
FT                   DSDLINIERDSVDKISPNKDKVEVLVEKLHKYEVSPIHLIDVIGEDVDNCVADFAF"
FT   gene            344469..344870
FT                   /gene="acpS"
FT                   /locus_tag="CPF_0287"
FT   CDS_pept        344469..344870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="CPF_0287"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by similarity to SP:P96618; match to
FT                   protein family HMM PF01648; match to protein family HMM
FT                   TIGR00516; match to protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83299"
FT                   /db_xref="GOA:Q0TUE3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUE3"
FT                   /protein_id="ABG83299.1"
FT                   /translation="MIIGIGVDIIEIERVRQAIQNNKNFLSKLFTEREIDYFISRNMNS
FT                   EVIAGNFAAKEAVSKALGTGIRGFSFKDIEILRNELGKPEVILHNGANLIGNKLVENNN
FT                   SLRVHLSISHNNSSAIAYSVLEGEYYGNM"
FT   gene            344857..346356
FT                   /locus_tag="CPF_0288"
FT   CDS_pept        344857..346356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0288"
FT                   /product="carbohydrate kinase family protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83748"
FT                   /db_xref="GOA:A0A0H2YSP5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSP5"
FT                   /protein_id="ABG83748.1"
FT                   /translation="MEICSSNSIRNMDKDYIEKFNMPSIVLMENAIIKFLENIDLTKES
FT                   FTIISGRGNNGGDALGIARHLLNKGKKVYVHILEKEKEGSVDYKTNLTILEKLGCYING
FT                   ISNNKDLEILKNNIINSEILIDGIFGTGLNKEISGIYFETIKCINENSKFTVSIDVPSG
FT                   INSDDGSICEIAVKANETISFQVYKLGFLNYKSFEYLGDLKIVDIGIPKSIVYKNSDNM
FT                   RFTDREYIRNKFPYRNKYGHKGTYGRSLIFAGHKGFIGAAYMVGQASIKTGAGLVTVFT
FT                   HKDVQSELSIKLNEGMTGTYNSKEEYEEFIGGANVIAFGPGMGNNDLTFEVLNNICNLY
FT                   SGTLVIDADGINVLKRKKSILKEFKGDIVLTPHPGEMARLLGIEIKDVERDRIGIAKDF
FT                   AKENGVTVLLKGYNTIITDGDKVFVNPTGNSAMASGGMGDTLTGIITSLISQGVNSFDA
FT                   AILGAYIHGYIGDELSKENFTVSAMEIIKNIPNKIKELISF"
FT   gene            346417..347010
FT                   /locus_tag="CPF_0289"
FT   CDS_pept        346417..347010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D96960"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84596"
FT                   /db_xref="GOA:A0A0H2YUT0"
FT                   /db_xref="InterPro:IPR014584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUT0"
FT                   /protein_id="ABG84596.1"
FT                   /translation="MKGKRNAILIILLIIILGVIGGLAIYQRTYNLTPEDILEDMFSIE
FT                   SYETEIIYDVKNSRGQFQEKGRIYYDEEVGTKIVLDDREQLFEKDKIIINYVKDEKTYE
FT                   VGRDYDQFYRFMFINELKDLCNEEHEFTYKWNDENEKSEIILEFKNLNGNENFSREVMI
FT                   IDAKKKVPKEATIYDRDDSESVSIKFNNFSKVKN"
FT   gene            347257..347499
FT                   /locus_tag="CPF_0290"
FT   CDS_pept        347257..347499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM25326.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82216"
FT                   /db_xref="GOA:A0A0H2YN40"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN40"
FT                   /protein_id="ABG82216.1"
FT                   /translation="MSVSKINKQDSKKEKKIENFSQLKGRNIITYSEDKKEDDFYEAMK
FT                   EGYKAMALINSQYAEEGTSVEYFDQIEYETWLCGV"
FT   gene            347505..347858
FT                   /locus_tag="CPF_0291"
FT   CDS_pept        347505..347858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0291"
FT                   /product="PemK family protein"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83189"
FT                   /db_xref="GOA:A0A0H2YQL7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQL7"
FT                   /protein_id="ABG83189.1"
FT                   /translation="MASLNVKRGDIFYADLSPVVGSEQGGIRPVIIIQNDIGNRYSPTV
FT                   IVAAITSQINKAKLPTHVEISSEEYGLNRDSVVLLEQIRTLDKKRLKEKIGHMTEDDMK
FT                   KVNKSLLISLNLQ"
FT   gene            348296..349120
FT                   /locus_tag="CPF_0292"
FT   CDS_pept        348296..349120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0292"
FT                   /product="putative transketolase, N-terminal subunit"
FT                   /note="identified by similarity to SP:Q58094; match to
FT                   protein family HMM PF00456"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84362"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTG9"
FT                   /protein_id="ABG84362.1"
FT                   /translation="MSKKIQELKSMSKVIRKDIVTMLTESASGHPGGSLSIADIVTILY
FT                   FDEMNIDPKNPKDPNRDRFVLSKGHAAPVLYSALARRGYFDPAELTTLRKFGSNLQGHP
FT                   NMNDLPGIDMSTGSLGQGISAAVGMALAGKLDNKDYRVFTILGDGELEEGQVWEAAMSA
FT                   AHYRLDNLTAFVDFNGLQIDGDIKEVMSPCPIDKKFEAFGWNVIVINGHDYEEIINAIQ
FT                   KAKSTKGAPTCIVCNTVKGKGVSFMENEAAWHGTAPTKEQCEQAIKEIGGDN"
FT   gene            349120..350064
FT                   /locus_tag="CPF_0293"
FT   CDS_pept        349120..350064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0293"
FT                   /product="putative transketolase, C-terminal subunit"
FT                   /note="identified by similarity to SP:Q58092; match to
FT                   protein family HMM PF02779; match to protein family HMM
FT                   PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84977"
FT                   /db_xref="GOA:A0A0H2YV29"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV29"
FT                   /protein_id="ABG84977.1"
FT                   /translation="MAKKIATREAYGKALAALANENKNIVVLDADLSKSTKTADFKKAC
FT                   PERFINMGIAEGNMMSVAAGLSTCGKIPFASTFAMFAAGRAFEQIRNSICYPRLNVKIC
FT                   ATHAGLTVGEDGASHQAIEDLSLMRSIPNMTVICPSDAVETEAAIRAIAEYNGPCYVRL
FT                   GRAGVNVINDRPEYKFEIGKGIELKEGNDVTLFATGIMVDVAIEAVEALAKEGINARLI
FT                   NIHTIKPIDSELILKAAKETGAIVTLEEHNIIGGLGSAVAEVVGGEYPVPVVRVGVKDT
FT                   FGESGKPDQLLKAYGLTSEEAVKAAKKAMSLKR"
FT   gene            350183..350275
FT                   /locus_tag="CPF_0294"
FT   CDS_pept        350183..350275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQM5"
FT                   /protein_id="ABG83280.1"
FT                   /translation="MLILKIEGNNINDELIINLKWGEQIKYKSI"
FT   gene            350291..351148
FT                   /locus_tag="CPF_0295"
FT   CDS_pept        350291..351148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0295"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84641"
FT                   /db_xref="GOA:A0A0H2YU90"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU90"
FT                   /protein_id="ABG84641.1"
FT                   /translation="MKISMKTLKEYGIITLGVILLAISLEYFYYPNDIAAGGVSGLALV
FT                   VNKITGISQGMFMNVANVILFALAFWLIGGSFGGRSIYAAFGLSITISLIESFLPTFAV
FT                   TENMLLATIFGSVVGAFGIALVFSQNSSTGGTAIVAKILNKYLHIEIGKSLLCADCVVV
FT                   VCALLVFGVDKALFGLIGVFIMGILIDKIIEGFNSCKQLLIISEKSEEISQVIMKEIER
FT                   GCTKIEGTGGYSKEPVTILYVVVNRRQFISLKKKIKEIDPRAFITVNDSKEVFGEGFLD
FT                   LVEM"
FT   gene            351354..352040
FT                   /locus_tag="CPF_0296"
FT   CDS_pept        351354..352040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0296"
FT                   /product="putative cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82359"
FT                   /db_xref="GOA:A0A0H2YPV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPV5"
FT                   /protein_id="ABG82359.1"
FT                   /translation="MIEFRNVSKVYNKNVKALTNVNINIDKGEFVFLVGPSGAGKSTFI
FT                   KMLLKEVEPSTGNIVMGNEDLSKIKRRQIPYHRRKIGMVFQDFRLIPTLNVYENVAFAM
FT                   RVVGASPKEIRKRVPMVLSLVGLSNKYKMFPTELSGGEQQRVSIARAIVNNPKVLIADE
FT                   PTGNLDPETAKEIMELIDDINKAGTTVVMATHAKEIVNSMKKRVIAIDKGEVVSDVQKG
FT                   GYEYEV"
FT   gene            352030..352938
FT                   /locus_tag="CPF_0297"
FT   CDS_pept        352030..352938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0297"
FT                   /product="putative cell division protein"
FT                   /note="identified by similarity to SP:O34876; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84916"
FT                   /db_xref="GOA:A0A0H2YUW2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUW2"
FT                   /protein_id="ABG84916.1"
FT                   /translation="MKFSTIGYFISDAFKSLKRNRTISIASIATVLTTLFIFGAFLLTA
FT                   LNVKNGVTDVQDKVEVKVFLKDDVTQEQRDAVEAKLKTVQGVKEVEFESKDQAFAKMEG
FT                   SSDYNKEILAGYSKENNPLPASYIVRLESPEVASSVESAMKTNDKFMAGVEDVGNDEEL
FT                   IGTINSFVKVINTVGLVLGVVFVGVSLFLIVNTIKITVYSRRREVGIMKFVGATDWFIR
FT                   WPFVIEGVIIGLVGGILSTLLLFAGYNFLYGKIVSSSSLYMPQFVQPMYVLTTMSWQFI
FT                   LAGIVIGAIGSIIALRKFLDV"
FT   gene            353027..354313
FT                   /locus_tag="CPF_0298"
FT   CDS_pept        353027..354313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0298"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84326"
FT                   /db_xref="GOA:A0A0H2YTH9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTH9"
FT                   /protein_id="ABG84326.1"
FT                   /translation="MSRNKDEKNKYNNIIKNLKKKKGFRALAIGVALTLIIGVSVYAGN
FT                   RLTAFGILPITSVSAVQSSLEKVNDTENFKKVLEVREMLYRWYDGDIDDSKLAEGAIKG
FT                   MVSSLGDQYTYYMNEKEFSDFKEKSQGNYMGIGIQVAVKDGKIVVISPIQGGPAEKAGI
FT                   KTGDIILKVNGEPVSGNELDKAVSMMKGTTKENIKLTLYREGKGEFDVDVMRDVIKTVN
FT                   VKSEMIDGDIGYIEVLAFDEGTAKDFETQLKALEEKGMKGLILDLRGNPGGFMKECVDL
FT                   VSNFVPKDKVIVSTIDKYGNKEESVSKGGIAQGMPLVVLIDGGTASASEIVAGAIRDYD
FT                   LGTLVGTTSFGKGIVQVVLDKIGQEKDGTALKVTISKYYTPNGENIHKKGIGPDVTVEY
FT                   SKELKEKTYSRSTDPQFEKALEIIQEKIK"
FT   gene            354336..355616
FT                   /locus_tag="CPF_0299"
FT   CDS_pept        354336..355616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0299"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83322"
FT                   /db_xref="GOA:A0A0H2YQX0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQX0"
FT                   /protein_id="ABG83322.1"
FT                   /translation="MNLLIENIRGISYALVSPTLSLMLIVIAIIFYFKNRKIAFMQKLM
FT                   LGRSIQSPLEMTLLQILIGILGGLIASLLLSILGVTFENSSLIDVILTVSVFSVLYKNR
FT                   FLKFPYIAALLGVIGVLVSKNTEYFGRGFSFSINLTSIIVLIGVFSIVEGILAMIDGDK
FT                   GYLPIFTQKDGKLVGGFGFKRFWALPLCLLVVLGANSGNSIINEVKDLPQWLPFFNGDK
FT                   ARALMSVAALGTLAAYGATSYEGTTFTQSKRSKTITSGLINIAYGIVVIILAYLLKESL
FT                   VFTIALIILIPLLYELRIRMELKLESLREPLYFSNDDEICILDVLPNSIAYKKGLRSGD
FT                   KIVKINEEIPKNEKEVFMAIKRNFYGLDLEIRKNNGNIEKHTITGEDRGKQFGIVLVPK
FT                   GISFDKEIDEFLEKLKKASKDEEVKNK"
FT   gene            355704..357683
FT                   /gene="uvrB"
FT                   /locus_tag="CPF_0300"
FT   CDS_pept        355704..357683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="CPF_0300"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by similarity to SP:P37954; match to
FT                   protein family HMM PF00271; match to protein family HMM
FT                   PF02151; match to protein family HMM PF04851; match to
FT                   protein family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82689"
FT                   /db_xref="GOA:Q0TUD0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUD0"
FT                   /protein_id="ABG82689.1"
FT                   /translation="MGEFKIQSKFKPTGDQPKAIDTLVQSIENGNRGQTLLGVTGSGKT
FT                   FTMANIIERTQKPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYYDYYQPEAYVPQT
FT                   DTFIEKDASINDEIDKLRHSATSALLERRDVIIVASVSCIYGLGNPEEYKKLTISLRPG
FT                   MIKDRDEVIKKLIEIQYERNDIDFARGTFRVRGDNLDIIPSSSSSKGIRIEFFGDEIDR
FT                   IREFDVLTGNIIGERQHVSITPASHFAASEETLEKSIRVIEDELEDRLKVLTAEDKILE
FT                   AQRLKQRTNYDIEMIREMGYCQGIENYSRILDGRMPGTPPQTLLDYFPEDFLMFIDESH
FT                   VTLPQVRAMYAGDRSRKTSLVEFGFRLPCAFDNRPLKFSEFESKINQVVFVSATPGEYE
FT                   LDHSKVVAEQIIRPTGLLDPVIEIRPIQGQIDDLYGEIQRTVQRGFRVLITTLTKRMAE
FT                   DLTKYLKDLNVKATYMHSDIDTLERMKIIRELRLGEVDVLIGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNSESKVIMYADNITKSMDKSIKETERRRVIQMEY
FT                   NEEHNITPTTVIKGVRDIIEATKVSEEKENYEDEVKKAAKKDIPVEKLIEQYEEEMKEA
FT                   AKNLQFERAAELRDIIKDLKENSK"
FT   gene            357949..358800
FT                   /locus_tag="CPF_0301"
FT   CDS_pept        357949..358800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0301"
FT                   /product="degV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82406"
FT                   /db_xref="GOA:A0A0H2YNN6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNN6"
FT                   /protein_id="ABG82406.1"
FT                   /translation="MAVKVITDSTSCIPKDLAEKYGVEIVSLSVIMNGESYKEVDIDSE
FT                   AFYDELAKCDKLPTSSQPPMDEFYNAFEKFAKDGHDIVAAFISSKLSGTYTTSHIIKDM
FT                   ILEKYPDVKIDLIDSQTSVMALGIGVLEGAKAAQEGKDFDQVSKIVRNTIEESEIIFVP
FT                   GTLENLKKGGRIGGAAALFGKMLKINPILTVKEGAVVVMDKVRTKKRAIDKIVEVVKQD
FT                   LKEKGIKQAVVCHILAEDEAKDLAKRLKEELDLDSMIGEISAVIGVHVGVKSVGIAYAR
FT                   ES"
FT   gene            359036..359761
FT                   /locus_tag="CPF_0302"
FT   CDS_pept        359036..359761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0302"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84426"
FT                   /db_xref="GOA:A0A0H2YUB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUB5"
FT                   /protein_id="ABG84426.1"
FT                   /translation="MISLKGINKEYTQGVKAVDNLNLEIKDGEIFGILGPNGAGKTTTI
FT                   SMITGITEPTMGEIKINNIDISKNPVEAKMQFGYVPDSPDMFLRYKGIEYLNFMGDVYN
FT                   VSESDREERIKDLAKRFEMTNALGDKIQSYSHGMRQKIIIMGVLIHKPSIWILDEPLTG
FT                   LDPKSSYILKEMMREHASEGNTVLFSTHVLEVAEKLCDRVGIIKKGKLIFVGTLEELKE
FT                   EFKGDESLEKMFLEITENE"
FT   gene            359754..361352
FT                   /locus_tag="CPF_0303"
FT   CDS_pept        359754..361352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0303"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAP10268.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83798"
FT                   /db_xref="GOA:A0A0H2YRZ2"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRZ2"
FT                   /protein_id="ABG83798.1"
FT                   /translation="MNRIKLLLKYFIGNSFYNASSNIKSRNLAIVMYILIIIGISTPIA
FT                   NMIDSMYPNFASIGQEGYLLSIIFLIGSLTLLVLGVYDILDSFFFSQDIEPLMPLPFKS
FT                   GEIMIGKFITCLVDMYIYLSITIIPLISFGLNAKMGFSYFLMIIPVYLFAPIIIVIFCI
FT                   LITMILMSFINVSKYQNAFKIIFGTLGIVLILGVYSLNSTGLNSENVSVALKNKTALVD
FT                   LTNKIFITTTFSVKALLYSNSLKGLLNLGLLILISIVALIIAYFLGKLMYKKILSRNLN
FT                   VYSERKNILENNKDKVVVRSSVRKAMVLRELRTILRDPSNFINCVVMIVYMPIFIFIFF
FT                   IKGNILAGDTQLAKDTIIMAATFIVTALTIAGNSVASTALSREGKEIFISKYIPVDYKV
FT                   QIQSKLIVSFIVNGLALILGIAILIYLKASPLVIVMSLLVQMGTIVAISLWGMILDYLS
FT                   PKLEWTDTKNLYSKNFKPLLVMLICLVIGGFNIGLIVTKSPIIVFLIDISILLIVSLIL
FT                   YKILMKKGLEAYKRL"
FT   gene            361573..362577
FT                   /locus_tag="CPF_0304"
FT   CDS_pept        361573..362577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0304"
FT                   /product="putative lipase"
FT                   /note="identified by similarity to GB:AAL47055.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84124"
FT                   /db_xref="GOA:A0A0H2YSZ5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSZ5"
FT                   /protein_id="ABG84124.1"
FT                   /translation="MKKFLKVVGVILLSLIIMIGALAYYFRGQIGFYINIGKEYLEFKE
FT                   NPPSIEDLKNIKMSEDMDFKDVVYKDTNGKAQTLDIYGPEKKLRHGSPVILYVHGGSWV
FT                   YGNKEIPDLIAPLLDSFRKEGYTIISVGYELATDKVDFKKQASDVKDAIRWVYKNKETY
FT                   RFNTDEIGVIGASAGAHLSLLATYSGEDEFVDDKELSNYPSKVKYVVDFFGPTELSALD
FT                   MTMASWDLNNSIEKTEKQLRGEESITEYMDKYSPINYVKPNLPKTLIVHGRQDKLVPYS
FT                   NSMNLYNKSKDMGNDIQILTLENSGHDFSQVDVNEVFELGFKVLNFILFNTKF"
FT   gene            362736..364301
FT                   /locus_tag="CPF_0305"
FT   CDS_pept        362736..364301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0305"
FT                   /product="MutS domain protein"
FT                   /note="identified by match to protein family HMM PF00488"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83415"
FT                   /db_xref="GOA:A0A0H2YR70"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR70"
FT                   /protein_id="ABG83415.1"
FT                   /translation="MDKRLLKVLKHDYAVEMDKKRNLKAIRTLYDMNEKEEYHIDEQTW
FT                   NDLDLDKVYSKLDRNYSSLGEASLYSMLRNPLNDEKKLNKRREEIEYFKENEEVRFKIM
FT                   WIFFELGRDKKNSLLDMINEKLIESNKFKYYFYTITGKILPLILILTAIFVSVSAMLGL
FT                   MAVTFVNIYINSKERDRIKANGLMYLRRVIKASKQIVKINDKNLESFNIKIRENLKDLK
FT                   SIDRNTIMISFINMWGGVFEFISVLFLLEETAYYKIADSIEKNKDSILSLYKTLGEMEA
FT                   IISIGSYEEEKKDKITRPKFIRETTLEIKNGIHPIIENPVANSINMSKRGIVLTGTNMS
FT                   GKSTFLRMLGVNMLFAQAFNFVLAEKYEGPIFNIVTSISPNDDLSVGKSFYMAEAESIL
FT                   RIIRALDKDLPVFCAIDEIFRGTNPIERISASAEILTYINNKNSISIVATHDRELVDIL
FT                   KECYEFYYFSENVDSKNGLSFDYKLKRGVSKTRNAIKLLEYIGYPKDIINKSYRRSEKL
FT                   EGFI"
FT   gene            364316..365002
FT                   /locus_tag="CPF_0306"
FT   CDS_pept        364316..365002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0306"
FT                   /product="FCD domain protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83098"
FT                   /db_xref="GOA:A0A0H2YRP6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRP6"
FT                   /protein_id="ABG83098.2"
FT                   /translation="MFKPVKNMKVYEQVVDQIKEMVRVGQIKKGDKLPTERVMAEELQV
FT                   SRTSIREAMRALEVVGLIESRQGAGNYIREEFDDVLLEPLSIVFMLQNGTNKDIFELRE
FT                   VLELSTIFLSVMRISDEELKKLGELVERFKTSRDEEENVKIDSEFHSIIVKGANNVLIT
FT                   NLLEGVSELVDKFISEGRRAILSDERNRGKLLDFHEKIYLAIKNRDAYSAYKHMQEHFQ
FT                   LIKENI"
FT   gene            365231..366763
FT                   /gene="lctP"
FT                   /locus_tag="CPF_0307"
FT   CDS_pept        365231..366763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="CPF_0307"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM PF03553; match to protein
FT                   family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83989"
FT                   /db_xref="GOA:A0A0H2YSJ9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSJ9"
FT                   /protein_id="ABG83989.2"
FT                   /translation="MKELNTYLMFFLALIPIIILIIGLGVLKIPAHKICPIALIITILL
FT                   SIFIWKMPTIDSLTAALEGIALGIWPIMIVIIAAVFTYNLVVHTKAMEVIKSMLISVSD
FT                   DKRILVLILAWGFGGFLEAVAGFGTAVAIPVGIMAALGFNPFFASVICLVANTTPTAFG
FT                   AIGLPVITLANVSGIPIESLSYYVVLQLFLFVVLIPFALVALTEKSLKGIKGVFGITLA
FT                   SGLSFGIVQVLVAKFLGPELPAVLGSIVSLLVTIFIAKKFYKHNEETKREEKFELKSVL
FT                   VAFSPFILILVIIIGISPLFPGLYNKLSEVRTSVSIYTGVGAKPYTFVWLTTPGILILI
FT                   ASFIGGFIQKASFKEMVEILLKTIKQMSKSTITILAIIALAKVMGYSGMVASIATVLVM
FT                   ITGSFYAFIAPFIGALGTFVTGSDTSANVLFGSLQAEAANSLGISPAWLGAANTCGATA
FT                   GKMISPQSIAVATAATGLAGKEGKILNSTLKVCIVYVILLGLISYLGSLIFV"
FT   gene            366858..367646
FT                   /locus_tag="CPF_0308"
FT   CDS_pept        366858..367646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0308"
FT                   /product="electron transfer flavoprotein, beta subunit/FixA
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84434"
FT                   /db_xref="GOA:A0A0H2YUY1"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUY1"
FT                   /protein_id="ABG84434.1"
FT                   /translation="MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETA
FT                   LRIKEKKGGHIKVISMGPPQAKAVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLSQG
FT                   VKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLVIPHVANVRRILDVNDDFIKVEMDMPN
FT                   TIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYGLNGS
FT                   PTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI"
FT   gene            367659..368852
FT                   /locus_tag="CPF_0309"
FT   CDS_pept        367659..368852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0309"
FT                   /product="electron transfer flavoprotein, alpha
FT                   subunit/FixB family protein"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82358"
FT                   /db_xref="GOA:A0A0H2YNC4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNC4"
FT                   /protein_id="ABG82358.1"
FT                   /translation="MGRLVVHQDKIEDVNSVIKICPFGAMEIVNGKVEINASCRMCKVC
FT                   VRKGPKGAFEFVEDENKVLVNKDEWKGIAVYVDHVNGEIHPVTLELIGKARELADKVNQ
FT                   KVYCLFMGNGIKDKAGELLHYGVDEVIVYDYKELENFRIEPYTAVFYDFINKIKPCSIL
FT                   VGATTLGRSLAPRVAARCRTGLTADCTILDIKENTDLVQIRPAFGGNIMAQIVTPNSRP
FT                   QMATVRYKVMSAPERNEECTGEIKYFEIEKDKLKSDIEVKEIKQKPKEHSISDAEIIVV
FT                   AGRGVKSEKDLEMIKELADLLGGELAVTRPLIENGWADANRQVGLSGRTVRPKLIITCG
FT                   VSGAIQFVAGMNNADYIFAINKDEKAPIFKVAHYGVVGDIYEIVPKLIEKIKGEGVL"
FT   gene            368854..370254
FT                   /locus_tag="CPF_0310"
FT   CDS_pept        368854..370254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0310"
FT                   /product="putative glycolate oxidase, subunit GlcD"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83374"
FT                   /db_xref="GOA:A0A0H2YR42"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR42"
FT                   /protein_id="ABG83374.1"
FT                   /translation="MSYNKINESGIEFIKGIINDNERVFIGEEISEDYSHDELGSEKHM
FT                   PDIVVKAMSRDEIVEIMKYANNNNIPVTVRGAGTGLVGAAVPILGGILLDLSGMNKILE
FT                   LDEDNLTLTVEPGVLIMEIAKFVEEHDLFYPPDPGEKTATIGGNVSTNAGGMRAVKYGV
FT                   TRDYVRGMEVVLPSGEVLELGGKVVKNSSGYSLKDLIIGSEGTLGIITKIVLKLLPLPK
FT                   KVISLLVPFNDLESAIETVPKIIKSKNIPTAIEFMQRDLIISAEEFLGKKFPDNSSNAY
FT                   LILSFDGNSKEEVEGYYEKVADICLKEGALDVFISDTEERQESIWSARGAFLEAIKAST
FT                   SDLDEVDVVVPRNKVAEFVKFTNEVEKKLNVRIRSFGHAGDGNLHIYILKDELSEDEWH
FT                   KKLNEAMEILYRKQRELNGQVSGEHGIGLAKRLYLNESLNKATMDIMRGIKLAFDPNNI
FT                   LNPGKVCE"
FT   gene            complement(370338..370736)
FT                   /locus_tag="CPF_0311"
FT   CDS_pept        complement(370338..370736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO75282.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84214"
FT                   /db_xref="GOA:A0A0H2YTV8"
FT                   /db_xref="InterPro:IPR023813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTV8"
FT                   /protein_id="ABG84214.1"
FT                   /translation="MPKLLIPAIIFITLALIFYTIGVWSEHRAGILKKKHVIIFWCGLV
FT                   CDTLGTYTMSRIVAAGTDKGITPTDLLIHQSTGMLAIILMLIHAVWATIVLNRGSEKAK
FT                   AIFHKFSLVVWFIWLIPYFVGMYIGMTS"
FT   gene            371104..371613
FT                   /locus_tag="CPF_0312"
FT   CDS_pept        371104..371613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0312"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83058"
FT                   /db_xref="GOA:A0A0H2YR31"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR31"
FT                   /protein_id="ABG83058.1"
FT                   /translation="MSKNLKEYVVIIFTAIVLTLLINKFLLFKIVVSTPSMAPTIEPGD
FT                   QLFATRIHNLSKMERGDMIVFYSKEFDERMIKRLIGLPGDKVEIKEDGTVNVNNEKLDE
FT                   PYIKYPGGKVNMNFEVPEDKYLLLGDNRDNSKDARYWSDKYIDGDDILGKAQITVWPLN
FT                   RFNFAN"
FT   gene            371637..372149
FT                   /locus_tag="CPF_0313"
FT   CDS_pept        371637..372149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83874"
FT                   /db_xref="GOA:A0A0H2YSC1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSC1"
FT                   /protein_id="ABG83874.1"
FT                   /translation="MSTWLFIDCFLLILIIWWIYDLLKGEFLINKLGAKGSFRWLIGIL
FT                   ITTIIVIIITFPLVKNTYEIKTFIRDSRLNQYISSYKLSGFRNSTVIAKGNDKFEQLDN
FT                   DLKFEYMESVRKNIISIVSYNYGIGDGGYIEIHEMISDMKVEVDVGEDKYVTKGSTLKL
FT                   NGEVLYK"
FT   gene            complement(372276..372656)
FT                   /locus_tag="CPF_0314"
FT   CDS_pept        complement(372276..372656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS41741.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84566"
FT                   /db_xref="GOA:A0A0H2YTZ2"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTZ2"
FT                   /protein_id="ABG84566.1"
FT                   /translation="MRKKYFILTILTMILGLLSRKFMSYVPSLIAPYLGDVLWATMVYF
FT                   GFRFLLPKLNTNTSFLIAILFSFGIEFSQIYQAKWINNIRATTLGGLVLGHGFLWSDLL
FT                   CYTIGILIGSFIDRLAFIKKKL"
FT   gene            372975..373649
FT                   /locus_tag="CPF_0315"
FT   CDS_pept        372975..373649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0315"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82300"
FT                   /db_xref="GOA:A0A0H2YN58"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN58"
FT                   /protein_id="ABG82300.1"
FT                   /translation="MTDRVECKLKAKELLRGRWENAVGACLLFFVSTFLLSFLLSPIPV
FT                   FGWIIIALISTFLTGSFIKYCIKLNETEGKVKYLECLISFKTTLKILLCDILIGLVVGI
FT                   GWIIFTMIFSVAFIASQSIVVFIVVLIILVALGFFIEAILFPVPMILTEDEGVGVMEAI
FT                   EMSFNITKGYRWKYIVMNLSFIGWMILSFLTFGIGMLWLQPYMMLTYYLFYKGIRSANT
FT                   TI"
FT   gene            complement(373842..374465)
FT                   /locus_tag="CPF_0316"
FT   CDS_pept        complement(373842..374465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0316"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84228"
FT                   /db_xref="GOA:A0A0H2YT91"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT91"
FT                   /protein_id="ABG84228.1"
FT                   /translation="MEFLGSLLTFLIDIVGSFGYFGILLIVGLEYACFPLPSEVVLTFF
FT                   GLSASQGEFSLIGVIIFSIIGGLLGSLICYAIGYYGGVPLQEWLGRKFPSSQKSMLALN
FT                   KWFKKYGKPAVLLARIVPLTRTYVSLLAGAEKFSLKYFILYSSLGISIWNIFLVSLGYF
FT                   IGDNLPLINSIMEKYTFVTLAILIIAVIIFIYLKFFKKEKNTSK"
FT   gene            complement(374562..377219)
FT                   /locus_tag="CPF_0317"
FT   CDS_pept        complement(374562..377219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0317"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85051"
FT                   /db_xref="GOA:A0A0H2YWA6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YWA6"
FT                   /protein_id="ABG85051.1"
FT                   /translation="MKKVYSKSKEELFKELGVNKDGLNDTEVKSMEEKYGKNELVEGKK
FT                   KSTFQVFLDQFKDMLIIILICAAAISMFLGDIESASVIIFVLIVNATLGTIQHLKAEQS
FT                   LSSLKALSSPSTKVLRNGERIEIDSKDVVVGDIIFLEAGDYVPADGRILENYSLQVNES
FT                   SLTGESESIVKMSEIIKGEEIPIGDRKNMVFSGSLVTYGRATILATAVGMDTEIGKIAQ
FT                   LLNDTKEKKTPLQANLDNFGKKLAIGILVICAIVFALSLYRGEAIIDAFMFAVALAVAA
FT                   IPEALSSIVTIVLSLGTQKMAKENAIIRKLQAVEGLGSVSIICSDKTGTLTQNKMTVKK
FT                   IFVDGKVIDSNELNLEKKIDNDLLTMSLLCNDAITDCEKEIGDPTEVALVNLGDLYGVD
FT                   ELVQRDKFKRLGEIPFDSDRKLMSVVYNIHGENIIATKGAVDVLLKRSTKIETSEGVRP
FT                   ITKEYIAKIEEINQEFSKTGLRVLSFAYRNIESRTDIKLDDENDLTFIGLISMMDPPRE
FT                   ESAEAVRACIEAGIKPVMITGDHKITASAIAKQIGILKDESEAIEGSALDKVSDEELKN
FT                   MVEHISVYARVSPEHKIRIVRAWQEKGNVVAMTGDGVNDAPALKQADIGVAMGITGSEV
FT                   AKDAASMVLTDDNFATIVKAIENGRNIYSNIKNAIKFLLSGNTAGILSVLYASILALPV
FT                   PFAAVHLLFINLLTDSLPAIALGLEPHKKEVMKEKPRKANASILTKDFITDVLFEGVVI
FT                   TIVTMIAFHIGLNQGGPLLASTMAFATLCLSRLVHGFNSKSKKHVVSKELFSNKYLWAA
FT                   FGVGFVLLNIVLLVPAFEGLFQVAPLTLNNLLTIYGLSLCTFIVVQFVKFIREKFTENK
FT                   TNTVQESNKENRAA"
FT   gene            377759..378556
FT                   /locus_tag="CPF_0318"
FT   CDS_pept        377759..378556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0318"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /note="identified by similarity to GB:BAD77164.1; match to
FT                   protein family HMM PF01987; match to protein family HMM
FT                   TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83493"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRE8"
FT                   /protein_id="ABG83493.1"
FT                   /translation="MNSHEIDFELFGDDMQFVEIELDPRETVVAEAGAMMMMDSSIEME
FT                   TIFGDGSNSSGSGGFFGKLGGAAKRVLTGESLFMTAFTNMGVGREKVAFASPYPGKIIP
FT                   VDLRNYGGKLICQKDAFLCAAKGVSIGIDFRRKLGTGFFGGEGFILQKLEGDGMAFIHA
FT                   GGTIIRKRLLPGQKLKVDTGCLVAMTKDVNYDIEYVKGIKNAVFGGEGIFFASLVGPGE
FT                   VWIQSLPFSRLASKVVSSAPQVPGSRDVGEGSVLGEFGRLFQD"
FT   gene            379116..379688
FT                   /gene="xpt"
FT                   /locus_tag="CPF_0319"
FT   CDS_pept        379116..379688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="CPF_0319"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="identified by similarity to SP:P42085; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01744"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83036"
FT                   /db_xref="GOA:Q0TUB1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TUB1"
FT                   /protein_id="ABG83036.1"
FT                   /translation="MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRKR
FT                   FEGEKVDKILTIEASGIAIAGIASQYFDYVPVVFAKKTESLNLDKDVYESNVHSFTKKK
FT                   DYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVIEKGFQDGR
FT                   KVLEDLGVRVESLAIIDKLEDNKVYFK"
FT   gene            380174..381106
FT                   /locus_tag="CPF_0320"
FT   CDS_pept        380174..381106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0320"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82625"
FT                   /db_xref="GOA:A0A0H2YPY6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPY6"
FT                   /protein_id="ABG82625.1"
FT                   /translation="MNNKQKGISLVLIATVFWGIMGISSRILYEAGLSTMFIAFSRSFL
FT                   SSICFFIWIMITDRKILKIDPRGLAISALYGIGTFALCFIGYNLSVEYIPISVATVLMF
FT                   TNSIWVTIFGVLFFGEKFNMKKGSVILLTLVGCIMVSNMSLGHFNMSAIGIAAGLGTGF
FT                   LFAFQIIFPKFFSGYRKDTLLIYGYIFASIFIGLFTDFKESFDIIANAPNIGVVILNIL
FT                   SIGILSTFISNTFYIKSTEYIEASVTSILASMEPVLSSIFAFFIFGEVLNGKQIVGAIL
FT                   IIIAAIILELKLDKERINNVFKLKFINQN"
FT   gene            381297..382679
FT                   /locus_tag="CPF_0321"
FT   CDS_pept        381297..382679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0321"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84769"
FT                   /db_xref="GOA:A0A0H2YUM8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUM8"
FT                   /protein_id="ABG84769.1"
FT                   /translation="MEIFKKQSLKRILSEANENKERTLSALDLTLMSVGSVIGTGVMVL
FT                   TGIVAAKQSGPATSIAFIGGGIAAAIIVLCYAEFSSSIPSAGGSYSFTYVSLGEIIAYI
FT                   SGLCIVIGYTLSTATVASGWGSYLLSLLDILGIKLPKTFTAIPSEGGIVNLPAMISILF
FT                   IVFVISLGTKESKKVNDIMVFIKIAVIALFIGVGVFHVNTSNWHPFAPFGVKGIVTGTA
FT                   SLFFAYCGFDATASAAEEVKNPQKSLPLGLISSLVICTIIYIAVSLVLTGVTSYTNLNV
FT                   GDALSYALKLVGQRGVAFVVSLGTVIGILAVIFAGNFTTSHILLAMSRDGLLPKFFSKV
FT                   DKKDVPYTALWTVGIIGALLAGFFNLGQLANFANIAFLLTYTLVCISLIAFRKKYPHVK
FT                   RGFKTPLVPFIPLLGAFSCLFLMSNLSEEIWKIFIVVLVLLIISYLVYGRKHSLINKNN
FT                   DN"
FT   gene            complement(383008..384312)
FT                   /locus_tag="CPF_0322"
FT   CDS_pept        complement(383008..384312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0322"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04087"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84733"
FT                   /db_xref="GOA:A0A0H2YUF6"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUF6"
FT                   /protein_id="ABG84733.1"
FT                   /translation="MSITKERFFNEFKKDQATYDEIHENILDGVNIGGANFIILMCAII
FT                   IASVGLNMNATAVIIGAMLISPLMGPIIAIGYSVGIYNLKLLKKSAIILIIEIFISITT
FT                   ATIYFSLSPISSAGSEILSRTAPNIWDVIIAFTGGIAGIIGITRKKSGNILPGVAIATA
FT                   LMPPLCTSGYGLATKNIHIFLGAGYLFFINSFFIALSTLLVVKFMKIPTRNTLSEVKQK
FT                   KLKKMIIVSTILVTIPSLISAATMVNSFLNNANLSNFIENEMPSEYILNKEINTKNKTI
FT                   DLVIIGNTIDNSEEEKLQEALKYYNFSGYKLIIQQSTDNFPELKMYLDKIKEQDSGFIG
FT                   DLEINKGKNNSSINNNVTSALNSVTSSLPGKFDDITKVYSGVLDNELPVFIINHSKDYI
FT                   DKDAINAYILSNPELKNAKIYFEKEDPNKENTKPQ"
FT   gene            384584..385969
FT                   /locus_tag="CPF_0323"
FT   CDS_pept        384584..385969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0323"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84185"
FT                   /db_xref="GOA:A0A0H2YTT8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTT8"
FT                   /protein_id="ABG84185.1"
FT                   /translation="MLSKDTIKKVLSVALSAGGDFAEVFVEEKLNNNIVLTSGAVKDII
FT                   SGKDYGIGIRIFKGLKCIYAYTNDDSIMSLVNTAKKAALALGDVIDGHTVNLNLVERIN
FT                   TNIHPILYVPSSISSAKKIEKMKEAYKGAKGYSHEIAQVTVTMKDEDQRVLIANSEGLF
FT                   TEDRRIRSRIAISSIASNGVDNQAGTRSPGASMGFEFFDTIDLSDLGKEASKSAVTMLH
FT                   ADYCPAGKMTVAIENSFGGVIFHEACGHSLEATAVAKGNSIFCDKLGMQIASKKVTAID
FT                   DGTIANAWGSLNIDDEGEPTRRKVLIENGILKSYMIDKFNGRRMGMPSTGSGRRESYKY
FT                   APTSRMTNTFIANGEDDNEEIIKSIENGLYAKQMGGGSVNPITGDFNFNVLEGYLVKNG
FT                   VIDRAVRGASLIGNGADILMNIDMVGKNLDHGQGVCGSLSGAVPTNVGQPLLRVKEITV
FT                   GGR"
FT   gene            385985..387334
FT                   /locus_tag="CPF_0324"
FT   CDS_pept        385985..387334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0324"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83342"
FT                   /db_xref="GOA:A0A0H2YRP4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRP4"
FT                   /protein_id="ABG83342.1"
FT                   /translation="MEFKDFKERLFNRAKELNFEKYELYYGKSESLNITSSNGEVERYG
FT                   LSTSIGVSFRGIYNGKMGYSYTEKLDEESIEILLLKAMECAELIESKDEEFILGDKAKY
FT                   VEVNSYDENISNLTPKEQIEKALKLSTEPSKINSEIIKSEYTKFNTAKLERVIVNSEGI
FT                   DLKEEKTIVQASISPIAKDGENMIVDGVSRVSTKLNDVNIDELMKKAINNTLRKKGATS
FT                   IKSGKYKVIIDGEVMASLIRTMEDNFLGHIAQENKTLLKDKIGEKVASNKVTLVDDPFL
FT                   KGGISTCSFDDEGVPTRVKNIIENGVFKGFLHSLKTAKKSKVNPTGNGFKSGFKSTVKA
FT                   SPTNLYIKEGEKSFEELLSYVENGIYIIDLAGLHSGANAVTGDFSLAAEGIKIENGVLT
FT                   RAIKHITIAGNFFDLLNNIEEVGNDLEESGVTSGYGSPSIIIKELSVAGE"
FT   gene            387643..389229
FT                   /locus_tag="CPF_0325"
FT   CDS_pept        387643..389229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0325"
FT                   /product="L-aspartate beta-decarboxylase"
FT                   /note="identified by similarity to GB:BAB92080.1; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82730"
FT                   /db_xref="GOA:A0A0H2YPF7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPF7"
FT                   /protein_id="ABG82730.1"
FT                   /translation="MITKDLEKKLEGLGAFEISSKMLKLAKNNEKHNKFLNAGRGNPNW
FT                   INTEGRLALGRIVEFGVFESRRTIHEGNLAGYTNLDGIYERLMDFLNGGHEVDKFLRDA
FT                   IDYSIKTLSVNKDELVKEFVDGAIGNDYPVPNRCLVNTEKILKLYLEKELFGGVKLAKE
FT                   TNVFPTEGGTAAICYIFNSLKENGLIKAGDKIAINTPIFTPYLQIPELKDYEMVEVDLI
FT                   SKEENNWVIEDSELDKLRDKEIKALFFVNPSNPASKALSEEALNHIADIVKERKDLMII
FT                   TDDVYGTFVENFKTIYSVVPYNTLLVYSFSKLYGVTGWRLGLIAANENNVFDELISKLP
FT                   EEKLQDLDKRYGLVTFEPRKFKFIERIVADSRSVGLYHTSGLSTPQQIQMALFALTSLI
FT                   TKGRDPYIESSKKLVRERYHDLCYTLGIKEDDSRENAKYYSLIDIYELAGDLYDDKFKE
FT                   YLKENFEPIDFLLRLAEINGVVLMEGVGFGAAPGILRVSEANLPDEAYKKIAKQVLELL
FT                   SEYYNQYKSQN"
FT   gene            389547..390023
FT                   /gene="ogt"
FT                   /locus_tag="CPF_0326"
FT   CDS_pept        389547..390023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="CPF_0326"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P19220; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82308"
FT                   /db_xref="GOA:A0A0H2YPP3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPP3"
FT                   /protein_id="ABG82308.1"
FT                   /translation="MKESLIKKGYYNSPIGILEIIESDGHIVEINFVEDDNCLEEFISE
FT                   EIEKCKIELEEYFSGRRSEFSVKVDLAKGTEFQRKVWNALRDIPYGETVSYKEIAEKIG
FT                   NPKAVRAVGGANNKNPIPIIIPCHRVIGKDGSLTGYGGGLSKKECLLNLENENK"
FT   gene            390072..392246
FT                   /gene="recQ"
FT                   /locus_tag="CPF_0327"
FT   CDS_pept        390072..392246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="CPF_0327"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM PF09382;
FT                   match to protein family HMM TIGR00614; match to protein
FT                   family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82741"
FT                   /db_xref="GOA:A0A0H2YPG6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029491"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPG6"
FT                   /protein_id="ABG82741.1"
FT                   /translation="MKRAKEILKSFYGYSEFRKGQEEIINEIISGNDVVAIMPTGGGKS
FT                   ICYQIPALILEGVTVVISPLISLMKDQVDAINSMGIESAYINSTLSNEEINNIFQSVKD
FT                   GHIKILYVAPERLESMEFLNLVSNIDISQVAVDEAHCVSQWGHDFRSSYKFIGRFINLL
FT                   RKRPVVSAFTATATEEVRKDIVKLLELNNPKVFVSGFDRDNLKIIIEKGVNKAHYILDY
FT                   LKENKDVSGIIYCATRKEVDSLCELINSRGIGCTKYHAGLSDEERKKNQEDFVFDKVSV
FT                   MVATNAFGMGIDKPNIRYVIHNNMPKNIEGYYQEIGRAGRDGEKSECILIFSPGDVQTQ
FT                   KYIIETGTLNPERKINELSKLQTMMDLVYSNGCYRRFILNYFGEDLEEDCHNCSNCEME
FT                   GELVDKTIDAQKVISCVYRMKRPFGIGVIIDVLRASKNKKIIELGLDQLSTYGIMKDYS
FT                   KEGLKDFINTLISHRYIDYIGEYPVVRLNQSSIDILKGNEKVMFKEKIKAKRVSKNNEL
FT                   FDLLRSLRREIALEEGVPPYIVFGDNTLKEMSVRIPVNESQLSEISGVGEKKILKYGEQ
FT                   FLNVIKEYVKVNNIEVQWESGLKINKDELEEKFKKGNGKDGKKKSFEITIDMLREGDKF
FT                   HTIAKERELSITTVLSHIQQYLEEGNKIDFEIDFDSLFSKREEELVLDAIDKVGYSKLK
FT                   PIKENLEEDVSYEKIRFIVTKLTINNLRKE"
FT   gene            392334..392462
FT                   /locus_tag="CPF_0328"
FT   CDS_pept        392334..392462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRQ1"
FT                   /protein_id="ABG83620.1"
FT                   /translation="MFLYPPKSAKTFSWSFLFNISKNKLLGYMNNNFQIISNKYFV"
FT   gene            392477..393274
FT                   /locus_tag="CPF_0329"
FT   CDS_pept        392477..393274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0329"
FT                   /product="amidinotransferase family protein"
FT                   /note="identified by match to protein family HMM PF02274"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84077"
FT                   /db_xref="GOA:A0A0H2YSS2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSS2"
FT                   /protein_id="ABG84077.1"
FT                   /translation="MEIRNNKGYGKLKTVIVCYPCNFKVKGKVQINYPLMYEQYNNFIN
FT                   LISGEGVKVQLLEPIYGENQVFTRDVGFVIGDTLFISSMSNKERIEETKALEKYIKNHN
FT                   LKVYRMENKIEGGDVIVYENYIFVGLSKRTSLEAIKELKEYINEYNMGYEIIEINFNKE
FT                   KMLHLDCVFNILGKNQCIISDYLYDKDKIKKRIKTCYNIDKKTSEELGANIVALGDGRI
FT                   LTSNKTVFHILKKADFEVFYLDYSEILKAGGGFTCSTLYFYIE"
FT   gene            393418..394857
FT                   /locus_tag="CPF_0330"
FT   CDS_pept        393418..394857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0330"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84797"
FT                   /db_xref="GOA:A0A0H2YUQ2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUQ2"
FT                   /protein_id="ABG84797.1"
FT                   /translation="MYFGVYFFVTALIILGVTLFLKKKLVGKDREFYKVLLVLCIPIIV
FT                   QNFISTSVNVIDTVMISSLGEESIAAVGVANQVFFLFNMGLIGLTGATGLFISQFYGSN
FT                   DRKSIKKVMGLSTILCVGFSFIFFVLAFFFPELIIGIFSTDPKVVELCKNYLVVIAISY
FT                   PLTALSMVISAGARAVRNPKLGMFCSGASLIINIIFNYCLIFGIGIFPELGVKGAAIST
FT                   VFARIIECLLLVGYVILKDKDYIIKFNINDIRGINKDFFKVYMSKGMPIFINDFAWAIG
FT                   SVSYSVAYAMVGTSAIAASQIATSTANLFIMLAMCIATGAAIMLGNELGADNTDRAIDY
FT                   SNKFSKIVFVVGSILGGMLILSIPILLKVYSTSSTMAGDLSKIFVIMGVLMGLKSFNIL
FT                   VIVGILRSGGDTKYAFALEFGCMWLVSIPLTFFGAINGFPIYMLVLFTYSEEIVKAIFG
FT                   LPRVLSKVWVVNLTKDIEISG"
FT   gene            395023..395772
FT                   /locus_tag="CPF_0331"
FT   CDS_pept        395023..395772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0331"
FT                   /product="putative transcriptional activator tipA"
FT                   /note="identified by similarity to SP:P32184; match to
FT                   protein family HMM PF00376; match to protein family HMM
FT                   PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82844"
FT                   /db_xref="GOA:A0A0H2YPQ1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPQ1"
FT                   /protein_id="ABG82844.1"
FT                   /translation="MYRVKEVSELTGISVRMLHHYDKIGLLRPTAISESGYRLYNDNDL
FT                   KLIQQILIYRELDFSLKEIKEILSNENLDLKETLRTQKQFIIDKRNRLNKIVETIENTI
FT                   KDMEGEFIMNKKGMFEGFDIEKHNKLYEEEVENKYGKSDAYKESKEKTSKYSKEDWNNI
FT                   MGEIDDLYKNLAELMDREVSDEEVQSLVHQWRMLISKNFYQCSIEIFKGLADMYIYDER
FT                   FTKNIDKYGEGFTNFLSEAMNYYCNEN"
FT   gene            395893..396303
FT                   /locus_tag="CPF_0332"
FT   CDS_pept        395893..396303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM24863.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83494"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRF0"
FT                   /protein_id="ABG83494.1"
FT                   /translation="MYIKGGVFLRYVRPSKCPVCNSELKIVKLECEKCKTKIEGEFKGC
FT                   DFCNLTPEEQYFLKIFVKCKGSIKEIEKELDISYPTVKSRLNQLITALGFEDKELEDEK
FT                   KDKKREREIILGKLDRGEITSSEALKELEKLK"
FT   gene            396319..396723
FT                   /locus_tag="CPF_0333"
FT   CDS_pept        396319..396723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM24861.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YW85"
FT                   /protein_id="ABG85026.1"
FT                   /translation="MDEKKKILEMISEGKISPEEGMKLLNALGENKEEFVIKKKIYKTL
FT                   KVKVEVENEEVKVNLSIPLSLIKVASGFTKFIPEDAMNNIEKGGVNLKDIDFKKVIEEI
FT                   ENGELDDPTICDVDINNKDDGKVIVKIYVD"
FT   gene            396713..396997
FT                   /locus_tag="CPF_0334"
FT   CDS_pept        396713..396997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84173"
FT                   /db_xref="GOA:A0A0H2YT12"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT12"
FT                   /protein_id="ABG84173.1"
FT                   /translation="MLTKKNFVYIKITLPSINWLRISLPIAVINLILNDIIDLLSFLKW
FT                   IFRLRKLENYINYLYGGLEALKEFRACEESEILDLSLGKENISIKIKLV"
FT   gene            397006..397377
FT                   /locus_tag="CPF_0335"
FT   CDS_pept        397006..397377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0335"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83324"
FT                   /db_xref="GOA:A0A0H2YRM8"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM8"
FT                   /protein_id="ABG83324.1"
FT                   /translation="MKRIISNFFINLVVVLILIYLFNLGEAKSVLNIVLFSAIFTILGF
FT                   TLRPILQIISLPITVLTFGIFLFLVNAFIVYIADIFTIGFNISGFLNNLIVSIVLFIVS
FT                   FIVNKYRLKIKIEKINKTV"
FT   gene            complement(397452..398123)
FT                   /locus_tag="CPF_0336"
FT   CDS_pept        complement(397452..398123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0336"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84725"
FT                   /db_xref="GOA:A0A0H2YUF9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUF9"
FT                   /protein_id="ABG84725.1"
FT                   /translation="MLLVKNEEKLLEVINKYELNSIFSQEIMPFLELHMFKKNEHICFM
FT                   NEELNYLYFFVHGKAKVYKTLPNGKSLLLEFYEPVQLIGDLELISKIKANCNVKALKSS
FT                   LCIAIPIQAVNSIALKDLNFLMYITKNLSNKLAKCSVTSSITITYPLETKLASYLLAMN
FT                   SNNIIMIDNYSNLADLLGTSYRHLNRVLNKLVEKGIILKDKNEIKILNKEELENICVDL
FT                   N"
FT   gene            399068..401887
FT                   /gene="uvrA"
FT                   /locus_tag="CPF_0337"
FT   CDS_pept        399068..401887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CPF_0337"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by similarity to SP:O34863; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83951"
FT                   /db_xref="GOA:A0A0H2YSI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSI4"
FT                   /protein_id="ABG83951.1"
FT                   /translation="MKDKIIVKGAKVHNLKNVSLEIPRDKLIVFTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSSYARQFLGQMDKPDVESIEGLSPAISIDQKTTSRNPRSTVGTVTE
FT                   IYDYLRLLYARVGVPHCPKCGKEITQQSVDQIVDQIMELPERSKIMILAPIIRGRKGTH
FT                   EKVLENIKKQGFVRARIDGEIYDLTEDEIKLEKNIKHNIEAVVDRIIVKDGIEGRLTDS
FT                   IETSLKMAEGLVLVNIIGEEDRLYSEHFACADCGISIDELAPRMFSFNSPFGKCERCDG
FT                   LGTLMEIDEDLVVPNKDLSIRGGAISTWGDSRMKEESWTYCVLKALMEKYNFDLDTPYK
FT                   DLPKKVQEVLMYGEPEKLKVTYTKENVTAVYNHSFEGEINNLRRRYMETNSDTMKAEIE
FT                   KYMSDNPCPKCKGARLKPEALAVTVGGKNIFEFTSMAIREELDFINSINFSEKDKIISS
FT                   QIIKEIQSRLSFLINVGLDYLDLARKAGTLSGGEAQRIRLATQIGSQLMGVLYILDEPS
FT                   IGLHQRDNDRLISTLKQLRDVGNTLIVVEHDEDTMREADYIVDIGPGAGEHGGKIVASG
FT                   TLDEIMSNENSLTGKYLTGAKKVELPEERRKGNGNFITVKGAKENNLKNVTAKFPLGTL
FT                   TMVTGVSGSGKSTLVNEILYKGLNKIVNKAKDLPGKFKEITGYENIDKIIDIDQSPIGR
FT                   TPRSNPATYTGTFDIIRELFSQTQEAKMRGYKPGRFSFNVKGGRCEACSGDGIIKIEMQ
FT                   FLSDVYVPCEVCKGKRYNRETLEVKYKGKNIADVLNMTVEEALEFFENIPRIKNKLQTL
FT                   MDVGLGYIRLGQPSTQLSGGEAQRIKLAYELSKRSTGKTLYILDEPTTGLHIHDVNRLV
FT                   KILQRLVDGGNTVIVIEHNLDMIKCADYIVDLGPEGGDKGGTIIATGTPEKIAEAKESY
FT                   TGKYLKKYL"
FT   gene            402221..402655
FT                   /locus_tag="CPF_0338"
FT   CDS_pept        402221..402655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0338"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83596"
FT                   /db_xref="GOA:A0A0H2YRG3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRG3"
FT                   /protein_id="ABG83596.1"
FT                   /translation="MFSKLMTWVFGIIFIVILYSIIYYALKIMYKDVKGGKKKKAPGKK
FT                   AHGLEVLKTISNGTLGIGSVIPVTSTISIGRREDNSIVLNDQFVSSYHAKIYVKNNDFY
FT                   LEDLASTNGTFINDSKVEGRVRLKVNDQIRMGSTVFKVIG"
FT   gene            402669..403898
FT                   /locus_tag="CPF_0339"
FT   CDS_pept        402669..403898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0339"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82304"
FT                   /db_xref="GOA:A0A0H2YNK3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNK3"
FT                   /protein_id="ABG82304.1"
FT                   /translation="MNTTLKYEKRMLLLVYLLCLALFTNIAVKQTPIDKMAFIIAGILI
FT                   IIIGFSHFIIRKFYPDGDKYMLIFASVLAVVGIAVLYRLDPKLAIKQLVWFSLGIALYM
FT                   GIVIVMPDLKSFAKYKYIYMGGTLIFMAMAMIIGKTVNGSKNWVYIGSFGFQPSEIGKI
FT                   FLILYLASALMKYEKKDNIKYEFKQLLEPALVVMYSLGFMVLQKDLGSALMFFFVSITM
FT                   LYIATCNWKYVGTGLVLFSLGGTVSYFLFSHVKKRVMIWKDVWKYASNESYQIVQGFYA
FT                   MSLGGMFGTGLYNGYPKLVPFASTDFIFTLIAQELGLVFGIGLLLLYFLLFYRGIRAAL
FT                   NTDDPFSQLNAVGFSTLIVAQVLVIIGGVFAVIPLTGITLPLVSYGGTSMLTVFIALGI
FT                   LQKISEEGLR"
FT   gene            403899..405362
FT                   /locus_tag="CPF_0340"
FT   CDS_pept        403899..405362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0340"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84701"
FT                   /db_xref="GOA:A0A0H2YUC9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUC9"
FT                   /protein_id="ABG84701.1"
FT                   /translation="MAKKKDLSGSIKKVMFVYLVLLVGLISYIAYFQLIQVPKIAEMDS
FT                   NSAVMAAQNEVIRGEIKDRDGNVLAKSTKSGDLTQKREYPYGEIYSHPIGYASGIYGNA
FT                   GLEGAYSKELTTYENVSLKAFLKSFNLKKDFKERNESDKKVGNSIVTTLDTDLQKAAYA
FT                   ALGANRGAVVALDPKTGAVLASVSKPGFNPNNMKETYEIANNPNGNPKDAILVDRALNG
FT                   QYPPGSTFKVVTLTSALENLPGVTERTFNDTGSINVGTKDLPNENGNAYGNISLRKALS
FT                   VSSNVIFGGILGEELGNKKLRETAEKYGFNKDLYLGNLKAYSGSFPDRKTVDKGLIAYD
FT                   AIGQGEVLSSPIEMAMVAATVANNGVRMEPYIVSKVVDKDGDTVKEFSSTKKDTVMSKE
FT                   QAQIINEYMQGVAKDRINDNWGYFKGMNVAAKTGTAQVPDGNSHAWLIAFAPADDPKIA
FT                   VATIVENGGSGSKVAAPVTARVMQAYFNK"
FT   gene            405519..407381
FT                   /gene="uvrC"
FT                   /locus_tag="CPF_0341"
FT   CDS_pept        405519..407381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="CPF_0341"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83959"
FT                   /db_xref="GOA:Q0TU89"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU89"
FT                   /protein_id="ABG83959.1"
FT                   /translation="MFDFQHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQ
FT                   NSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIK
FT                   ITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAVYEVMGLIKKLFPLRTCKKAIVEGGEP
FT                   TRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELE
FT                   FEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGRE
FT                   HFMIENISDDPVKEVISSFIASFYGGTAQIPKTIYVPEEIEDQELIEKFLTEKRGSKVW
FT                   IKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPARIE
FT                   AYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLE
FT                   EVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIEIPVCGLVKDHKHR
FT                   TRGIIFNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGE
FT                   KRRRNLLMKFGSIDNIKKASMEELLDTPGIDKRAAESIKQYFSS"
FT   gene            407530..408444
FT                   /gene="murB"
FT                   /locus_tag="CPF_0342"
FT   CDS_pept        407530..408444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="CPF_0342"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by similarity to SP:P18579; match to
FT                   protein family HMM PF01565; match to protein family HMM
FT                   PF02873; match to protein family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82218"
FT                   /db_xref="GOA:Q0TU88"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU88"
FT                   /protein_id="ABG82218.1"
FT                   /translation="MNQYMEFYKLLGEFYNEEDITVDSPMSEHIYFRVGGPADILVTPV
FT                   NEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVVIKFNKLNKITTEGNCVTAQS
FT                   GALLKDVSKAALENNLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCN
FT                   IKNLTKEELELGYRSSIVMKKGYVVIEATVELESGEYASIKDKIDDLTNRRESKQPLEY
FT                   PSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAH
FT                   VQKTVKENFDVELHTEVRIIGRD"
FT   gene            408684..409568
FT                   /locus_tag="CPF_0343"
FT   CDS_pept        408684..409568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36958.1; match to
FT                   protein family HMM PF03668"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84634"
FT                   /db_xref="GOA:Q0TU87"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU87"
FT                   /protein_id="ABG84634.1"
FT                   /translation="MRFVIVTGLSGAGKTEATRSLEDLGYFCVDNLPPKLIPKFAEACV
FT                   QSEGKIDKIALVIDIRGGIFFDDLFESIEYLKANDFNYEILFLEASDEVLVKRFKETRR
FT                   SHPLSPDGRIITGISEERMRLRELKDRADNIIDTSNYPIRNLREKINLLYGDGKPVEQN
FT                   LSITVLSFGFKYGIPSDSDLVFDVRFIPNPFYIPELKPFSGEDEPVKNYVLAQEETKGF
FT                   LSRLSDMAEFLIPNYIKEGKRQLIISIGCTGGRHRSVAIANALYKDLLCKNFHVTLEHR
FT                   DINEDINRGDRKL"
FT   gene            409565..410910
FT                   /pseudo
FT                   /locus_tag="CPF_0344"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:Q97LP2"
FT   gene            410913..411863
FT                   /locus_tag="CPF_0345"
FT   CDS_pept        410913..411863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:B96963; match to
FT                   protein family HMM PF02650; match to protein family HMM
FT                   TIGR00647"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82366"
FT                   /db_xref="GOA:Q0TU86"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU86"
FT                   /protein_id="ABG82366.1"
FT                   /translation="MSFSAKVKGEICRYIDISKEEALAQISAIMKVCGTLAFSGRQISF
FT                   KMTTENPASARLMFTILKDYFDIHAKLMVKKSNSLKKNNIYMVVVTEEMGVKKLLEITG
FT                   ILREIDGIMSLDYHIDENLVDTEEKKKAYIRGAFIGGGSISNPEKTYHLEFVTHSQEYA
FT                   EDLGKLINTFGLKAKVIQRKNSYIVYIKEGEQIVDLLNIIGAHTALLELENIRIMKEMR
FT                   NNVNRLVNCETANLSKTVNAAVRQVESIKLIEREIGLARLPKNLREVAELRLTYPEESL
FT                   KELGEMLEPPVGKSGVNHRLRKIEKIAEELRTGNF"
FT   gene            412037..412591
FT                   /locus_tag="CPF_0346"
FT   CDS_pept        412037..412591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0346"
FT                   /product="putative lioprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84260"
FT                   /db_xref="GOA:A0A0H2YTC1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTC1"
FT                   /protein_id="ABG84260.1"
FT                   /translation="MARNFKKTIWLLVGVMIFGIIGMVGCTKKTNEMTENSGLSATTPA
FT                   EYKTMLEEKIKTYIGDVNLGTEYDFSKVTEDTKQATYEEYEKYYKNLDTELTNLKNELN
FT                   SKVSPSDGKVNDANRKIVESIDNLKMSISTVKSDLDANRNKILAMPKDEFIGAMKDIEK
FT                   SAYDARVKVQESIDSAKNSFK"
FT   gene            412991..414241
FT                   /pseudo
FT                   /locus_tag="CPF_0347"
FT                   /note="DNA polymerase III, alpha subunit, interruption-N;
FT                   identified by match to protein family HMM PF02811; match to
FT                   protein family HMM PF07733"
FT   gene            414446..415225
FT                   /locus_tag="CPF_0348"
FT   CDS_pept        414446..415225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0348"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAP09652.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82279"
FT                   /db_xref="GOA:A0A0H2YPL8"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL8"
FT                   /protein_id="ABG82279.1"
FT                   /translation="MHKYICEKCSKEFLTRKKGQRFCSKSCANSHNTTLRKIEDLSIFD
FT                   KGINEISAYILGLIISDGCLSYDKHCKRFKITITSTDLEIIKFLNKSYCLNKKIYEYKS
FT                   KKFKDAKISYSFITTNKYDVEFIQKIGITERKSKDVFLLNVEESFIGDFIRGIFDGDGS
FT                   VYINTTKNKLSNGDIKEYKYLNVSISTGSINMAKQLSNLLNQKSIKAKIVKDSRKFHEC
FT                   WYVKIYEKNSILNLYKLMYTDAKLYMHRKKNVFNMMI"
FT   gene            415338..417662
FT                   /pseudo
FT                   /locus_tag="CPF_0349"
FT                   /note="DNA polymerase III, alpha subunit, interruption-C;
FT                   identified by similarity to SP:O34623; match to protein
FT                   family HMM PF01336; match to protein family HMM PF07733;
FT                   match to protein family HMM TIGR00594"
FT   gene            418374..419333
FT                   /gene="pfkA"
FT                   /locus_tag="CPF_0350"
FT   CDS_pept        418374..419333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="CPF_0350"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02482"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82335"
FT                   /db_xref="GOA:A0A0H2YNH8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNH8"
FT                   /protein_id="ABG82335.1"
FT                   /translation="MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGLI
FT                   NGELFKMDRKSVSEIINRGGTILRTARCLEFKQEEVREKAAQILKAYGVEALVVIGGDG
FT                   SFMGAKLLSKLGVKTVGLPGTIDNDLSYTDYTIGFDTALNTVVDAINKLRDTSTSHERV
FT                   SIVEVMGRNCGDLALYAGIAGGAEAIIVPEMPFDKDELIKTILEGRTNGKTHSIIVVAE
FT                   GVGGSAELAKEIESVTGIETRATILGHIQRGGSPTADDIVLASRMGAKAVEVLLEGKTS
FT                   KVIGIKENRIFDMDIDEALDIERSFDESLYEMANAINK"
FT   gene            419427..420830
FT                   /gene="pyk"
FT                   /locus_tag="CPF_0351"
FT   CDS_pept        419427..420830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="CPF_0351"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82961"
FT                   /db_xref="GOA:A0A0H2YQ71"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ71"
FT                   /protein_id="ABG82961.1"
FT                   /translation="MRRTKLVCTIGPASENEEILTKIIEAGMNASRHNFSHGDHEEHKG
FT                   RMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDVIGDTT
FT                   KCSVTYAGLAKDVKAGDTILIDDGLVGLEVVSVEGNAVKCVVRNTGLVGTHKGVNVPGV
FT                   SIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLIANGGADIQIFSKIE
FT                   NQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQML
FT                   DSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLS
FT                   YELASSKAKKHIPAVPGVISRAACNAAHELKSAAIVSLTQSGATAKRISQCRPDAPIVT
FT                   VTPNERVAKKVALCFGVYPVVAENATMENAVEIAKNAGFVKANDTAVVVAGVPANEGNT
FT                   NIVKVEVVK"
FT   gene            421410..421766
FT                   /locus_tag="CPF_0352"
FT   CDS_pept        421410..421766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07561"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83946"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSH9"
FT                   /protein_id="ABG83946.1"
FT                   /translation="MTRLACSAHNCVNYVNGMCSALTIEVDGESAENKQETCCNTFAPR
FT                   TFVNAIKSAFNTNYAGTIMQALDSQEDVDHKIKCYAMNCTYNVGMTCTSTDIQVFGPEA
FT                   TTSTSTECETFYKK"
FT   gene            422075..422872
FT                   /locus_tag="CPF_0353"
FT   CDS_pept        422075..422872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0353"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84708"
FT                   /db_xref="GOA:A0A0H2YUD4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUD4"
FT                   /protein_id="ABG84708.1"
FT                   /translation="MNELGKIAVITGATSGIGKEYAFQLAKKGYDLILVGRRVEKIKTV
FT                   AEEIENNFKVKTHVEILDLTDDNKLDDFIKRLEKKDNIEFLVNNAGYGADDSFTRDEYS
FT                   KQYDMAKVHMLVTMKLCHSLSKKMKENNKGYIINVSSMAGFNVFPSSAMYCSTKAFLIS
FT                   FTQCLAMELLENNIKVQCLCPGFTRTDFHSKLNMEESKLQNKGFVRWMSTKEVVEISLK
FT                   NINKKLKVIVIPGFCNKFLYFVSKFTPRWLYYKVAIKGWELMD"
FT   gene            423044..424579
FT                   /locus_tag="CPF_0354"
FT   CDS_pept        423044..424579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0354"
FT                   /product="cardiolipin synthetase family protein"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82288"
FT                   /db_xref="GOA:A0A0H2YN47"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN47"
FT                   /protein_id="ABG82288.1"
FT                   /translation="MEKFLKKLLSRAFIVGFLIFIQFVILMGAIWKVSEDFIYVYFLFI
FT                   FISIVVFIYIVSRKDNPSYKLAWAVPVLLVPVFGGLFYLIFGGNKTSKKFRKQIKASYD
FT                   ETAHLLYNDRKVLDELEEQDKSIANQSRYIADYSQFPVYKNTTTEYLSPGEVFFERLKE
FT                   ELKKAKHYIFMEYFIVHEGVMWNSILEILEEKVKEGVEVRFVYDDMGCLGTLPYKYNEV
FT                   LEAKGIKCMVFNPFVPLLSLRMNNRDHRKITVIDGHTGFTGGINLADEYINEIVRFGHW
FT                   KDASIMIKGDAVWNLTVMFLQIWNFYSERKEQYEKYYPYFHHEDEFESDGYVQPYGDSP
FT                   LDDEIVGENVYLNIINKAKDYVYINTPYLIIDNELVTALTLAAKSGIDVRIVTPHIEDK
FT                   WYAHIVTRAYYPQLIESGVKIYEYTPGFIHSKTFVSDDEIGIVGTINMDYRSLYLHFEC
FT                   GVWLYKTKSVGQIKDDFLKTLEKCQRITLEDCAKVKVPTRILRSIIRVFAPLM"
FT   gene            complement(424786..424944)
FT                   /locus_tag="CPF_0355"
FT   CDS_pept        complement(424786..424944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97334; match to
FT                   protein family HMM PF07561"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82923"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQT0"
FT                   /protein_id="ABG82923.1"
FT                   /translation="MKHNSSIGCTVHECKYHCNEDNYCTLNKIEVVKHTAEASSTECTD
FT                   CGSFERK"
FT   gene            425211..426773
FT                   /locus_tag="CPF_0356"
FT   CDS_pept        425211..426773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0356"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83926"
FT                   /db_xref="GOA:A0A0H2YSB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSB0"
FT                   /protein_id="ABG83926.1"
FT                   /translation="MFKNLTFNENEKKYIQIARYIRELINRGVLIEGSKLPSSREISSI
FT                   LSIGRNTIMSAYEILESEGFVETIKGKGTFVKKEFSNEKSTKVSSIKKENSEIKEDNKW
FT                   NIDWKYKTNEYGVLAESLDIIKSEEKWEKGMISFKSIAPPGNLFNIEELKRSFSNRIAL
FT                   EKHKIVNYGYAVGYKPFIYYLKDYMKEKGAYSEEKEVIVTNGFTEGLDMILSAFTKEGD
FT                   YILCENPTHNTALKIMKTHKLNIIGVKMTKDGMDIEDLNKKIKKFGEKIKFSYLIPSYH
FT                   NPTGVVASIKKREEVYNILKNAGIPIIEDGFNEELLYESSPTIPLASLDRESNGVIYIG
FT                   SFSKILFPGLRIGWVYGDKKIIGILESVKRCRNIHTSFLDQGILYDFMISGAFEKYIKK
FT                   VRKVYKEKYKFTKKVIEKYIKEAEIWGEGGLYMFLKIKGVDTRELLKRCYDRGVLFMPG
FT                   DLFYIDNDLYLEKENRVFSLEEHNIKGREKRDTLRIGFTRLSEEEIEKGIKIIGEEVRS
FT                   ILT"
FT   gene            427075..428442
FT                   /gene="rumA"
FT                   /locus_tag="CPF_0357"
FT   CDS_pept        427075..428442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="CPF_0357"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84618"
FT                   /db_xref="GOA:A0A0H2YVC9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVC9"
FT                   /protein_id="ABG84618.1"
FT                   /translation="MVEKNKEYIFDIISQGYEGEGIAKIDNKYPIFIEGALKGEKVKVR
FT                   IVKVNKNFAYGKLMEVLEASEERVNPPCAIYKRCGGCKLQHASYKAQLDFKWDRVKDCV
FT                   SKIGKLDPSIVKYPLGMEEPWRYRNKVQLPIGLINGEVKIGFFAPRSHDIIDMESCLIQ
FT                   DEIGDKVVKLTREWIEKFNIRPYNVDGEYDEKGIVRHIMIRRGFTTNEVMVVLVTNGEK
FT                   LPHKEEFVDLMVKNIPGIKSVIQNINSKKTNVILGLESKTLWGEDTISDYIGDFRFNIS
FT                   PLSFFQVNPTQTEVLYGKALEYANLTGNEEVFDAYCGTGTITLFLSQKAKKVYGVEIIP
FT                   QAIDNAWINAKENKVENVEFFVGESEVVIPDLINKGVKADVVVVDPPRKGCDKKLLDAI
FT                   TNINAKKIVYVSCDPSTLGRDLAILEENGYKTLEVQPVDMFPNTSHVENVAKLIKK"
FT   gene            complement(428816..429070)
FT                   /locus_tag="CPF_0358"
FT   CDS_pept        complement(428816..429070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPB0"
FT                   /protein_id="ABG82667.1"
FT                   /translation="MVPVKLSGYFFEFYVSLQLYSPQKVIPKHPPQTRLSWYTPQIIEL
FT                   IFSPFSRGFHYPFSFSTFRDFRNCLTSSPFFSLSNPYIF"
FT   gene            429345..431828
FT                   /locus_tag="CPF_0359"
FT   CDS_pept        429345..431828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAB85057.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83313"
FT                   /db_xref="GOA:A0A0H2YQP9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQP9"
FT                   /protein_id="ABG83313.1"
FT                   /translation="MANLVPSIDEIENSKPYPEDGEIYLIKYLKENLDDSYEVYFQPFL
FT                   NGDKPDIIIMKPNVGVYIIEVKDWNLEHYTYLRQYPNKMEEIYLNKNGTRLRTPFQQVE
FT                   KYKKNLFGFYSNKLIERKVYNKNYYGVVKCGVYFHLHSENYLKQYFSLENTMTLNYIKV
FT                   WGNNSHIIEDIKSWAEDIKNVLFDKDIYEELLILLKPQIHTEDMGQYLTFDKSQLELCK
FT                   SSHNKQSKIKGVAGCGKSLILARRAVNAVKRTGSQVLILTFNITLRNYIRDRISIIREN
FT                   FNWNKFEINHFHLFIYQKINQYNGEIIWDDFEDAELDQFNKDKFYNSVVDSLECIKDKI
FT                   KKYNAIFIDEGQDYDKKWFDIVKKYFLAPDGEFVIFADEKQNIYHRAEIDKDKKITTNI
FT                   PGRWNELNKSFRIGKEISKLACEFQKEFLKEKYNLDKIEVANEQLAFNIEQNLGVNLRQ
FT                   DIVFNCMNKLEYIEIFKDIREYAKKNRIGYNEICFISGNIKGLRKLEYDLRNTYLINSE
FT                   ITFEKEEEYLKIKDSLNSNLQLIEIRRARKYNFQMNSGKLKISTIHSFKGLEIDNLVLI
FT                   LDEDSDEKISDELIYTAITRCKKNLFIYGVEDSKYYRFLSENCKKVNNLKSKDKKDSFK
FT                   KLDSLILRTLLAGESMLYLDMSDFLDYAINKTIFIEDKITYFENFDEVIFEVIRECIIN
FT                   TQFKTGKDKFYTIFGSCTNVGNKVSSKQNKLFSFGDNLLSDLKYYHVYYNGYIRTTFNI
FT                   LFYGHNDGALEEYRSFDIDDVITRFKYYLELFSINKLRYSYEDCTFGEFDEKKERELEH
FT                   IKRLMIKAHCGKTHF"
FT   gene            432083..432409
FT                   /locus_tag="CPF_0360"
FT   CDS_pept        432083..432409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQR9"
FT                   /protein_id="ABG83218.1"
FT                   /translation="MSSFINSNIELVNNINTVLKKKKNSFINIVNDKLTLSVFSLLEKN
FT                   LSNVKDINFLIRDTRSIPSNHEISREFQIDINPNDMLFNSYDIIEKNKLKHLLKRSLCM
FT                   TIYI"
FT   gene            432472..434523
FT                   /locus_tag="CPF_0361"
FT   CDS_pept        432472..434523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0361"
FT                   /product="type III restriction-modification system, Mod
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82425"
FT                   /db_xref="GOA:A0A0H2YNX3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNX3"
FT                   /protein_id="ABG82425.1"
FT                   /translation="MSNFEKVPVGILNKVENNKQIFIAEFKDKLQEVFPSAVKDGIVDF
FT                   EALLNEFGKYAETDEKEKYNMTWVGKKEAIKTANEDIIGKTLKYVSEDSKDSETTQNLY
FT                   IEGDNLEVLKLLRNSYYGKIKMIYIDPPYNTENDFIYKDNFKIDKEKYEKLEGSIDEYN
FT                   ERLTASKKGSGRYHSDWMNMIYPRLKVAKDLLSDDGVILISIDDNEVVNLKKICDEIFG
FT                   EENFIANLVWEKKKKGSFLAKSITNIKEHILVFSKVKDYFDGLIGEINDNQETYPCVNA
FT                   SNKREIRIIPKGIISKFKEKDYILNKGSIISSGTMNLILHSDLIIKDGKLANELVIEGN
FT                   WRYSQEAMYEYAINRELYLTQDLYIRRIVSEVRYKALKDLLPRVGKDKNSVNLNLKDLF
FT                   ESGWSSNEDADDEMRLLMGIQGLIEYPKPTKLIMKIIASYRKKEFIILDFFSGSATTAD
FT                   AVMQLNSEDNGNRKFIMVQLPELCNEKSEAYKNGYKNICEIGKERIRRAGEKIKEENKD
FT                   KEGIESLDIGFKVFRVSDTNIRWISEAIKSNDGVEEKDIITQEELRENESYKDRLDFNP
FT                   WFTDLDVVYEMMLKRQDIELTERIEKLAYIGDRTYLVGYTILVCLEENITKEMVRKISE
FT                   IETSLSWIVFRDSAFDDDINLKTNTINLLRTLIKEKNPRNKNQKILWI"
FT   gene            434536..437700
FT                   /locus_tag="CPF_0362"
FT   CDS_pept        434536..437700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0362"
FT                   /product="type III restriction-modification system, Res
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84399"
FT                   /db_xref="GOA:A0A0H2YUV7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUV7"
FT                   /protein_id="ABG84399.1"
FT                   /translation="MSKSVKFKFEKNLPHQDKAIDSVVSLFSDVDKSIDNSVYSGTINA
FT                   IREKLQGEIVDRRNNQISNGKKLRDNLRKIQSNNGLILNDEVETDNNTLTFTIEMETGT
FT                   GKTYVYLKTILELYKKYDGKFKKFIIVVPTVPIRMGVEKSIEMLNEHFSEQFDGLDISK
FT                   HVFIYNSKLKDVAESVRRKFIDSQDLSILVMNTQAFNKDTNILRNTDHEKNTENISVWD
FT                   EIRQLHPVVIIDEPQKFDGGKNSKKRTSSLSAIDEIQPTFTLRYSATHNEIINPTYKLD
FT                   SYAAYRDKLVKRIKVKTVNKLVPTDFPYIRYLEFTKDLYAKIEIFYAEQGKEITKKTFK
FT                   VRQDSNGNIFELSGDLPQYRNFRIAENPFKGKSLKIETSDRLVEINEGDCLSPFSEKEN
FT                   VRIQMKIAIQSHLEQQFNLLESGQKIKALSLFFIDRVSKVRGEDGEDGEYLKIFDSVYN
FT                   EVISDPTYNKIFEKYPDYFKEYKDTKKVRQGYFAIDKKKGSTIVKEIEGWNEDGNDSSI
FT                   SLKAKDKEYIERGIELILEKKDGLISFEEPLAFIFSHSALREGWDNPNVFTLCTLKNSS
FT                   NSIAKKQEIGRGLRLPVDTEGNRCKDESLNVLTVVANDSYDHFSEKLQQSYDEESGFNK
FT                   DEVTNDVINIVFKKAGIPIEKITSELTTAFRNELRENGLIDKNDILKKDAEEKFSEIQF
FT                   KNETLKEHSANIRKEFVNQMKSKGSKKINIENGDLTPVKNKMQSYVKEADFKRLLKGIN
FT                   ERLAQKTIYKININKDNFIEDCIKEINNTLHCKEISNIVEHSEGMHYIDENNKAKFEKS
FT                   TEFITEEVVENIQVKSDFEIINYIMVGTELPRMTISKILKEIKNRKILNSQDYLDDVMM
FT                   IIKEIFIRHQVKDKISYELLNGYKFDSKTIFSIDEINATELNDPKIITYKANSLKRKAI
FT                   NEYYKFDNEKELEFAQSLENDPNILLFTKIKKGGFVILTPYGNYSPDWAVVYKNNYGKA
FT                   EIYFIVETKFDKKEADLSEVEKFKIHCGKEHFKVVSKNSEDYVKFDWANSYEQFKEESS
FT                   KVKVMQ"
FT   gene            438159..438710
FT                   /locus_tag="CPF_0363"
FT   CDS_pept        438159..438710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84224"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTW7"
FT                   /protein_id="ABG84224.1"
FT                   /translation="MSNLDCFLSLLIGNFDNSEQFKDFENNGVKDFPFAEHVNTICNNK
FT                   IKNLPENFKGKFLLEESYYTSNGKTHASPHLFLFTEETKGIKLTSYEIPEGYDKKSFNY
FT                   ENMNLIDYSDLKISEKFTPAFYVFKENFWEGGSVSNFSPIMKFTLFERFSEKQLEVSET
FT                   IEVNGKRTFGYDDPIIYKRK"
FT   gene            438829..439407
FT                   /locus_tag="CPF_0364"
FT   CDS_pept        438829..439407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0364"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83572"
FT                   /db_xref="GOA:A0A0H2YSV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSV8"
FT                   /protein_id="ABG83572.2"
FT                   /translation="MAQQYTKKMIRSVFIELLNERPLNKITVKDIASACGINRNTFYYY
FT                   YSDMYELLSELFQTELQNVIDEYNDTMSWEESFVLATRFALGNKKVIYHVYNSMQREEL
FT                   VNYIYNVSGNMMERYVKKLSHGINASEYDMKLIATFYQCALTEMVIQWISSGMKEDPDA
FT                   IIRRIGKLFDGNIKLSLQRSEEFNKIGEK"
FT   gene            439756..441549
FT                   /locus_tag="CPF_0365"
FT   CDS_pept        439756..441549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0365"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06100"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84860"
FT                   /db_xref="GOA:A0A0H2YUS6"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUS6"
FT                   /protein_id="ABG84860.1"
FT                   /translation="MKLKTHDDRLTLTNGSYHALVHARKPKGIENKSAYLIGTGIGALA
FT                   AGCFLIRDAHMDGSKITFFEQLDLPGGSLDGEVLQNLGYVARGGREMGHHFEVLWGLFS
FT                   SLPSTEDPNMTVLDHFFYTNYDDPNYSNCRITHKNGERYDNAKFNLGQDLAKELAEFVL
FT                   IPDEELQDKSIDEIFSEELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVGGLPT
FT                   LSALQFSRHDQYTSFVKPMVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIVAKDKN
FT                   GKDISVNLTENDLVFITNGSMTEGSGYGDDNTPAPFNKEPQGCWELWRNIAKQSDEFGH
FT                   PDKFCTDTEKSNWESCTVTCHDERVPKYIEKITKRSPYGGKTVTGGIVTAVDSSWLMSW
FT                   TINRQEQYYGQPEKDVVVWVYGLFSDVDGDYIKKPMRDCTGKEITKEWLFHIGVPVDEI
FT                   EELAESCTAIPVMMPFITSQFMPREFGDRPYVVPKNAVNFAFLGQFAETLDDPGRDTVF
FT                   TIEYSGRTAMEAVYVLTGVEKGVPEVYASRYDIRYLLNAGVCLLDGEKPKLDLPPLAKR
FT                   KVMKQIAGTDIEKLLKEYGII"
FT   gene            441948..443681
FT                   /locus_tag="CPF_0366"
FT   CDS_pept        441948..443681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0366"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84543"
FT                   /db_xref="GOA:A0A0H2YV68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV68"
FT                   /protein_id="ABG84543.1"
FT                   /translation="MKLILKYLKNYKSIFILNVISVFGFALVELGIPTIMAKVIDIGII
FT                   NNDISYIKKMGLVIVVISIVGVMGTILLGYCSSKISTGITKDIRNDIFKKAQEFSHTEY
FT                   DEFGVSSMITRTTNDPFVILQFTNTLLKMALITPVMFTISLVMILKTSLSLSLVLAVVI
FT                   PIIILGVILIAKTSEPLSEKLQKRLDKLNRISRENLTGIRVIRAFGNEKYEEKRFDETN
FT                   ESYAEVAKKLNKLMAISQPLFFFLLNIAIIVIFWISSKMINVGTLQVGQLVAFIEYLFH
FT                   AMFSIMLFSMVFVMYPKAQVSANRIMEVLNTEPIIKSPKNGIKDTENKGTIEFENVSFT
FT                   YPNGEEPVIKDVSFSGKKGEVIAFIGSTGSGKSTLINLIPRFYDVTKGSIKIDGVDVRD
FT                   YDLKYLRKKIGFIPQKTLLFTGSIANNIKFGKKDAEYKEVEDSAKIAQAYEFISNKPNK
FT                   FDEIITEGGSNVSGGQKQRLSIARAIVRKPDIYIFDDSFSALDFKTDAILRKELRAETK
FT                   DAIVLIVAQRIGSIMDADKIIVLNEGEVVGIGTHKELIKNCPIYHEIATSQLTEEELAN
FT                   E"
FT   gene            443674..445455
FT                   /locus_tag="CPF_0367"
FT   CDS_pept        443674..445455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0367"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83921"
FT                   /db_xref="GOA:A0A0H2YTP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTP8"
FT                   /protein_id="ABG83921.1"
FT                   /translation="MNKFKSVVKKISPFVGKYKWAFLGAILFIISAAVFTAIAPRTEGL
FT                   IITQLTKDFEGIIRGVSGASVNFNYIFKVLILLFLVYAGGTGSTLIASFLLTNAIQNTM
FT                   KNIRNEVEKKINRLPIRYFDGNSYGDVLSRITNDVDTISNALQQSFVQVINAFLSVGLA
FT                   LIMMYSINIKLALIATLIIPLSILITKIIVSKSQKLFNSQQKALGNLNGKVQEMYTGFN
FT                   ELKLYGKEDDALNEFVKVNEELRETGFKAQFISGIMSPLISLVTYLGIAVVGVVGSIIA
FT                   IGGGITVGNLQAFIRYIWQINQPLSQVTQLSSAIQSAVAAANRVFEFLEEEEEVKDPNN
FT                   AIKIEKPKGDVTFDHVKFGYKEDKPLIKDLSVDVKSGHMVAIVGKTGAGKTTLINLLMR
FT                   FYDVQGGSIKIDGVDIRDMKREDLRSMFGMVLQDTWLFNGTIYDNIRYGRFDATKEEII
FT                   EAAKVANVHHFIKTLPGGYNMLLNEEASNVSQGEKQLLTIARAILKDPAILILDEATSS
FT                   VDTRLELLLQKAMRNIMKDRTSFVIAHRLSTIRSADLILVMNDGNIIEQGTHEELMKQG
FT                   GYYESLYNSQFASKEVN"
FT   gene            complement(445536..445934)
FT                   /locus_tag="CPF_0368"
FT   CDS_pept        complement(445536..445934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0368"
FT                   /product="rubrerythrin family protein"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82991"
FT                   /db_xref="GOA:A0A0H2YQY5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQY5"
FT                   /protein_id="ABG82991.1"
FT                   /translation="MKQNENEVLLKLQQGELDAVLVYRKLAELASSEEEKNVLLSIAAD
FT                   EGRHASIIREYSKEILKPCNKSSEEIEAAYKNLGKEKVFEMLINAEINGGPVYEKLGEE
FT                   FPRLKEIAKDEIKHGNLLKVLIGKSNLN"
FT   gene            446200..447228
FT                   /locus_tag="CPF_0369"
FT   CDS_pept        446200..447228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0369"
FT                   /product="glycosyl hydrolase, family 25"
FT                   /note="identified by match to protein family HMM PF01183;
FT                   match to protein family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82669"
FT                   /db_xref="GOA:A0A0H2YQ22"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ22"
FT                   /protein_id="ABG82669.1"
FT                   /translation="MEGRNSNNLNGIDVSNWQGNINFKSVKNEGIEVVYIKATEGDYFK
FT                   DSYAKQNYERAKAEGLKVGFYHFFKPNKNAKRQAKYFIDYLNEIGATDYDCKLALDVET
FT                   TEGRSAYELTTLCIEFLEEVRKITNREVVVYTYTSFANNNLDNRLGVYPLWIAEYGVKA
FT                   PKDNRVWSSWIGFQYSDKGNVAGVSGNCDMNEFKEEILDVKNNFKLYNATTKNVSTYLN
FT                   TREKGEIDSKIIGKIPAGEKFMIKWVDSNYLGWYLIEYKNITGYVSSKYVEKFQMATTY
FT                   NVSDFLNVRERGTTDSKVVAIIDDGEIFRIDWVDSDYIGWYRITTKYGKNGFVKADFVK
FT                   KI"
FT   gene            447486..447884
FT                   /locus_tag="CPF_0370"
FT   CDS_pept        447486..447884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0370"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83443"
FT                   /db_xref="GOA:A0A0H2YR82"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR82"
FT                   /protein_id="ABG83443.1"
FT                   /translation="MENIINYIKWGIVSLGTLFTWIFGAWDIPLITLLVFIFLDYLTGV
FT                   IKGCKSKELCSNIGLRGITKKGLILVVLLVAVMLDRLLDNGTWMFRTLIAYFYIMNEGI
FT                   SILENCAALGVPIPEKLKQALKQLNNKK"
FT   gene            complement(447929..448999)
FT                   /locus_tag="CPF_0371"
FT   CDS_pept        complement(447929..448999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN83046.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84127"
FT                   /db_xref="GOA:A0A0H2YU77"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU77"
FT                   /protein_id="ABG84127.1"
FT                   /translation="MNSMYDVAIIGLGPAGSTLARLLSKEFNIIAIDKKYTINNGFQKP
FT                   CGGLLSSHAQEAFAKFDMTIPKDILVDPQIFAVKTIDLDSNLIRHYQRFYLNLNRHKFD
FT                   LWLKSLIPSNVEIHNNSTCSKIEKVTDGYKITFFEDGSEHIIKAKYLVGADGANSIVRR
FT                   TIYPTKKIRTYMSIQQWFAEEHENPFYSCIFDEENTDCCSWSISKDNQFIFGGAYPLNN
FT                   PREKFENQKKKLEKLGFKFGEPLKTEACLVLRPSKYSDFCCGKDNAFLIGESAGFISPS
FT                   SLEGISSAINSANYLSEILNSNSKNPNKKYRFKTFKIRLKIFSKLFKCPFMYNRFLRKI
FT                   VLKSRLQSISIISSKK"
FT   gene            complement(449260..450180)
FT                   /locus_tag="CPF_0372"
FT   CDS_pept        complement(449260..450180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0372"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83116"
FT                   /db_xref="GOA:A0A0H2YRR2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRR2"
FT                   /protein_id="ABG83116.1"
FT                   /translation="MRKIKHKGFLIALVSALIISSSFIACDMKGNKSNVESEKANLENN
FT                   TQKDEASSNKENPTDNTSEKSNSNAEATNNRFEGLKTTSEDMNIPVLCYHDVTPNNPNN
FT                   NELLVNPEKFKEQLQYLKDNNYTPITLDELYDYLRNNKPIPEKSVVITLDDGYKGNYEY
FT                   AYPLLKEFKFPATIFVISNYVGAQDYMTADQLKEMSNNGIEIESHTFKHDDLSTLDESK
FT                   QLETLKDSKVALEKIIGKPVDFVAYPFGRYNSSTRVAAEKAGYKLGFNLNGNFTDRKDN
FT                   NFNMDRIYVSNNDSLQKFESRLTGR"
FT   gene            450585..451403
FT                   /locus_tag="CPF_0373"
FT   CDS_pept        450585..451403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0373"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84671"
FT                   /db_xref="GOA:A0A0H2YV18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV18"
FT                   /protein_id="ABG84671.1"
FT                   /translation="MSKIIDGRFSDKVMIITGAAGGIGKAVALRAAKEGAKLVLADRKE
FT                   EMSKETLKEIREITSNVEFLICDLREGENCKKVIDTAIKKFGGLDILINNAGITGTPAP
FT                   VHEMSEEMFRNVLDCNIMIAFHCSHYGIQEMIKQNKGGAIVNVSSVAGLTGFPGHSAYV
FT                   TSKHGLNGLTRNMALDYARYGIRVNAVNPGTTDTPMYHEALEFLKNKRESAEKAGVKIE
FT                   GGIVSGKVTSPQNRVARAEEVADVILFLSSPEASNVTGIFMPVDGGFTAF"
FT   gene            complement(451426..452157)
FT                   /locus_tag="CPF_0374"
FT   CDS_pept        complement(451426..452157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0374"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84915"
FT                   /db_xref="GOA:A0A0H2YVH4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVH4"
FT                   /protein_id="ABG84915.1"
FT                   /translation="MEILTVNKHKELLYVTVYDKLFKMINEGTFPENSRLPSEPELAKR
FT                   LGVSRSTLRQALALLQDDGLIKNIRGKGNYIIKENKTDTTGLEKIGHPVYKCLDVETNN
FT                   IELDFKIDPPSDYYKKILGDSSVATVCIDRWYLNDNLALAYSYTIISIEAISKFNIDLS
FT                   DKNNLLKFIEEESYKECSKIKSTIKFTTSGNFVTKRRPIPDESQFYLIEEAIYSNSELP
FT                   VIFNKHYLPMKHSTIKVNPMK"
FT   gene            452392..453177
FT                   /gene="udp"
FT                   /locus_tag="CPF_0375"
FT   CDS_pept        452392..453177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="CPF_0375"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /note="identified by similarity to SP:P12758; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01718"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84287"
FT                   /db_xref="GOA:A0A0H2YTA6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTA6"
FT                   /protein_id="ABG84287.1"
FT                   /translation="MIYTQGSDKQFHIDVAPGEVGKYVIMPGDPKRCAKIAKYLDNAKL
FT                   VADKREYVTYTGYLDGEKVSVTSTGIGGPSAAIALEELVKCGADTFIRVGTCGGIDLNV
FT                   KGGDLIIATGSIRAEGTSREYAPIEFPAVANLDVINALVKGAKELKVPYHTGVVQSKDS
FT                   FYGQHSPETKPVSYDLLNKWEAWKRCGCLGSEMEGAALFIVGSYLRVRVGAVFLTIANQ
FT                   EREKEGLDNPQVHDTELAIKAGIEGIRNLIKEDKMKNNA"
FT   gene            453344..454534
FT                   /gene="deoB"
FT                   /locus_tag="CPF_0376"
FT   CDS_pept        453344..454534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="CPF_0376"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="identified by similarity to SP:P46353; match to
FT                   protein family HMM PF01676; match to protein family HMM
FT                   PF08342; match to protein family HMM TIGR01696"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83289"
FT                   /db_xref="GOA:Q0TU57"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU57"
FT                   /protein_id="ABG83289.1"
FT                   /translation="MSKYKRIFTIVIDSLGIGAMNDSEKYGDVNVDTLGHIAESVDTFN
FT                   IPNLQKMGIANLHPIKHVAPVENPIGYQAKMAEASVGKDTMTGHWEMMGLHITKPFKTF
FT                   TDTGFPQELLDELTARTGHKIVGNKSASGTEILDELGEHQIATGDMIVYTSADSVLQIC
FT                   GQEETFGLEELYRCCEIARELTLKDEWKVGRIIARPYLGTKKGEFKRTSNRHDYALKPY
FT                   GRTVLNELKDNNFDVISVGKIKDIFDGEGITEGNKSKSSVHGMEQTLEIMDRDFTGFCF
FT                   VNLVDFDALWGHRRNPQGYAEELEKFDVNLGKVLEKLHEDDLLIITADHGNDPTYTGTD
FT                   HTREYVPFLAYSPSMKGHGQLETPKTFATIGATIADNFGLKMPEGTIGESVLNKLV"
FT   gene            complement(454962..456407)
FT                   /locus_tag="CPF_0377"
FT   CDS_pept        complement(454962..456407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0377"
FT                   /product="putative arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF01490"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83796"
FT                   /db_xref="GOA:Q0TU56"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU56"
FT                   /protein_id="ABG83796.1"
FT                   /translation="MNDNKKLGVIALAGVVISAMLGGGVYNLPQNMAQSASAGAILISW
FT                   IITGIGIWFIANTFRILAAARPDATTGIYTYGELGFGKFTGFLMAWGYWICNSFANVGY
FT                   AVLLMDSLNYFFPPYFKGGNNWLSIACGSLVLWIIFFIVLAGVKQASALNVIGTIGKLL
FT                   PLAIFLLVLLFSFRFSTFFTDFWGLKTVAKVHDTNLGGILPQVKSTMLVTLWVFTGIEG
FT                   AVVVSGRAKSQKDVSKATFLGFITCLLIYTLLSLLPLGVYSQGEISKMAPPSTAAVLMD
FT                   LIGNWGSVIMNLGVIIAILSSWLIWTVMLSELPFAAAQSGTFPKIFAKENKNESPSFSL
FT                   LASTIIMQIILILVHFAGNAWNMMLSITSVMALPCYLVSTLYLFKITYKNENYPTDIFA
FT                   KRKYAMITAILGSIYGVWLIYAAGINYMLIAIVIYALGIPVFIKARRETSPNEKEFTKV
FT                   ERYFAIVLIILALIGLVYLFKFM"
FT   gene            complement(456453..457415)
FT                   /locus_tag="CPF_0378"
FT   CDS_pept        complement(456453..457415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0378"
FT                   /product="histidine decarboxylase, pyruvoyl type"
FT                   /EC_number="4.1.1.22"
FT                   /note="identified by match to protein family HMM PF02329;
FT                   match to protein family HMM TIGR00541"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84693"
FT                   /db_xref="GOA:Q0TU55"
FT                   /db_xref="InterPro:IPR003427"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="InterPro:IPR016106"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU55"
FT                   /protein_id="ABG84693.1"
FT                   /translation="MNKNLEANRNRTLSEGIHKNIKVRAPKIDKTAISPYDRYCDGYGM
FT                   PGAYGNGYVSVLKVSVGTVKKTDDILLDGIVSYDRAEINDAYVGQINMLTASSFCGVAG
FT                   QVWGHDLATHDSIANDEIKPLYELKQFDGTPLKVYDAKPLLEAGIELFGTEKNRRFTTA
FT                   PGAHVICANKSATAYRPKENRPLKEGEAYGVWSFIALSLSNDRDHCADLFIEDAGLWTK
FT                   NDNPEDLKKFLEDHRKAVTWSVVECGRDSHVVFERTYIGFAYVIMKPGEIGNALTCAPY
FT                   VTLARDAVPSEGFPSLNRISLSQWLDDMNFDSLVNPSKK"
FT   gene            457883..458716
FT                   /locus_tag="CPF_0379"
FT   CDS_pept        457883..458716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0379"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84702"
FT                   /db_xref="GOA:A0A0H2YVJ8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVJ8"
FT                   /protein_id="ABG84702.1"
FT                   /translation="MEILLGALGITLVTGFFYYENNGISTTNYEVDCGIGKDINVVHLS
FT                   DLHGKEFGKNNEKLKRSILKEKPDLVVATGDMIDSSLKNMEGVIDFLSDLSKCVKVVYI
FT                   SGNNEQRCKKAEYIFESLKSKGVIVLRNEIITLSLNGVKVNILGMFEKPKGDLHSSLKK
FT                   INGSYAYEDSHKLFKRLEGLEGLKIVLSHYPELFEAEYLKYDFHIMFSGHAHGGQFRIP
FT                   IVKRGLIAPGQGIFPKYTEGMHGNKNKLIISRGLGNSTKITRLFNRPEIVNVKIK"
FT   gene            458841..458993
FT                   /locus_tag="CPF_0380"
FT   CDS_pept        458841..458993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS83"
FT                   /protein_id="ABG83321.1"
FT                   /translation="MNKNMEMMKKLIEEKKNKGKNTKANVRAQKTIGFAQGGRKSNNGG
FT                   GLFDK"
FT   gene            459461..460324
FT                   /gene="garR"
FT                   /locus_tag="CPF_0381"
FT   CDS_pept        459461..460324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="CPF_0381"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="identified by similarity to SP:P23523; match to
FT                   protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84327"
FT                   /db_xref="GOA:A0A0H2YU45"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU45"
FT                   /protein_id="ABG84327.1"
FT                   /translation="MKKIGFIGVGIMGKSMVRNLMKNYFEVSIFARNKEKVLDVISEGA
FT                   NFYPTIKECVSGCDAVITIVGFPKDVEEVYFEENGILENVKEGTYVIDMTTSSPKLAVE
FT                   IFEKAKEKGLKALDAPVTGGDIGAKNGTLTILVGGEEEDYKACLPIFQAMGTNIHYEGK
FT                   AGFGQHTKLANQIMIAGAISGVCEAMAYAKDKGLDVKKMLDSVSTGAAGSKQLELVSPK
FT                   ILEEDFAPGFFIKHFIKDMKLAKEEALADNVNLDILSKVLENYEDLEREGFGDLGTQAL
FT                   IKHYNK"
FT   gene            460631..461536
FT                   /gene="nadA"
FT                   /locus_tag="CPF_0382"
FT   CDS_pept        460631..461536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="CPF_0382"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="identified by match to protein family HMM PF02445;
FT                   match to protein family HMM TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84870"
FT                   /db_xref="GOA:Q0TU51"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU51"
FT                   /protein_id="ABG84870.1"
FT                   /translation="MDIRNEILKLKKEKGAIILAHYYQIPEIQEIADYVGDSYYLSKIA
FT                   KDCEENIIVFCGVKFMAESAKILSPEKTVILPVMEAGCVMADMATADGLAKLKEEHPNA
FT                   KVVCYINSSTEVKALSDVCCTSSNAENIINNLEEKEIIFLPDRNLGSYIQEKTPDKKFI
FT                   LWNGFCIVHEAIQKEEILRLKSEHEGILTVAHPECSKEIRDISDFIGSTSEIINFVNNS
FT                   SNKKFIIITEEGVLHQLRKNGEEKEFYIPYGKMVCRNMKMTTLKDLYESLLKMENKIEI
FT                   DEDLRLKAYNSLKNMHKLGG"
FT   gene            461541..462860
FT                   /gene="nadB"
FT                   /locus_tag="CPF_0383"
FT   CDS_pept        461541..462860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="CPF_0383"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82433"
FT                   /db_xref="GOA:A0A0H2YNI1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNI1"
FT                   /protein_id="ABG82433.1"
FT                   /translation="MKRVADVLIVGSGVAGLYASLNLREDLEIIMVSKKSVNLCNSSLA
FT                   QGGIAVARGKEDFQSFIEDTLKAGKYENNIDSVRVLVEESMDNINKLIDLGANFEKDEN
FT                   GVLFTKEGAHEINRIVYHKDITGKHVEDILLENVKRRKNIKIIEDCEMVDIYHRDNRCI
FT                   GALFNKDGETLSIYAKVVILATGGIGGLFKKSTNERIITGDSIGVAIRNNIEIKDLSYI
FT                   QIHPTAFFSKKSEEKRFLISESVRGEGGKLINCNGERFVDELLPRDIVSKKIYEEMKKT
FT                   NSNNVFLDVSFMEKSFLQNRFPNIYNKCLEEGIDISKEPIPVAPAQHYFMGGIKVDLNG
FT                   KTSMENLYAFGETSCTGVHGANRLASNSLLEALVFSRRGALEINSYIDNLELIIEEREC
FT                   EDLDKYRLLNRKILIDEICRLRGDIKDELVTCGGECKKSS"
FT   gene            462817..463656
FT                   /gene="nadC"
FT                   /locus_tag="CPF_0384"
FT   CDS_pept        462817..463656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="CPF_0384"
FT                   /product="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82947"
FT                   /db_xref="GOA:A0A0H2YQU9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQU9"
FT                   /protein_id="ABG82947.1"
FT                   /translation="MNWLLVEENVKRALNEDLQYGDITTESVVLDHKIAKVDIIAKEKG
FT                   VIAGTEVFKMVFKILGDVEVDFSVNDGEEVEKGQHFGQVSGDAKKILMGERVALNYMQR
FT                   MCGIATLTREFVERLEGTKVKLLDTRKTTPNMRIFEKYAVKVGGGTNHRFGLNDGVMIK
FT                   DNHIEAAGGIKNAVSLARKNSPFVRKIEVEVESIEQLNEALEAKADIIMLDNMDIKTLK
FT                   EAVKLIDNRAEVEASGNVTLDNIMEIAETGVDFISTGSVTHSFKVLDISMKNFRYID"
FT   gene            complement(463973..465331)
FT                   /locus_tag="CPF_0385"
FT   CDS_pept        complement(463973..465331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0385"
FT                   /product="uracil-xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801; match to protein
FT                   family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83929"
FT                   /db_xref="GOA:A0A0H2YSG4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSG4"
FT                   /protein_id="ABG83929.1"
FT                   /translation="MEKQNLKNTEVNLIYGVDDDLDLPKKVLFGLQHIFAAFGGIIVVP
FT                   LVIATSLGFDSKVTTALISASILGSGLATIIQAKGVGKVGARVACIMGTDFTFVSPAIS
FT                   VGSVLGLPGIIGATILGSLFEVILSFFIKPLMKFFPPLVTGTVVALIGLTLLPVSIDWA
FT                   AGGAGSANYASLENLAVAMFVLVITLLLNNYGKGMISSASILIGIVVGYIVCIPLGLVD
FT                   FTPVKEASWLSFPKILEFGVTFDAKAVMAFIPAYFVATIGTVGCLKAIGETSNIDIGDK
FT                   RVAAGVLSDGVGSALGGLVGSCPNTSFSQNIGIISLTKVASRHVAVMAGILLVILGFLP
FT                   KVAAIITGIPNPVLGGVGIMMFGTVAAAGIRTLSNIKLTERNLLIIAISMGLGLGVTFR
FT                   PDVIHNLPEAIRMIFSSGISTGTIAALILNAVLKESPTSMEFENMYDEETKAS"
FT   gene            466007..466825
FT                   /locus_tag="CPF_0386"
FT   CDS_pept        466007..466825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0386"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by similarity to SP:P46354; match to
FT                   protein family HMM PF00896; match to protein family HMM
FT                   TIGR01697"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83242"
FT                   /db_xref="GOA:A0A0H2YQT8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQT8"
FT                   /protein_id="ABG83242.1"
FT                   /translation="MNLSKEIKEAYEYIKSKSKYSPKIGLVLGTGLGDLANEIEEAEYY
FT                   RYMDIPNFPVPTIAGHEGTLIIGKLHGREVIAMKGRCHYYEGHSMQRITLPIRVMKLLG
FT                   VETLVVTNCSGQAKESIEAGDLVVIRNHINFTGDNPLRGENLLEFGERFPDLAYPYDKD
FT                   LREEVKNIAKDLDINLKEGVYAMFSGPSYETAVETLMAASLGADVVGMSTVPEVIVANH
FT                   CGIKVLGFSGVPCLAAAYSEAEITHEEAMVNFQSITEKCTSIVKEFLKRY"
FT   gene            466915..467592
FT                   /locus_tag="CPF_0387"
FT   CDS_pept        466915..467592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0387"
FT                   /product="putative nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /note="identified by similarity to SP:P31215; match to
FT                   protein family HMM PF04973; match to protein family HMM
FT                   TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83448"
FT                   /db_xref="GOA:A0A0H2YR89"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR89"
FT                   /protein_id="ABG83448.1"
FT                   /translation="MELMKKFTSYTCSPIFVVVACAICLLVGFSINSSIIEIFASVIGI
FT                   INVWLLSREKVSNFIFGIITVVAYLYIYYNTGLYALAVLACFQVGFNIFGWYYWVKNSD
FT                   QEDNVVTSGLTKKGQILWTIIILAAWAVWGYVEINILHAQNAILDSLTAVLGLVAQYWL
FT                   SKKLYENWILWILSNILFIIIYILNGYYVMLILVAIQLILSISGLLEWYASFKEQGENK
FT                   LTL"
FT   gene            467626..468267
FT                   /locus_tag="CPF_0388"
FT   CDS_pept        467626..468267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0388"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84652"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUC6"
FT                   /protein_id="ABG84652.1"
FT                   /translation="MKSYELIEFINNCPKEIKKELKNRSFKYGEKLLVQNENCDFVYIL
FT                   LKGKIKTYHCDFTGAIYLEDIDSEATIFGELEALINKEVVTTVEALSQCETLEISKESF
FT                   IKWIELDNKFSLFISKLIAERNYECCKRERVNAFYNLRYRVMYIILNTLHKNNLGITKD
FT                   LLVEGVGSNIRSINRIINQLIEEGILDYNSGKIKVKSIEKLKEEVNYYKP"
FT   gene            468492..468809
FT                   /locus_tag="CPF_0389"
FT   CDS_pept        468492..468809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0389"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82211"
FT                   /db_xref="GOA:A0A0H2YN36"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN36"
FT                   /protein_id="ABG82211.1"
FT                   /translation="MQITDEKVKKNFVIRALKQIGTFFIFTMVFAIVFSFLQPRVYKTH
FT                   SEYIFIKEKYDNLQKEYDSLNEKISKDTNALNSKKEDLTKSNEDLQNKLNSLNKEIQSL
FT                   N"
FT   gene            468822..469433
FT                   /locus_tag="CPF_0390"
FT   CDS_pept        468822..469433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSJ2"
FT                   /protein_id="ABG83442.1"
FT                   /translation="MIKEIIKFIKTHKIALILALILGISPNLMVKDYSKEFNEVAPKVN
FT                   ELEYKIPALKNNTELKSIQEEIDKLQNENNTLSKEVEDKQKELDNLRAKKEEQVKIAQE
FT                   ESKKAEENSKNKGVENSNSTSNNNSKNTNKSSGDPSNLANSSGDSTPKTAGSGEIVYWT
FT                   SGGKSYHKRSNCTTLKRSKTIYSGTQAESGKSDPCNVCCR"
FT   gene            469640..470176
FT                   /locus_tag="CPF_0391"
FT   CDS_pept        469640..470176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35738.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83901"
FT                   /db_xref="GOA:A0A0H2YSC5"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSC5"
FT                   /protein_id="ABG83901.1"
FT                   /translation="MSDKKLFTIKTSINKKDYSRFLYIATFLRKKFTIPAIIVITALMA
FT                   GFVSYNNRIFELKSFLIYWLILLIITLFAIVVKIEFQSREREKADKSGILKSIETLEFF
FT                   EDILVIKSTAFKGKSKIKYYKFYEVIETKNYFIIYFNRRQASIIRKIDLEDSLVDELRN
FT                   LLTGKIGRKYKKLFK"
FT   gene            470911..472248
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0392"
FT   CDS_pept        470911..472248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0392"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83155"
FT                   /db_xref="GOA:A0A0H2YRU8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRU8"
FT                   /protein_id="ABG83155.1"
FT                   /translation="MKDLSRKDLLLVSLMLFSLFFGAGNLIFPPFLGQAAGNATWITIL
FT                   GFFVTAVGFPVLGVIAVAKSGGLHALASRVNPVFATFFTVLIYISIGPGLGIPRAGSLP
FT                   FEMAVAPFLPEGLISNNLALFIYTFVFFAVAYWLSLSPAKLVDRMGKVLTPSLLVLIGL
FT                   IFVASIFKPLGAYGEVTGVYKESPFISGFLDGYMTMDTIAALNFGIVIALVIKSKGVKE
FT                   EKFVVKTSVKAGIIAGGLLIVIYSMLAHLGATSGGRFGLTENGAQTLSNIITYIFGKPG
FT                   AILLAVIFTLACLTTCVGLITSCSQYFQTLTKKINYLSWVRILTLTSMVLANMGLNKIL
FT                   AVSVPVLNAIYPMAIMLIVLAMLDKYIKGNSVVYTTTIAFTTIVSVIHALSGTGINIEF
FT                   LNRIFENLPFYSEGLGWVLPALFGLGLGLVLKSFLEKNKEEVLEVS"
FT   gene            472504..473376
FT                   /locus_tag="CPF_0393"
FT   CDS_pept        472504..473376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0393"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84162"
FT                   /db_xref="GOA:A0A0H2YT01"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT01"
FT                   /protein_id="ABG84162.1"
FT                   /translation="MNKKNGRIYQVAYRITAIILFGALAGIGVNFFLTPAHIYSSGVTG
FT                   VSQLLSSIGGDFFNINIDISTWVLILNLPLAYLSYRKLGKKFTLYSFLSIISLSFFIGV
FT                   IPTRAVTNNQLLNSIFGGVLMGAGVGMCFRAGFSTGGTDIIVLVVQKMTGKSVGQLGFI
FT                   VNGIILLVAGLVYGWELALYSLVSIYVTTKVIDLFYIQQYKLTVTIYTKKEKEVVDSLI
FT                   KSQMRGVTIGRNLYGGYTNEPLSSITTVISKHELLIVKKNVMDIDPEAFVNIQPTVEVM
FT                   GNFYDNSLI"
FT   gene            473690..476701
FT                   /locus_tag="CPF_0394"
FT   CDS_pept        473690..476701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0394"
FT                   /product="polysaccharide lyase, family 8"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF02278; match to protein
FT                   family HMM PF08124; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84856"
FT                   /db_xref="GOA:A0A0H2YUV2"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUV2"
FT                   /protein_id="ABG84856.1"
FT                   /translation="MKESRKKLNRLISTAIVSCMVMGASYENVLALENKSQNNSEKVVK
FT                   YDNEAEYIKNIRLRWKEDLVGNSSLDTSNATISKKIISYTNNTDKLVAKLNMDPNAQWL
FT                   WEDLKDYKQNPARITSMFNNLVTMSMAYSLPNNKYYKNEDLKNKIIYSLDWINKNAYNE
FT                   NIDQYGNWWDWMIGIPARLNNIVVLMYDDLTEEQVKNYMNAIQKFLPSIEPGSKYHTGA
FT                   NLADVCMNKLLQGVNENDPEKIKEASEDIVGVFDYVTSGDGFYKDGSYLQHGMVAYTGS
FT                   YGNVLIEKISNIMFLLEKTPWSIKSESKDNVYKWIFESFNPIIYKGYVMDMVRGRAISR
FT                   YNANGYLQASGIIEGMIKIGMISDGDKASEINALVKKWATEAKSVLDFGARFKSINVIG
FT                   EFYGIMNNDNIKPLEEGDKHYALNSMDKTVHKRENFALGISRSSSRISKYEFMNKENLT
FT                   PWFQGDGMTYLFNNDLNQFSGNFWATVDPYRMPGTTVDTRKREPKEILPGLDPGASQQN
FT                   EIYYELGKSNWSGGSKLGAYGVAGMEIDNKYDSLKAKKSWFMFDDEIVALGSGITNPED
FT                   FETETIVENRKIKSDGSNKFIVDGKERVSKLKEKDKVDNAKWAYLEGNVSGSNIGYYFP
FT                   EGANINLIKDEREGNWINVNSSKPEADKVVKDNYLTMYIDHGKAIKDQKYSYVLLPNKT
FT                   EDKVKEYSENPNVEIIQNDDVAHSVKHKKLNIEAANFWKEGKNTAGNITSTGKSSIIIK
FT                   ENKDNTLSIAVSDPTFLEKNLSIEINKPAMEVIKSDKRISNINLENGKIKFDANTENLS
FT                   GAPLELLVKLGDKNNGNNENNNEIKNEAPVIEGEDANLFVGDKWDKSLHKLKAKDKEDG
FT                   DLTKNIKIKDNQIPLNDQFEVTKPGTYPVTFEVSDNNGKKAEKKLNVLVKEKEENKPEN
FT                   KPENQENKPEIKPEDQENQSTKPESEENKGENPQANNNTEKLPNTGGASNLSLGAIGVL
FT                   LATVGTMFTKKRKK"
FT   gene            476808..477638
FT                   /gene="kduI"
FT                   /locus_tag="CPF_0395"
FT   CDS_pept        476808..477638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="CPF_0395"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="identified by similarity to SP:Q46938; match to
FT                   protein family HMM PF04962"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84736"
FT                   /db_xref="GOA:A0A0H2YUJ7"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUJ7"
FT                   /protein_id="ABG84736.1"
FT                   /translation="MRNRYANNPKDSKRYDTEELRENYLVKDIFKDDQIELVYSHVDRI
FT                   IFGGIKPVYKELKLEAGKEMGVDYFLERRELGIINIGGKAIVTIDGTEYELKEKDGLYV
FT                   GKGNKEVSFKSVNPEEPAKLYVNSVPAHKEYETVKIDIEKANPVRLGDNKTLNKRTIYQ
FT                   YVHPNVCESCQLLMGLTMLEPGNAWNTMPCHTHERRMEVYFYFDMDEDTRVFHLMGEPT
FT                   ETRHLVVKNEECVISPSWSIHSGVGTSNYTFIWGMCGENKTFDDMDHISMDILR"
FT   gene            477654..478430
FT                   /gene="kduD"
FT                   /locus_tag="CPF_0396"
FT   CDS_pept        477654..478430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="CPF_0396"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01832"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82855"
FT                   /db_xref="GOA:A0A0H2YPW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPW2"
FT                   /protein_id="ABG82855.1"
FT                   /translation="MNMEKFSLDFFKLDGKVAIVTGGNTGLGMAYVEALAAAGADVLVT
FT                   TFDNNTEEVKNIVESLGRKIVFVQGDLTKKETRDKVVSTCLEEFGKIDILVNNAGTIRR
FT                   APLLEYKDEDWQAVMDINLNSVYYLSQAVAKVMAKQGYGKIINIASMLSFQGGKFVPPY
FT                   TASKHGVAGITKAFANELADLNIQVNAIAPGYIKTANTAPIRADKARNQEILSRIPAGR
FT                   WGEVSDLMGTVVFLSSKASDYLNGHILAIDGGWLVR"
FT   gene            478427..479068
FT                   /locus_tag="CPF_0397"
FT   CDS_pept        478427..479068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0397"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83465"
FT                   /db_xref="GOA:A0A0H2YRA7"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRA7"
FT                   /protein_id="ABG83465.1"
FT                   /translation="MIKKIKTLTNLINEAFVLVLRTNTKDEGIETAKAAIKGGCNIIEV
FT                   TFTIPNADKVIEELIKDKNEEVVIGAGTVLDAETARIAILAGAEFIVSPSFDKETATLC
FT                   NRYGIPYIPGCFTPREIKEARECGSDVIKLFPGSAFKPTIVKDLKAPIKGIAVMASGGV
FT                   SFENMDEWFNNSCDIVSIGSAIIKLKDPAKIEAETRKYIERVKKLRMQRG"
FT   gene            479072..480091
FT                   /locus_tag="CPF_0398"
FT   CDS_pept        479072..480091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0398"
FT                   /product="kinase, pfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83724"
FT                   /db_xref="GOA:A0A0H2YRZ1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRZ1"
FT                   /protein_id="ABG83724.1"
FT                   /translation="MKKVLVLGEMLMRLTPPNNNKIGQANSFNVCFGGAEVNVAVGLSN
FT                   LGIETRVLTALPDNEIGNFAKSFLKSQYVDCDFIISKGDRLGLYYYEEGCSARKAKVVY
FT                   DRKHSSITELQYEDIDVESLFKDVELLHISGITFGLSEEVSEVALKLVNEAKKRGIKIS
FT                   VDLNYRSKLFESYEEFVRIMKPVVQDAYLCFGWLNREDEPFKVLDASTTELSDEDFIER
FT                   FRYTIEDLKVKNIVTTLRSGTPYNYHTLQGVFYDGERVYKSSKYDFSMISRIGGGDAFA
FT                   AGVIRTLIENKGEDLSHVIEFGTAAAVLKQTQLGDVSISSKEEVLDLINNKNLGSVNR"
FT   gene            480256..481086
FT                   /gene="kduI"
FT                   /locus_tag="CPF_0399"
FT   CDS_pept        480256..481086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="CPF_0399"
FT                   /product="4-deoxy-l-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="identified by similarity to SP:Q46938; match to
FT                   protein family HMM PF04962"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84449"
FT                   /db_xref="GOA:A0A0H2YUZ6"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUZ6"
FT                   /protein_id="ABG84449.1"
FT                   /translation="MRTRYANNPRDSKRYDTEELRENYLVEDIFKDDQIELVYSHVDRI
FT                   IFGGIKPVYKELKLEAGKEMGVDYFLERRELGIINIGGKAIVTIDGTEYELKEKDGLYV
FT                   GKGNKEVSFKSVNPEEPAKLYVNSVPAHKEYETVKIDIEKANPVRLGDNKTLNKRTIYQ
FT                   YVHPNVCESCQLLMGLTMLEPGNAWNTMPCHTHERRMEVYFYFDMDEDTRVFHLMGEPT
FT                   ETRHLVVKNEECVISPSWSIHSGVGTSNYTFIWGMCGENKTFDDMDNIPMDVLR"
FT   gene            481103..482293
FT                   /locus_tag="CPF_0400"
FT   CDS_pept        481103..482293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0400"
FT                   /product="putative glucuronyl hydrolase"
FT                   /note="identified by similarity to GB:BAA84216.1; match to
FT                   protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82476"
FT                   /db_xref="GOA:A0A0H2YP09"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP09"
FT                   /protein_id="ABG82476.1"
FT                   /translation="MIKEIRVEEIAKKDEFLKTKLLTRAEVKNAIDLVIKQIDANMEYF
FT                   KEKFPSSATKNNQYGIIENIEWTDGFWTGLLWLAYEYTGDEKYRELADKNVASFKNRVE
FT                   KDIELDHHDLGFLYSLATVSGYKLTGSEDAREASIKAANKLISRYQEKGEFIQAWGELG
FT                   SKDHYRFIIDCLLNIPLLYWASDETGDAKYRNIANKHFVTSCNNVIRDDASAFHTFYMD
FT                   NETGKPLRGVTRQGYSDDSAWARGQAWGVYGIPLNYRYTRNESCFNLYEGMTNYFLNRL
FT                   PKDNVCYWDLIFNDGDDHSKDSSAAAIAVCGMHEMNKYLPEVDENKEVYKYAMHNILRS
FT                   LMENYMNPEIEPGKPVLLHGVYSWHSGKGVDEGNIWGDYFFLEALIRFYKDWNLYW"
FT   gene            482310..482798
FT                   /locus_tag="CPF_0401"
FT   CDS_pept        482310..482798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0401"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84444"
FT                   /db_xref="GOA:A0A0H2YUZ2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUZ2"
FT                   /protein_id="ABG84444.1"
FT                   /translation="MGVNIEMMRIDERLIHGQGQMWLNSLGVNTVIVANDIASEDKIQQ
FT                   TLMKTVVPKSIAMRFFSIQKTCELIHKASPQQKIFLVCKTPEDALKLIAGGVPVKEINI
FT                   GNIHNAEGKEQVTRSIFLGKEDKDALRELSEKYNVKFNTKTTPRGDDGAMQVDITKYL"
FT   gene            482846..483637
FT                   /locus_tag="CPF_0402"
FT   CDS_pept        482846..483637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0402"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82202"
FT                   /db_xref="GOA:A0A0H2YNZ4"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNZ4"
FT                   /protein_id="ABG82202.1"
FT                   /translation="MEITLIQCILIGLWTAFCLAGMLLGLYTNRCIILAFGVGIILGDI
FT                   PTALAMGAVSEIAFMGFGVGAGGTVPPNPMGPGIIGTLMAITMKGQGMDPATALALSFP
FT                   FAVAFQFLITATYTFATGLTQFANKGIEEGNWIKFKIGANATIWVFAIVGFIIGFAGAF
FT                   STTGLQAAVEMIPAWLIGGLSVAGKMLPAIGFAMILSIMAKTELIPFVLLGYVCIGYLN
FT                   LPVMGVAFVGAIFALIEHFRGNNSNNSSDSNDEEVVFEGGI"
FT   gene            483627..484436
FT                   /locus_tag="CPF_0403"
FT   CDS_pept        483627..484436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0403"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84128"
FT                   /db_xref="GOA:A0A0H2YSX2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSX2"
FT                   /protein_id="ABG84128.1"
FT                   /translation="MESRVLTKSDYIKTSLRAFFLQNGFNYGNYQGLGYANILYPALKK
FT                   IYRNNEEGFKKALGENVEFFNSNPHFLPFITSLHLVMLDSGRSSEEARTIKLALMGPLA
FT                   GIGDSLSQFCLAPLFSTIAASLAQDGLIAGPILFFVAMNAILLTIKLLTGIYGYKLGTS
FT                   IIDVLSEKMAQISAVASMIGVTVISGLAVSFTKIQIAYKYTAQMPDGAEKVVSIQEMLD
FT                   KIAPALLPALYTILIFYLIKKRKWTTYHLVILTIVVGILGSVLKILA"
FT   gene            484506..484919
FT                   /locus_tag="CPF_0404"
FT   CDS_pept        484506..484919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0404"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIA
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83824"
FT                   /db_xref="GOA:A0A0H2YS20"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS20"
FT                   /protein_id="ABG83824.1"
FT                   /translation="MKILVVGHGEYSTGIKSVIKLLTGVEENIDAINLNGELTHDEFTV
FT                   KVKNYIEDNNDLIVFADITGGAPFQITSREILLNEKSENQYVVGGVSVACILEVVMNTL
FT                   VLENNENHRGVIEEALNKLPEMSSVICRKDLVG"
FT   gene            484922..485200
FT                   /locus_tag="CPF_0405"
FT   CDS_pept        484922..485200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0405"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83029"
FT                   /db_xref="GOA:A0A0H2YQC6"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQC6"
FT                   /protein_id="ABG83029.1"
FT                   /translation="MNDRVLWLIILVLATYTIIISFVSPMIHKKRMKEQEKARDIYLSK
FT                   LKPGDKVIIISGIYGIIKGINNNIVKLEISKGVIIEIDKESIMGVLN"
FT   gene            485340..487358
FT                   /locus_tag="CPF_0406"
FT   CDS_pept        485340..487358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0406"
FT                   /product="heparinase II/III-like protein"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82423"
FT                   /db_xref="GOA:A0A0H2YQ04"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ04"
FT                   /protein_id="ABG82423.1"
FT                   /translation="MSNYSNKIEGLKAKVNEYMQVYDAEFVRYYINHNCKNEVDKKLIG
FT                   SNLILNNSFIFDDEWDMEQCKIPYLNRDLDWNFTPNGDEEWVFMLNRHEYFEKLIAAYY
FT                   FSNDEKYLDKLKELIFNWIEKNEIKECGGPTIRTIDTGIRCFSWMKSLLHLIHENKLED
FT                   EEILKIISSIKEQLEYLKKSYIDKYVLSNWGVLQTTAIITCSLWLKEFIEDEELYKWAL
FT                   EELYREINLQVLEDGSHWEQSVMYHIEVLNCSMATIHYVKYFNVDLDEEFLEKIHSMAK
FT                   YLVYCGDSNSIQVAQGDSDRSDIRDVLLRASILFNDPHLKFRAYETMDLTSILLFGRDG
FT                   FLKYTNMDAEEITKLNKSFIDSGNIYIRSGWDKEASFTYLQNGTLGSGHGHSDLCHFSI
FT                   HYGGEPFLIDSGRYTYVESDLLREYLKSVKAHNVSVIDDSPFAIPKNSWKYNKYPDVMK
FT                   NYFNEKDNIAYAEMAYLATLSDGTPYTVIRKVLVISPDIWVIVNDIRCSGKHICKNYYN
FT                   LDYKVKVIKEEGYFRCVNKESEIKIYNNNVDKKYIENTLISTNYNSINNSKKIVTQGTF
FT                   ENNFVNYDIILGQNLKSIEIKDPSIVQYNSKEKIDTSVAITKEFVINENESYTVIIFNK
FT                   ETFKGAKVYMYDDLALYGKVIVVHRVKDKREIIRLKA"
FT   gene            487392..488405
FT                   /locus_tag="CPF_0407"
FT   CDS_pept        487392..488405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0407"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84852"
FT                   /db_xref="GOA:A0A0H2YUR0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUR0"
FT                   /protein_id="ABG84852.1"
FT                   /translation="MVNEGAKLTINDIAKKAKTSKTTVSFYLNGKFDKMSPDTKRRIEQ
FT                   VIEETNYSPNIMARSLKLKKSNLIGVVVADITNPFSSNIVKGIGEITRRKGYQILVGST
FT                   NLDYYNEEEYFKKMLDMGVDGFIVQPTKNFDKLYPAIKNKGKKIVVLDSVSSRYTGKWV
FT                   KTNNYEIVYEAVLKLAEKGYEEFILVTEAPDKLAARMERKTGFEDAVNKINCKSFIEII
FT                   NENTEVDEIAEMLKINISNNKKTVIFAINGKILQKVFKAVKMEGFDVPNHVGIIGFDKW
FT                   DWTMYASPSVTTIDQPTYEEGKYAAKMLIEMIEENDDFYKSEVFDCNINWEESTDL"
FT   gene            488700..490046
FT                   /locus_tag="CPF_0408"
FT   CDS_pept        488700..490046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0408"
FT                   /product="berberine family protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84013"
FT                   /db_xref="GOA:A0A0H2YSN5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSN5"
FT                   /protein_id="ABG84013.1"
FT                   /translation="MEKVDFSKFTGDLVTRENIEYEKSIESWNRAIKKYPLGIVFCNNI
FT                   DDVKNALEWAKENNIPFRIRVGRHNYEGYSIGNDVLVIDLSKMNNIIIDEENMKVTIEG
FT                   GVKNEEIYEALGVLGYPFPGGGCPTVGVVGFALGGGWGYSSRLLGLGCDNLLEVKFINS
FT                   KGKIVIANEYDNSDLFWAAKGGGGGNFGVVISMTFKIPQKIEMATLIDIDYPNAEKEEL
FT                   VYVIRTLQKKFKNLDRRMNLKTAIYNSKDKGIGVKITGLFYGHKEEANEILLPFKLPTR
FT                   VNFNLSYMRVLEANRKIEYSHPPYEKYKSTGRFVFRDYDNCEIEKLIDIVSNRAEGAYY
FT                   TAISFYGLGGAVKDVHKNSSAFYYRDARFIMGIQSVWEDDIFAEENIKWIKNNFKYIES
FT                   ITTGSFINFPFKDLKDYEEEYYGENKDKLREIRKKYDENKFFAFEQGIK"
FT   gene            490346..490699
FT                   /locus_tag="CPF_0409"
FT   CDS_pept        490346..490699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO80898.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83490"
FT                   /db_xref="GOA:A0A0H2YS50"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS50"
FT                   /protein_id="ABG83490.1"
FT                   /translation="MAYKSSIILNKEKYDSYFDNTFKNSIVHHLKCLLLGILTLGLAYP
FT                   WIICMKYEATCKHTVICGKRLKFIGNPKELIGHWIFWWILIVITFGLYGLVVKIRFQQW
FT                   TSANTIFEDVEIK"
FT   gene            490894..491718
FT                   /locus_tag="CPF_0410"
FT   CDS_pept        490894..491718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0410"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="identified by similarity to GB:AAM24960.1; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   PF05116; match to protein family HMM PF08282; match to
FT                   protein family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84497"
FT                   /db_xref="GOA:A0A0H2YTY1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTY1"
FT                   /protein_id="ABG84497.1"
FT                   /translation="MSIKLICIDMDGTLLMDQQNIAEEDKNAIKEAVKKGAIVAITTGR
FT                   IYDCARMYSDTIGLKTPIIASNGAYIGGVNDEEIYNNPLKQSDLEDFNIITKKNNLFTY
FT                   VTTNWGIVSTVELPENHVYKVLNKTLPKDKQVRLEVVKDLDEAFKKYKGEILKGVCVEK
FT                   EFKDKLKEAKEELIACTTDLEVVSSWDDNFEIMKKGSSKGEAVQMLAKYLGVSQEEVMC
FT                   IGDSENDLSMITWAGTGVAMGNAIDSVKEFANYVTSDNKHGGVAEAIRKFVL"
FT   gene            491866..493287
FT                   /locus_tag="CPF_0411"
FT   CDS_pept        491866..493287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0411"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83744"
FT                   /db_xref="GOA:A0A0H2YTA4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTA4"
FT                   /protein_id="ABG83744.1"
FT                   /translation="MRDIIVIGAGVVGCSIARELSKYNLDVLVVEKNSDVSEGISKGNS
FT                   GIVHAGYNEKIGTLKAKLNIEGNKIFDDLSRDLQFPFKRNGAFILAFSDEEMKTLESLK
FT                   ENGEKLGVEGLEILTREEALNIEPNLNKKIVGVLNVKTSGIVSPYEMTIALAENAAENG
FT                   VEFKLNSKVTSIEKISEGYKVTLNNKEVVNGKLIINASGLEGAFLNNLVSMTKREINPV
FT                   KGEYCLFDKVAGAMINKTLFQVPNKLSKGVLVTPTAEGNLLVGPNAVEGKTLETSREGI
FT                   DEILDKSKKSLEELPVARILNTFSGIRPKTKGGDFIIEEVEDAKNFINVIGIDSPGLTA
FT                   APAIGVYVVNMIKERLDLVEKKNFKKTREKIVRFAELSLKEKNKLIKEKPAYGHMVCKC
FT                   EFVTEGEIVEAIHRPIKALTVDAIKRRTRASMGGCQGIGCTLPISKILSRELGIDISDI
FT                   NKNSEGSPVIGFKED"
FT   gene            493292..494182
FT                   /locus_tag="CPF_0412"
FT   CDS_pept        493292..494182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0412"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84244"
FT                   /db_xref="GOA:A0A0H2YT72"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT72"
FT                   /protein_id="ABG84244.1"
FT                   /translation="MREYDLIIIGGGASGLLLAINGKKDGIKNILLVEKDPILGGALNS
FT                   ADYNISEKGNLTGIEYKESLLKEFNELNIDVKLNTMVLKIEDSNEILCTSSEYGVEKIK
FT                   GKNIIITNGGKEKSRNAVQIPGDRTAGVLTVGMAKKIFGIKNMVPGKNIFIVGDSTLYM
FT                   IQEDLKKHNIKVSGIITDKNKNEVFDLSENLYPGYEIVSIHGEGRVSSVTIKNDDEKKN
FT                   IKCDTVIFAYPMISDGLVALRSGLKLNPSTTGPAVDENLETSSKNIYACGNAIYIHKSI
FT                   EEIEDECKKLIKTIS"
FT   gene            494423..494800
FT                   /locus_tag="CPF_0413"
FT   CDS_pept        494423..494800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK47746.1; match to
FT                   protein family HMM PF06094"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83610"
FT                   /db_xref="GOA:A0A0H2YRP3"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRP3"
FT                   /protein_id="ABG83610.1"
FT                   /translation="MVYFAYGSNLCLDQMKKRCPEAIPMISVHLNNYKLVYNKYADIIP
FT                   CEGEKVYGAIYEISLNDLKNLDKYEEYPDLYEKIDLIVQDINGISYEAFAYVMNEKGDK
FT                   TPDKRYLDIINKGYEDWGIIY"
FT   gene            495016..495588
FT                   /locus_tag="CPF_0414"
FT   CDS_pept        495016..495588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0414"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82641"
FT                   /db_xref="GOA:A0A0H2YPC2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPC2"
FT                   /protein_id="ABG82641.1"
FT                   /translation="MEKNVRRLEEILEFNKSFVENKEYEKYKATKKPEKKLVILSCMDT
FT                   RLTELLPKAMNIKNGDAKIIKNAGATIMHPFGSIVRSILVAIYEFNAEDVLVVGHHGCG
FT                   MSNLNSKDMISKMEDRGISEETILTIKHCGIDVEKWLHGFGCVEESVKESVTSLKNHPL
FT                   MPSDVNVHGLVIDPHTGELKVIVNGYE"
FT   gene            495732..496370
FT                   /locus_tag="CPF_0415"
FT   CDS_pept        495732..496370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58407.1; match to
FT                   protein family HMM PF06541"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84029"
FT                   /db_xref="GOA:A0A0H2YSP6"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSP6"
FT                   /protein_id="ABG84029.1"
FT                   /translation="MEISNTINIYKIIWIFTIGSILGYCVEMIWCYVRNGHFESRKGLI
FT                   YGPISPVYGIGGVALTLLLYRFIDYNGIIIFFISAIIGGAFEYLCSWVQEKVFGSVSWE
FT                   YNSKALSIHGRTSVEYSVFWGILGVFFLRDIYPLFDKFMGLFSFQTVKIITVIFLVLLI
FT                   PDIIISSLAVRREVARMNGIKAKNALDRFLDKKYTDEFLKKIYPNMIFK"
FT   gene            496395..496784
FT                   /locus_tag="CPF_0416"
FT   CDS_pept        496395..496784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36906.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83563"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRK7"
FT                   /protein_id="ABG83563.1"
FT                   /translation="MFFIGIFGIENKQKEVKQLENIYCKTCSTRTMGALIKSYEYFHIF
FT                   FIPIFRWNEKYYVMCKRCNSIYEISKEKGKAIENGEINEVNLEDMTLIQEGQVYGKRAV
FT                   KKVCPNCGKTAEGDYNYCPYCGSEI"
FT   gene            497117..498988
FT                   /gene="hsp90"
FT                   /locus_tag="CPF_0417"
FT   CDS_pept        497117..498988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp90"
FT                   /locus_tag="CPF_0417"
FT                   /product="heat shock protein"
FT                   /note="identified by match to protein family HMM PF00183"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84623"
FT                   /db_xref="GOA:Q0TU16"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU16"
FT                   /protein_id="ABG84623.1"
FT                   /translation="MEKREFKAESKRLLDIVINSIYTNREIFLRELISNASDAIDKVYY
FT                   KTLGDSSLTFNKDDYYIKIKPNKEERTLTISDKGIGMTEKELDENLGVIAKSGSLQFKK
FT                   ENEIKDGFDIIGQFGVGFYSGFLVADKITVITKAFGADKAYKWESDGVDGYTISEAEKD
FT                   SFGTDIILHLKANDEDENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEGTENE
FT                   HEEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGMISYNS
FT                   ILYIPENIPYDYYTKEYEKGLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQDLSLNIS
FT                   REMLQHDRQLSRIAKNIKTKIKNELESMMKNDRESYEKFYKSFGRQLKYGVYDDFGMNK
FT                   DELKDLLMFYSSKEKKMVSLAEYVERMAEDQKYIYYAVGESNERIEKMPQTEMVLDKGY
FT                   EILYFTEDVDEFAIKMLMNYKEKEFKSVSSGDLGIESEEENKKENEENKGIFEAMKEAL
FT                   GEKISAVKASSRLKNYPVCLSSEGEVSIEMEKILSAMPNNQGVKAQKVLEVNTNHEVFN
FT                   SLKDALENDKDKFNLYTKLLYNQALLVEGLSIEDPVDFTNDICKLMK"
FT   gene            499216..500817
FT                   /locus_tag="CPF_0418"
FT   CDS_pept        499216..500817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK81170.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82398"
FT                   /db_xref="GOA:A0A0H2YNF4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNF4"
FT                   /protein_id="ABG82398.1"
FT                   /translation="MRKCKSCGRAIEGNNRFCLMCGAKIEDVDENLDNNTTTDDKSHKE
FT                   ENLEVSTEELKELQENDSKSENNSYDNSKKNNNEPQKKRGNKIILIPIILIIILFFSYN
FT                   QLKNYMSNPQNVIENFKVAILENDEQKLIDSLETESSALQINEESAKVIIDYFNKNPKE
FT                   LDETINSLNKDAESINKDAESINKNDALINIFNLNSDEKKKIFYIENSKKSFLGLNKVK
FT                   VYVKPIFINVTSNVSGVKFFVNNNEICESDKDDFSFKAGPFVPGEYELSYKFDSEFVNL
FT                   EESETIDFIENKSIHNNEFNYEIGNELKYVTLKTSEKSKDAIVCVNGKNTGKKVDEMSN
FT                   LGPILEDTKISIEIKQGDSVLKSDEIKVGERSELYIDLDNKLYEYEVKNNKQANQSEKN
FT                   SISFNDDYSDLYYSVENLVKDYTYNFTVAVNNNDFGAIKKYLYPGKELYKSQPNVIKQF
FT                   FDDGIKEELLDVSVEKINILDKQELSGTVETIEKYNIKQNNEEKEKVFNSIYEFKFNNT
FT                   SKNYELTNMRYLNKLN"
FT   gene            500854..501573
FT                   /locus_tag="CPF_0419"
FT   CDS_pept        500854..501573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0419"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAK56814.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82383"
FT                   /db_xref="GOA:A0A0H2YNM0"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNM0"
FT                   /protein_id="ABG82383.1"
FT                   /translation="MYCSKCGKEIPNESVFCPECGCKCKSDMDNKIRETSAIEIKELIT
FT                   KVICNPISTVKNEAIKLSSQNKLIYIIITSLITPLITIFSFKTYGSGLVKYIINSIPMQ
FT                   KVYILNLGSYIINYVLLLGIIYILFKSLMKDKIDKTNAMDIMLTISTFNMLLEIIAAIV
FT                   LFLGVIPWVILKVFSMILLIILMYSLLNSLLILKEKLIYIYSTALVVIALINMWFVFKN
FT                   VGSIISDMFFSNILKFM"
FT   gene            501760..502752
FT                   /locus_tag="CPF_0420"
FT   CDS_pept        501760..502752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0420"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82795"
FT                   /db_xref="GOA:A0A0H2YPD1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPD1"
FT                   /protein_id="ABG82795.1"
FT                   /translation="MKVTIKDVAREANVAPSTVSRVLSDSPKISEETKIKVNKAIKKLN
FT                   YKPNAIARSLVNNKTKILGVVLPNEADDSFKNPFFVEAMRGMSMSAEENGYYIMYAFSK
FT                   NDEDELKTIKEFSSNNLLEGLCLLSVREEDKTIKYLKDINFPFVVIGRPDEEDILWVDN
FT                   DNFQAMFKLVDKFIKDGQSDIAFIGGKKSWNVSKDRLSGFKDAFKANNLNYDKTMVIEG
FT                   IDFSEECGYLAMREIISKRTPKIVVTTDDLLALGANKFLNEDGIEGVKIVGFNNTPMTK
FT                   YQNPPISSIDINARELGYEATKLLIDYLNGNLVGRKKYCIVDTELIDRG"
FT   gene            503188..504852
FT                   /locus_tag="CPF_0421"
FT   CDS_pept        503188..504852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0421"
FT                   /product="putative oligo-1,6-glucosidase"
FT                   /note="identified by similarity to SP:P29094; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82409"
FT                   /db_xref="GOA:A0A0H2YNG3"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNG3"
FT                   /protein_id="ABG82409.1"
FT                   /translation="MNKKWWKELIAYQIYPKSFMDSNGDGIGDIQGIISKLDYLKDLGI
FT                   DLIWLCPMYKSPNHDNGYDISDYKDILDEFGTMDDFNELLSEVHNRGMKLIIDLVINHT
FT                   SHEHPWFIESRASRDNPKRDWYIWREGKGDEEPNNWESIFKGSAWEFCENSEEYYLHLF
FT                   AKEQPDLNWENKEVRNELYKMINWWLDKGIDGFRVDAISHIKKEEGLKDMDNPEGLKYV
FT                   SSFEKHMNVEGINSHLKELKEETFSKYDIVTVGEANGVSANEADHWVAEDEGTFNMIFQ
FT                   FEHLNLWNYEEGQGFDVKAYKDVLTNWQNSLEGKGWNALFIENHDIPRVVSTWGNDKEY
FT                   LTECAKAFGAIYFLQKGTPFIYQGQELGMTNVKYHSISEYDDVKTINTYNERIESGVSE
FT                   EIALKEAWVTSRDNSRTPMQWNSSENAGFTCGKPWIGVNENYKTINVEVEERDENSVLN
FT                   FYKKLIKLKKSNEALIYGVYDLILEEDENIFAYTRTLNNEKFLIMANLTGENAKYMYEK
FT                   EKLNSKDLILNNYEVCEHKNLTEFTLKPYECRVYKLS"
FT   gene            505111..506766
FT                   /locus_tag="CPF_0422"
FT   CDS_pept        505111..506766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0422"
FT                   /product="PTS system, IIBC component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83479"
FT                   /db_xref="GOA:A0A0H2YRC1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRC1"
FT                   /protein_id="ABG83479.1"
FT                   /translation="MKKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYIDV
FT                   DFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIF
FT                   SVSNAMLAGDSTATVQSFTGQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKY
FT                   YNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTA
FT                   PIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGGVYHILTGPTAGQVVAGQDPLWLAW
FT                   ITDLNNFKQAGDITSYNQLIGSVVPARFKAGQVILSSASLIGVALAMYKNVDPDKKKKY
FT                   KSVFFSAAIAVFLTGVTEPIEFMFMFISPILYVVYAVIAGLGFAIADIINLRVHAFGFI
FT                   ELITRSPLMINAGLTKDLINFIIVAVVFFFLNYFVFSFLIKKFKIATPGRMGNYIDNED
FT                   ENTNKASSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKD
FT                   NKALGLIVKDKGVQAIYGPKADVLKSDIQDILGI"
FT   gene            506777..507568
FT                   /locus_tag="CPF_0423"
FT   CDS_pept        506777..507568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0423"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83663"
FT                   /db_xref="GOA:A0A0H2YRT9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRT9"
FT                   /protein_id="ABG83663.1"
FT                   /translation="MKLLTLNCHSWLEEEQLYKIKYLAKTIVEEKYDVIALQEASQSIK
FT                   ASIKEGNLKEDNYGLVLIEEINKLGGEKYHLVWDYSHIGYDIYEEGLCILTKHKIVNSE
FT                   SFYISKSHCKTFWRSRKIVKATIDIKNENIDFYSCHMGWWHDKEESFTFQVENLLAHAK
FT                   ESKNRAFFMGDFNNNAFLKNEGYDFLKSNGLIDTYNLAENKDSGVTVNKNIAGWEDNTG
FT                   ELRIDIIFTNRNTKVYDSRVIFNGKNKEVVSDHFGLEIETM"
FT   gene            508224..508961
FT                   /locus_tag="CPF_0424"
FT   CDS_pept        508224..508961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0424"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /note="identified by similarity to SP:P37965; match to
FT                   protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84229"
FT                   /db_xref="GOA:A0A0H2YTX2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTX2"
FT                   /protein_id="ABG84229.1"
FT                   /translation="MKKILNVAHRGLSGLYPENTMIAFRKAIEADCDGIEMDVHLTRDG
FT                   VPVVIHDEEVDRTTNGSGYVKDFTYEQLCNLDAGIKFSDEFKGEKIPTLKEFFDFMKDN
FT                   DKLINIELKNSIIHYEGLEEKVYKEIENYGFEDRVIISSFDHYSIRKCIRLNKNIKTGI
FT                   LYWDCIFEPHNYCKVVGSSALHPEFNSITEEIVRDAHEDFQQVNVYTVNEKKDMEKMID
FT                   LNVDMIITNYPNILKEVLENKNK"
FT   gene            509058..510344
FT                   /locus_tag="CPF_0425"
FT   CDS_pept        509058..510344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0425"
FT                   /product="major facilitator family protein"
FT                   /note="identified by similarity to SP:P46907; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84815"
FT                   /db_xref="GOA:A0A0H2YUR7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUR7"
FT                   /protein_id="ABG84815.1"
FT                   /translation="MKNNNAKKWITLLVLCAGGGIIYRLPYLREVFYIPMQQAFHLTNF
FT                   QMGFLTSMYGIVNFLLYIPGGVIADKFSYKILVPFSLIATGLLGFWYATIPSYTVCLII
FT                   NGAWAITTVFTFWPTMVKAVRMLGDSSEQGKLFGILEGGRGAASTVVSFIALGMLAKLG
FT                   EGLLGIRSIIIFYSVALIVIGIIAYFLLDDSKEEKEINKQTRGDIVHGIKKVVKMPEVW
FT                   LVAALVFTTYAAFSGLAFLTPYVTEIFGMSVALGAFIGIIRSYVIMMLAPPISGVIADK
FT                   MHSTIKFMIIGLTLSIIFTLVYVFMPGKSAFIIPVLINMLILSIILLGMKGVFFAPLDE
FT                   VRVPREYTGIAAGIVSFIGYVPDMFINSYYGGLLDSHPGIKGYNLIFLSMIALCVIGLI
FT                   CGIVLYKLVYSKKKESVGEKELEVAKLNS"
FT   gene            510845..513457
FT                   /locus_tag="CPF_0426"
FT   CDS_pept        510845..513457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0426"
FT                   /product="helicase, UvrD/REP/exonuclease family protein"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM PF00929; match to protein
FT                   family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82841"
FT                   /db_xref="GOA:A0A0H2YQI9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQI9"
FT                   /protein_id="ABG82841.1"
FT                   /translation="MINLNEEQQKVVNEQKNNIILLASAGTGKTNTLAERVTSIIKNGN
FT                   SKPSEILCITFTNKACKEMSDRVMKIVGGEAKDITIRTFHSFCFDVVRTYAKRNTDIFS
FT                   DFTIFDEDDCREVISKLSYYYATSNLMATNMQIQKVIDFIKVERARIETLEDRVLDEYK
FT                   TVIDEIFKFREEKINQVCTNKGNLNLNLKNYIKFHGHELVTLYDSKLREDHALDFNDLI
FT                   ILTKELFKDEKVVRALKNKFKYINIDEVQDTSIIEYSIIEKIFEGNNVLICGDFFQTIY
FT                   SWRGSDPEIIFNKFKEKYNPVEIVFSKNYRATKNLNKASLEFLNNAFSSKVSTMYKDGI
FT                   LAESKEDGEKILLKETRGLREEARFIFDYVNKLCEKGEDLKRVCVLTRDNNYNIGLSEE
FT                   LYQIGGYEGSDFEFILVDQFKFFRRQEVKDILAFLKLIANRYDSLSLKRIVNRLPTGIG
FT                   MRTLETIESYKYKEVGIRLADYIDPLVLKYGEKFSLLINEFEKENIIVFDVESTGVDVT
FT                   EDEIIQIAAIKLNKNGEVVDKFEKFLKNKKPVKDSYYVHGFSDEMLQRIGEDKEKVLKE
FT                   FVEYSKDSIIVGHNVQYDINILCSELERNNLGKPKFKTFYDTLDIYRRFYPGNINYKLE
FT                   NLSKVYDTKHKPSHDAMDDIIATGELLVRAINKKIIPTSMERMALMSKHLKAFTAISKK
FT                   LNELFQIAESKRPYELVACVMNGFNIKSMYAGDENKEKLNRLRDLYALFRDLDDKSKGN
FT                   RDALLDIIRITGLSNGELESLIINRTKKPRIPIITVHQAKGLEFDTVFLAGIQNNTFPS
FT                   YMSIKEGNLSEEKRVFYVAITRAKKRLVITYNSQGKYGHRNEISQFINYIPKEFFKII"
FT   gene            513634..514293
FT                   /gene="trmB"
FT                   /locus_tag="CPF_0427"
FT   CDS_pept        513634..514293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="CPF_0427"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83472"
FT                   /db_xref="GOA:Q0TU06"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TU06"
FT                   /protein_id="ABG83472.1"
FT                   /translation="MRMRRKPWARPELEACDFFVANPKENKGNWKNTFKNTENPIYLEL
FT                   GCGKGTFMAVHGSDHPNINYIAIDIKDEVLVLAKRNIEKAYEEKNKALDNVKLMPQEIA
FT                   LIDTILDSNDKIERIYINFCNPWPKDRHKKRRLTHTRQLTKYRDFLVDGGEIHFKTDDD
FT                   ELFEESLEYFKECNFEITYITRDLHNSGYEYNVVTEHEEMFSKQGIKIKFLIAKKL"
FT   gene            514812..516095
FT                   /locus_tag="CPF_0428"
FT   CDS_pept        514812..516095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AG1527; match to
FT                   protein family HMM PF06824"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84485"
FT                   /db_xref="GOA:A0A0H2YTW9"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTW9"
FT                   /protein_id="ABG84485.1"
FT                   /translation="MSLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVE
FT                   VSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYA
FT                   NAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKK
FT                   AFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDA
FT                   CEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGF
FT                   GEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEG
FT                   KAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDD
FT                   PTKFTRDWFAWSNSLFSHFIYEKVINKK"
FT   gene            516563..517141
FT                   /locus_tag="CPF_0429"
FT   CDS_pept        516563..517141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ02"
FT                   /protein_id="ABG82642.1"
FT                   /translation="MKKVSLILINIILVCNLIACGAQGNEIAINFIDNEIEVEENEKRD
FT                   ITIQSKDKYKQFRNSNTKIKKEDLKTYFYNDKTLKDFEVPKKTIEEYENWFINMARDRG
FT                   ESAKDISDAFRSVDMLIGEDIVKFPVIIDTVNFNDREAYAIAYLCEEGENLDMEAQEAM
FT                   ELKRFDEVLVIGVYKDSSDIFYKDKYSLK"
FT   gene            517372..517527
FT                   /locus_tag="CPF_0430"
FT   CDS_pept        517372..517527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNQ8"
FT                   /protein_id="ABG82336.1"
FT                   /translation="MPKDSQPDNKVARMEKCNFQTPITSEEGKNHNRTAKKHSVKREGF
FT                   QSPHIN"
FT   gene            517919..518446
FT                   /locus_tag="CPF_0431"
FT   CDS_pept        517919..518446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82958"
FT                   /db_xref="GOA:A0A0H2YPV7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPV7"
FT                   /protein_id="ABG82958.1"
FT                   /translation="MVNEKFGILAKIFLLILILVPITFRVYDLYYLNSSWDINSKVVKR
FT                   GKVYRDYIKEKKLTGVPNIYYKYNSLTPEEMMTLDVLANTKGYNIEEVLPEVEKYVLSK
FT                   NNEKNGAKLNEDEKIEVNQCVKQIKEEVNENLEKNSSYIYWMKMLMSVFTALMLVLSIY
FT                   AIYMTIVFINEK"
FT   gene            complement(518534..519076)
FT                   /gene="lepB"
FT                   /locus_tag="CPF_0432"
FT   CDS_pept        complement(518534..519076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="CPF_0432"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85001"
FT                   /db_xref="GOA:A0A0H2YVN6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVN6"
FT                   /protein_id="ABG85001.1"
FT                   /translation="MNLLSESNISTLNKKSHLKIKNLILFSVIVFLGSYFLTNYLIFKA
FT                   YIPTGSMRPTIMEEDEVIVSKIYTSINRGDIFVFSHESSEELLIKRVVGLPGEKVELKD
FT                   GLLYVNDVFIDEPYVKNNESMNKTFYVPEGNYLFFGDNRARSEDARRWENPYVPKKNLD
FT                   GKALFTVYPKDRIGFLK"
FT   gene            519284..520126
FT                   /locus_tag="CPF_0433"
FT   CDS_pept        519284..520126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP09437.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82859"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPR3"
FT                   /protein_id="ABG82859.1"
FT                   /translation="MNEISDLAKITSILGIAATTYLVYENNSIFINEYELFTRKTPNSF
FT                   RGFKILHLNNLYGKTFGSENYRLIEKINSLKPDIIVTTGNMLTSSLDKDFVFLELCKNL
FT                   RSFYPIYYSIEGCKNLIGKKYEKYRDYLKGLVDIGVILLNNSKVSLIKKEDKLNIYGIY
FT                   IEDEIKSFSLKEGFKKEKIFSKEDVVNKLGSPNRSEFNIVLANDVINFEAYVKWGSDIT
FT                   FSGYTRAINRYIFNNLMERKKGIFIEKDSSMILSRGLGNDFLKMRIMNRPEITLITIR"
FT   gene            520409..521248
FT                   /locus_tag="CPF_0434"
FT   CDS_pept        520409..521248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0434"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82631"
FT                   /db_xref="GOA:A0A0H2YPZ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPZ0"
FT                   /protein_id="ABG82631.1"
FT                   /translation="MLYYKVVNNKYLHKDKEWILMLHGIGGNLNIFKKQIDVLSENYNL
FT                   LLVDLHGHGNSQNHTLKNMKKTKGEISFKYICEDIVEILDKLNIEKVNVLGISLGTIVG
FT                   MQFEKYFPNRVSSMILGGGIVGMNLKSKFFLNLALVTKNIIPREIFYKIVAYMSMPCKN
FT                   HKLSRNIFLKAAEKLDKNECFRWVELMREHLENYKYVKNNVKKIFIMGDQDHVFLPTIK
FT                   KFVPEEDIVVIKNCGHICNIDSFKTFNHLTLNFLINNHGYMFGAKERRKYVYKYNFT"
FT   gene            521332..522627
FT                   /locus_tag="CPF_0435"
FT   CDS_pept        521332..522627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0435"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07656"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83593"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM5"
FT                   /protein_id="ABG83593.1"
FT                   /translation="MRLKNICFMAMATILCTSVLTGCGTSSAKEDSDNELYIITEDKSS
FT                   ISLSNSKPGMFGVTEDGEIFMEKGYEGKVAYIDKKGKKSIGFKFDKGSEFSYGMAGVKE
FT                   GNTYKIINKKGKTLVEKEDGVLSPLNNNLIRYEKLANEILTNENTTEAIESLAQSGKTL
FT                   KTTGILNTKGEVIVEPGRYDEIIKDIGEGYILVKKNKMYGLLNAEGNEIIPCEYTSIGE
FT                   INEGFIPVSKGNLCGALNEKGEIIVPIEYFYVGSMNEGVAPARLDESGIGFLNKEGSWA
FT                   IMPDFDGVTAMNNGVAFARKDNKHIIIDKDGKEVETKINFENKVSINGFSDSGLAVVDI
FT                   LDGESKYMSVINTKGEEIKNLEKKDYSALEVYPSGLIVSVNQEGKKGLLKEDGSVILEE
FT                   EYNDIRVISKDVILVDKDGTYSYIDSTGKTLY"
FT   gene            523004..523492
FT                   /locus_tag="CPF_0436"
FT   CDS_pept        523004..523492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0436"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83917"
FT                   /db_xref="GOA:A0A0H2YSF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSF3"
FT                   /protein_id="ABG83917.1"
FT                   /translation="MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAYI
FT                   QYSAGVFKDYQLAIRMIFKEENSLKGNFKNRCVFLENENGERIGTIMIVPSLSEEAGVQ
FT                   EIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYNDKSIVLFENLGFERS"
FT   gene            complement(523551..523886)
FT                   /locus_tag="CPF_0437"
FT   CDS_pept        complement(523551..523886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97099"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84897"
FT                   /db_xref="GOA:A0A0H2YVG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVG1"
FT                   /protein_id="ABG84897.1"
FT                   /translation="MYIDLNFIYLLLALLGCVAIVYLILTLNKVLKLVSNINSLLDQNK
FT                   DNLTKTINDLPTIANNVNDACQNIKDISDVATETTADLIVAKENIESNVETVKEIAKII
FT                   NQVFFKK"
FT   gene            complement(523892..524308)
FT                   /locus_tag="CPF_0438"
FT   CDS_pept        complement(523892..524308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT04397.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84404"
FT                   /db_xref="GOA:A0A0H2YU92"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU92"
FT                   /protein_id="ABG84404.1"
FT                   /translation="MSLAKLIDEKRKAKARAERNKKAKVAVTGAAVGTLAGVLGGLLFA
FT                   PKSGKETRNDIKEGSKKAAQKLNDKSVELKENLNTQVAKGKENISDAKSKIKEYLNSKK
FT                   CKNIEEAVEENLNVPVEVADEATSLETEEVKESN"
FT   gene            524854..526191
FT                   /locus_tag="CPF_0439"
FT   CDS_pept        524854..526191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0439"
FT                   /product="CBS/transporter associated domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83597"
FT                   /db_xref="GOA:A0A0H2YSX6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSX6"
FT                   /protein_id="ABG83597.1"
FT                   /translation="MDPSPSILPKIILILVLILINAFFAAAEMAMVSVNKSKIKMLAEK
FT                   GNKKALLLKKVLKSPGNFLSTIQIGITFAGFFASASAATSISETLAQFMYKLNIPYGNE
FT                   ISVILITVLLSYITLVFGELLPKRIALQKPEEIALMAIRPINVISKISTPFVKILSAST
FT                   NLFIKILGLNKSEDKETVSKDEIKSMISIGQESGVIDKTEKDMLDNIFEFDHKVVKEVM
FT                   TPRGEVFAIKSTTPNETIAKKLISEQFSRVPVYNETRDNIVGILYLKDFFEAVVKVGVD
FT                   NIKLDQLIRPAYFVLENKAIDDLFKELQDSKQHMAVIIDEYGGFSGIVTIEDLIEEVMG
FT                   DILDEYDDSENYIDKIDNNTYVVDGLLTLDKLNDYLNLNLESQNIETIGGFVVNLIGNI
FT                   PQSENQMVEYDNLSFQVCKTNKKRIEKLKIYLNNSTSFNSDVILNN"
FT   gene            526466..527518
FT                   /locus_tag="CPF_0440"
FT   CDS_pept        526466..527518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0440"
FT                   /product="bacterial extracellular solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84080"
FT                   /db_xref="GOA:A0A0H2YSW0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSW0"
FT                   /protein_id="ABG84080.1"
FT                   /translation="MLKRKKLLALTLTALVSMGVLAGCGQKNQEAKAEETGSGEKVVNV
FT                   YSSRHYDIDKQLFKDFESDTGIKVNLVDGKSDELIERMAREGDNTSADVFLTVGAENIA
FT                   QLNEKDLIKDISSEKINENIPSEYRGKNWVGLTSRARIIVYNKEKVNPETIKTYNDLTK
FT                   DEFKGKVLTRSSSSSYNNALLSSFIQLDGAEKAKEWAQGIVNNFARTPEGNDRDQAKAI
FT                   MAGIGDVGIMNSYYIAKMISSSDAEEAKVGKEIGVLFPENTHLNLSFGAVTKNAKNEEN
FT                   AVALLEYLTEEKAQKAYVDENGEFALNTKVGKSELQKSWGEFTVQNLNYEILGESKQEA
FT                   TLIFDQVGWK"
FT   gene            527509..529110
FT                   /locus_tag="CPF_0441"
FT   CDS_pept        527509..529110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0441"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84541"
FT                   /db_xref="GOA:A0A0H2YUM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUM4"
FT                   /protein_id="ABG84541.1"
FT                   /translation="MEIMKKIKFNGWALLSTIISLMIVLPNIDIIIHLFQKPNKTWYHI
FT                   KEYLLKDYIVTSIIVVFFTVLLSIIIGVTLAWLISAYDFPFRKFFRWALILPLAIPPYI
FT                   GAYTYSGMVSYTGVIQRFFRNILGVELNQKYFDIMSIEGAIFIFTLFLFPYVYMVTMTF
FT                   LEKQSAGLIESARLLGSSAIGIFFRVIIPVSRGAIVAGSTLIALEVLSDYGVVSYLGVQ
FT                   TFSTAIFKSWISLGDVDSAIRLAGILMVVVFIIISSEKALRGRKKYSFTNTKVRPIKRK
FT                   NLKGFNKFIVTLYVLIIFSLGFLIPVLQMIAWAIASYKNIYYSQFLSMIFNSVILASGC
FT                   SLLIVIMALIVANYVRTRSGLLSKIYAKVTLIGYSIPGAVVAITMILFFVDIDNKIKGL
FT                   ALSTSIIMLVFAYVIRFLAIGYQNIEGGFEKIGNKFTEASRTLGYGVTKTFFKVDIHML
FT                   KPAILGAFALTFVDIIKELPLVLTLRPFNFYTLSTKVFEYANDEMIPESAIPSLIIVFV
FT                   SFVAIYFLYKVADKED"
FT   gene            529113..529793
FT                   /locus_tag="CPF_0442"
FT   CDS_pept        529113..529793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0442"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82558"
FT                   /db_xref="GOA:A0A0H2YP13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP13"
FT                   /protein_id="ABG82558.1"
FT                   /translation="MFIEIKELYFKYPKSKNDIIDNFNMSLEKGEILSILGESGSGKST
FT                   ILRIIAGLEESYKGEIKIGGKIVFSDNNFVEPEKRGVGMVFQDYALFPHMTVKKNIQFG
FT                   LKGKNKEEKEKIAMDMLKLVNLVEHKDKYPYELSGGQQQRVAIARAIAPKPSVLLLDEP
FT                   FSNLDADLQEKIRGEIKEILIKAGITSIFVTHDRSDAKALANKFIELKEGKIIKAASIN
FT                   ELRC"
FT   gene            530116..530775
FT                   /locus_tag="CPF_0443"
FT   CDS_pept        530116..530775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0443"
FT                   /product="putative sulfite/nitrite reductase"
FT                   /note="identified by similarity to SP:Q05805; match to
FT                   protein family HMM PF01077; match to protein family HMM
FT                   PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83143"
FT                   /db_xref="GOA:A0A0H2YQA4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017220"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQA4"
FT                   /protein_id="ABG83143.1"
FT                   /translation="MVSGTHYGNLQKVRGGKRTFGITPHIPGGFINPEQLEKIAKVTKK
FT                   YNGVIKITSGQRLLITNLKGEDLPKIWDELGMEPAVKKQNSVKNVEMCPAGFCKRSKFN
FT                   TIGTGMKLLNKYKHMDMPCRTKIGVAGCRNACGSVYSKDVGVIADKTGFLVTAGGSAGH
FT                   NPRMADILIKDVDEKEALRIVDKIFEVYKGEAEAGEKLGDFIDRIGIEVFKEKTLV"
FT   gene            530965..531138
FT                   /locus_tag="CPF_0444"
FT   CDS_pept        530965..531138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0444"
FT                   /product="BFD-like iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83658"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRL9"
FT                   /protein_id="ABG83658.1"
FT                   /translation="MSNVCLCKGVSEEKIVEAVKNGALSFEEVGEKTGAGTGACCGARC
FT                   KCKIEELIEENK"
FT   gene            531404..531775
FT                   /locus_tag="CPF_0445"
FT   CDS_pept        531404..531775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0445"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85040"
FT                   /db_xref="GOA:A0A0H2YVC8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVC8"
FT                   /protein_id="ABG85040.1"
FT                   /translation="MNIVVSNTSGVPIYEQIAKAIKNEILSGDLKENSALPSIRSLASE
FT                   LRVSVITTKRAYEELERDGFIYTLPGKGSYVAEQNKELLMEEKLREIEEKLGEAIDIAN
FT                   SIGLNFNDLVGMLKTLKEL"
FT   gene            531809..532672
FT                   /locus_tag="CPF_0446"
FT   CDS_pept        531809..532672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82740"
FT                   /db_xref="GOA:A0A0H2YQS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQS5"
FT                   /protein_id="ABG82740.1"
FT                   /translation="MENVLEIKNISKNYKGFSLKDVSFNIPKGFVMGLIGPNGAGKTTT
FT                   IKAIMNLINLDSGEIYIFGEDIKKNEISIKDRIGFVYDDCCAFEDFTIKENKKIISKFY
FT                   SKWDEEKFKYYLEKFELNENKKLKQLSKGQKMRFSLALALSHKAEFLILDEPTSGLDPV
FT                   FRSELLDILFEIIGEEEVSILYSTHITTDLEKLADYITFLNKGKVEFSLEKDLLLEEYF
FT                   LVKGPLDILNKDLEKELIGLRKTRYNFEGLTNNMRKLKELFGEKIIFEKATLDDIVVYY
FT                   SKKDVK"
FT   gene            532674..533300
FT                   /locus_tag="CPF_0447"
FT   CDS_pept        532674..533300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0447"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAP28153.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83437"
FT                   /db_xref="GOA:A0A0H2YR80"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR80"
FT                   /protein_id="ABG83437.1"
FT                   /translation="MKELLKLDFFIQKKYIKSSIIVFLFLGITFALTQGMNYLYTMGTF
FT                   IVFYLTIIPIEVERKSKFNIYLNSLPNKKSNYIYSKYLSTLIYIIVVNLFLYLFCTILG
FT                   VISGSDFTLTLRAILPNIIVQLFYVSLTLPVYMIISHKFYRVVNIIFTILIMMISSILF
FT                   NSLENENLQVLFNITNGVYGLAFGILALIISLIVSLNIYKKSEVS"
FT   gene            533302..533970
FT                   /locus_tag="CPF_0448"
FT   CDS_pept        533302..533970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0448"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAS12417.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84059"
FT                   /db_xref="GOA:A0A0H2YST7"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YST7"
FT                   /protein_id="ABG84059.1"
FT                   /translation="MKNLIIKDLKNIRVIFIFYILTMTFGYSPFFIDLPKDRYDFLINS
FT                   VFIYFTLLASMISVNFIIAKNTNKGAMTNKLLRSLPIDARSVVGTSFILPILIFLIFSL
FT                   PNILVGMGVSFMLGEKIIVNPFNLLLTFIIFYIYASITFSMAIIYPESSVVSYLRSVPL
FT                   FILIIGLALVEKFMKNINYDVSNILNSLPLVVLILAVISIFILIVFYKFSLNKFIRKEL
FT                   "
FT   gene            534086..534466
FT                   /locus_tag="CPF_0449"
FT   CDS_pept        534086..534466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0449"
FT                   /product="putative lactoylglutathione lyase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82225"
FT                   /db_xref="GOA:A0A0H2YP15"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP15"
FT                   /protein_id="ABG82225.1"
FT                   /translation="MASKMLHTCIRVKDLDKSLKFYKEALGLIETRRMDYPEYKFSLVY
FT                   LSDKEDGYEVELTYNYDQEKPYDLGNGFSHIAVGVEDIEAERERHISLGYEVTPMKGLS
FT                   DGAATYYFVTDPDGYKVEVIKL"
FT   gene            complement(534603..535460)
FT                   /locus_tag="CPF_0450"
FT   CDS_pept        complement(534603..535460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0450"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82856"
FT                   /db_xref="GOA:A0A0H2YQK4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQK4"
FT                   /protein_id="ABG82856.1"
FT                   /translation="MDRFDRQLELADGIETEYLRILYYTFEKNYKDTYKSYEYKRLCTI
FT                   VDGEKNVRINNGENIIYDSSKYMLLPPNSSVEMKIEKPTKALVLELNEDLINTVSEKLS
FT                   YELDVDLNKSILEKPFFNENNELIELTTKRIVETATKDTNNKEFLLDLYAQEITYSLLN
FT                   TKGAKDIISSDFNNPINRSIQIMKGNLKNNITVSEIAYDLNMSLPSFSSKFKKAMGMTP
FT                   NDYLTSLKLNEAARLLKFSSVTEVAYDLGYENISHFIKLFKKKFGLTPKQYSLKYSGEV
FT                   IQIQ"
FT   gene            535649..536797
FT                   /locus_tag="CPF_0451"
FT   CDS_pept        535649..536797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0451"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83458"
FT                   /db_xref="GOA:A0A0H2YRA0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRA0"
FT                   /protein_id="ABG83458.1"
FT                   /translation="MSYKFFMPAISLMGADCLKDAGDQVGELGFKKALIVTDKVLGQIG
FT                   IVKKVTDVLDNKNIEYAIYDETKPNPTVKNVNDGLALLKEKECDFVISLGGGSAHDCAK
FT                   GIALLATNGGEIKDYEGVDKSKKPQLPMVGINTTAGTGSEMTLFAIITDEERHIKMALV
FT                   DKHLTPIIAVNDPILMLAMPKSLTAATGMDALTHAIEAYVSTAATPITDACAEKAIELI
FT                   SNYLVNAVENGQDVEARDMMAYAEYLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNA
FT                   ILLPHVQEYNKSTSASRLAKIAKIMGGNIEGLTDEQGADLCIDMIKSLSQTIGIPEGLG
FT                   VLGVKESDFETLATNALNDACSLTNPRKGNLEEVIAIFKKAM"
FT   gene            536987..537310
FT                   /locus_tag="CPF_0452"
FT   CDS_pept        536987..537310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35553.1; match to
FT                   protein family HMM PF08821"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84111"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU70"
FT                   /protein_id="ABG84111.1"
FT                   /translation="MSIAIMACRKVIGKCAASGCFKAYNNSTAAFSIYGENKEDLASFF
FT                   YCAGCKDTLVEGENWTHKVKQLKKNGVETIHISHCIESKCDDLKKHERILEKEGFKIVH
FT                   GTH"
FT   gene            537424..537816
FT                   /locus_tag="CPF_0453"
FT   CDS_pept        537424..537816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0453"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by similarity to GB:AAP24625.1; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84722"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV47"
FT                   /protein_id="ABG84722.1"
FT                   /translation="MNLKKIHHVAIIASDYKKSKDFYVNLLGLKIIREVYREERDSYKL
FT                   DLEIGDSQIELFSFKNPPKRPSYPEACGLRHLAFEVENIEKQVRELKEKGIKVEEIRID
FT                   EFTGRKFTFFSDPDDLPIELYEITCN"
FT   gene            538113..540347
FT                   /locus_tag="CPF_0454"
FT   CDS_pept        538113..540347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0454"
FT                   /product="putative enterotoxin EntC"
FT                   /note="identified by similarity to GB:AAS41916.1;
FT                   similarity to GB:BAD02898.1; match to protein family HMM
FT                   PF06347; match to protein family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84864"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUR9"
FT                   /protein_id="ABG84864.1"
FT                   /translation="MKRKKLSIFILSAAIVTSSVSYGMTAKADEVKETKGYNYNVNLSE
FT                   QKAVANNKISVKKVNGEILGYANPFTMLQILNMNGKTVEVITQSGLRGYVDANEFTLVE
FT                   SAVNDKLIEKNIEGHVTNVSTVLNLRKEPRIGAEIINRLLNNTKVNILGKQGSWYKIEL
FT                   NGQKGYVYGMFLNEGTMKENSSKTIANKKSEVKSEYKKEKKSSVKKEAKKEVVSGAKAK
FT                   VAQKQREEAKANMTSEVKPAINKETKSNNKVEVKSEVKKEAKNEVKTEMNSVTKAETNQ
FT                   VVTSEIVQAVKSEKNPETNLQVRPEIKSEEKTEMISKENLNVNPEAKKEGISEEIKPEV
FT                   NTEVESKPEMNKEVKVEEAKVEEKQEPKQEEVQDSKAKEMDELLKSEEYKFLRMSISYG
FT                   ERLVDRNDVYTKDSLKILRTELAKAKKVFQDKDNLTMKLVQDTRDDLERAIVDLVKLSD
FT                   VKKPVKSKAKVEVKKESNTEKKEEVKPVEASEEKVEVKEEPVKVEEKVEAKKEEVQDPK
FT                   AKEMDELLKSEEYKFLRMSISYGERLVDRNDVYTKDSLKILRTELAKAKKVFQDKDNLT
FT                   MKLVQDTRDDLERAIVDLVKLSDVKKPVKSKAKVEAKKESNTEKKEEVKEQPAKVEVIV
FT                   PEVKENKEIKKEEPVKAKEVVKEKKSREEEIEEILKSEEYRFLLKDIAYGERLSEKITV
FT                   YTRDSLKVLNAAIEKAGRIVRQKEKLTVKLVQDTRDDVDRAIVDLVKKNN"
FT   gene            complement(540545..541330)
FT                   /locus_tag="CPF_0455"
FT   CDS_pept        complement(540545..541330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0455"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by similarity to SP:P39075; match to
FT                   protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84232"
FT                   /db_xref="GOA:A0A0H2YT62"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT62"
FT                   /protein_id="ABG84232.1"
FT                   /translation="MNKYFSIGEVSKITGLSIDRLRNYDKIGLLKPSYIDPNSGYRYYS
FT                   ENKFRKLRIIKYLRKIGTPLKEIDLILNKNIDSQEFVKFLELKIRDIEKEIESLNMIKE
FT                   DISEIKHTFECNFKLSNINYIHKKYINERYVVKKSLNRNINFVVSHREQVFSKFKSEIN
FT                   TLEPPRSLEKGLYLHSLEDLENNNTEVYMLLKDYENIHNFIIPSGNYLCLSYKENERDK
FT                   AIFKLKSYIEENNIKVKGPILNLVLTTLPKEEFQFQILI"
FT   gene            541443..543263
FT                   /locus_tag="CPF_0456"
FT   CDS_pept        541443..543263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83649"
FT                   /db_xref="GOA:A0A0H2YRS3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRS3"
FT                   /protein_id="ABG83649.1"
FT                   /translation="MTIKQMNIKIFKLPLIFAVLSVVLMGLYKTIFGVENTIIGLIIAM
FT                   ASYAFLRLDLTSYPIYKSMIFLILNLFLAISAYISAINPFVGLIINFLILFTVSFIYTT
FT                   EFKNVISYIFLLLYVYMWEYSISLDELPRRLVAMGVGVFIIIGIHILFNRRNFKKNSNN
FT                   IIIRSIRNIQKEICHIINESYREKENIYIDSELRKLLILIEGRNNNKFIENHKDDIYFN
FT                   IVLILERINSIINKVGKINNKSKDVIDYLNSLNHDLENITLFLERKVDCINEEKDDLNK
FT                   DSTINNWTEKEYAFLGECTELIRLLEKNINNLYEYNRKKSRKRIKVKFNLKELLIGNSS
FT                   LKMKHLRVAYSLKLAIAVSLIMFIVDLFKIPQGRWIVTSVYVVIQPYEEETLTKAIKRF
FT                   KGTIIGVIIYISIFTFFPHIIPLELLLLILMFLYFVQKDYEKKVVCTALMTLSFGLSRS
FT                   TVGYLAFYRFLFVIIGIVIALGINKIIFPQSIKNSIYDLKERYLELTSKLLYELKSILY
FT                   EEKYNENTIKLLLDCNLIECKLMENKLIAENLELKDLVYKQSIILSKIRCLILFINYSN
FT                   WGISSKHINVDKNLLNVIFNKIEEELREIY"
FT   gene            543568..544077
FT                   /locus_tag="CPF_0457"
FT   CDS_pept        543568..544077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0457"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84276"
FT                   /db_xref="GOA:A0A0H2YT97"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT97"
FT                   /protein_id="ABG84276.1"
FT                   /translation="MDFGTITNYFSEYGLLFLFVIILLEYMNLPGLPAGIIMPAVGVLV
FT                   SKSEMSLITALLVSVIAGLIGSWILYCIGRFGGELILKKYLNKFPSHESFVNSKIDYLR
FT                   EKGYTGILISKLIPMARTVISIPAGVLKLNFLKYSVYATLGIFIWNTVLISSGYFLGEE
FT                   LLKFLG"
FT   gene            544136..544768
FT                   /locus_tag="CPF_0458"
FT   CDS_pept        544136..544768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL95465.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPN8"
FT                   /protein_id="ABG82301.1"
FT                   /translation="MKAVVKRVYNGYLNFVLKTSTVSFENFYEIDDEIMDNCILGFWKE
FT                   NSYSMNLLLKKLNRYYKVKKNQELDVNVVVTDDSRGEYIEYILNSYGANALKMPDDVHK
FT                   KEFIKELREKSKEDSLVALALDGPIGPLHEPKKIAFSLAKDSNKPFVGIKVRHSKRLKL
FT                   KNKSDNYGIPLPFTKIQFSADVFGNIDNEVLTNFKEYKEIVKERLCF"
FT   gene            544990..545694
FT                   /locus_tag="CPF_0459"
FT   CDS_pept        544990..545694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0459"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83581"
FT                   /db_xref="GOA:A0A0H2YRL7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRL7"
FT                   /protein_id="ABG83581.1"
FT                   /translation="MEKYNVLVVEDEKEIAEAIEIYLKNQGYNVFKGSNGLEGLEIVEK
FT                   EEIHLAVVDIMMPKMDGATMVMKIRESYDFPIIMLSAKSEDMDKILGLNIGADDYVTKP
FT                   FNPLELLARVNSQLRRYSKYLNMVKKDEKKTNSYAIGGLEVNSDRKEVILDGDVVKVTP
FT                   IEFKILQLLIKSPGRVFSAEEIYERVWNENAVNTDTVMVHVRNIREKIEIDPKNPKYLK
FT                   VVWGVGYKIEKQ"
FT   gene            545669..547900
FT                   /locus_tag="CPF_0460"
FT   CDS_pept        545669..547900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0460"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82555"
FT                   /db_xref="GOA:A0A0H2YPT2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPT2"
FT                   /protein_id="ABG82555.1"
FT                   /translation="MAIKSKSNKENLQVNKENRTNKTKWFFTIITLILIGIISICLLLS
FT                   YPIIKKNAPNYITSYSLLDNYNFREKIINTNYGIYYDYLEKKAEENDKELNPIEDLFTL
FT                   KRENISNSEESPEYNLNEDKRELNSYIKELINKVHSLGNLRVYAMDEEGNTVYETKGDQ
FT                   NWLLEALAKGSYIENGDLENYYRFYMVLKYNNRGKVSLEKIYGEDSPRVSNLLLDMDSQ
FT                   YFAYHNEYEAKPIENMTYVYAVPKTLEYQDNLYYSEMNHKIMALGSASAPFIMIGIIVT
FT                   CLLALLIPFKYTREVLGFNKFLKIPFEINFIIASIMLAFTIESGRLIIIPTLQGGLSEA
FT                   LKMTSLPHLDIVTNIINVLYWMVIYGFVFFEVIYVKYIFNIGFKNYIRKHLLVYKVKDF
FT                   IFFILRKFINYIKGIDLNKNSDKVLLIILGINFVIVSILCSVWFFGIFGVVIYSGILFY
FT                   FGRKYIDKWKKDYNKILEKTKEISNGNLDSKDDEDCGFFNPMRDELNNIQKGFKAAVDE
FT                   EVKSQRMKTELISNVSHDLKTPLTSIIAYVDLLKGEEDEEKRKAYLETLERKSQRLKHL
FT                   IEDLFEVSKATTGNINLNIMDVDISYLMKQVVLELDDKINEAGLDMRLSLPEEKVILPL
FT                   DGQRTYRVFENLIINVVKYALPNSRVYIDIKEGRENVDVIIKNISADEITFNINEISDR
FT                   FVRGDKSRNTEGSGLGLAIVKSFVELQGGKFHIEVDGDLFKAIISFKKK"
FT   gene            complement(548090..548392)
FT                   /locus_tag="CPF_0461"
FT   CDS_pept        complement(548090..548392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0461"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84842"
FT                   /db_xref="GOA:A0A0H2YUU2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUU2"
FT                   /protein_id="ABG84842.1"
FT                   /translation="MKNIFIFILFIAIDYFLSIGLFISLNFIFFKINSIKFNQDYKKYN
FT                   FYFYFLSKLIPVFLISIFIIKSAKFIGLVYLLFSVIYKIIDFIKFLNYFDKKDFK"
FT   gene            548818..549855
FT                   /locus_tag="CPF_0462"
FT   CDS_pept        548818..549855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0462"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83659"
FT                   /db_xref="GOA:A0A0H2YT30"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT30"
FT                   /protein_id="ABG83659.1"
FT                   /translation="MIKSIKKNLKPKILISNLILIIGIVIFVTLYGAVFGSANSLVGVC
FT                   AITAMLMFVDVHLSLKLNEAIITTVLSFVLMGVSSQIASINPFLGFVVNFISIFVVSYL
FT                   VTNAMETKAYLPFILCYVFIEGTPITWSELPRRLIALFVGGALIALVYYFSHRKKDDSD
FT                   HMNISEMIKTMNKNTLQFNFSLRMALAVSIAMLLGSILGFQKSMWISITAMSITQPHFD
FT                   DTKTRVKERFFGTLIGSAIFVLIFVYIVPQQFSSIVLLILSYIYTFIKEYKIKMIFITM
FT                   SSLGAAMILFQPGVSVPMRIAFIVMGIGIALVVNKVIYGRLKLEESNEELDETIKDIDK
FT                   VNDEF"
FT   gene            550623..551036
FT                   /locus_tag="CPF_0463"
FT   CDS_pept        550623..551036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB80172.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRH8"
FT                   /protein_id="ABG83022.1"
FT                   /translation="MSLCKGTVKIGKKNLKRGTNKYFFKRYLKKNYEFTVSEFKDRNKF
FT                   ELLEPVNVEGLDFFVDVEFKGIRPKEIDLRSIDNLEKYQFERYEHWISNNLGISLENSK
FT                   WKNKKFNWGNLNVKLSKTVKEDLGCITIKVVYN"
FT   gene            551513..552211
FT                   /locus_tag="CPF_0464"
FT   CDS_pept        551513..552211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0464"
FT                   /product="capsule chain length determinant protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83528"
FT                   /db_xref="GOA:A0A0H2YRB9"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRB9"
FT                   /protein_id="ABG83528.1"
FT                   /translation="MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQY
FT                   EAKTKLFIGKQETTQENASYNNNDVMMYQKLMKTYAELVKTSDLVTKAVKSANLDYNQN
FT                   QIRGILNNLNVTPSADTQILDLSFKGGNPKEVLKVSEAITNEFISESKELIPNGNVQVI
FT                   QKPQLPEHPVSPNKKLNILIAFVLGLMLGVGVVLLIEYLDNTFKSREELEKTLDLPIIG
FT                   AIPDYDSIEK"
FT   gene            552224..552877
FT                   /locus_tag="CPF_0465"
FT   CDS_pept        552224..552877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0465"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82882"
FT                   /db_xref="GOA:A0A0H2YPY2"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPY2"
FT                   /protein_id="ABG82882.1"
FT                   /translation="MLILENNPKSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEG
FT                   KSTTSANLALSFAQDGKKVILIDCDLRKPVVHKEFQISNSRGLSEFLIGNVEFSKVVYK
FT                   HESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKILSTK
FT                   VDGTILVVKYGYTKKDAVIEAVKGLRAVNANIIGTVFNGEENQRGKYYHYYKKD"
FT   gene            553078..553746
FT                   /locus_tag="CPF_0466"
FT   CDS_pept        553078..553746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0466"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84669"
FT                   /db_xref="GOA:A0A0H2YUB3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUB3"
FT                   /protein_id="ABG84669.1"
FT                   /translation="MYESMEKVQEEKEYIKADQGNRIYLFFKRLIDILGASFGLIILSP
FT                   VFLIVAIAIKIEDSKGSVLFSQKRVGQYGKEFNMYKFRSMVSNAEELKAKLMEKNEMSG
FT                   PMFKMKHDPRITKVGKFIRKTSIDELPQLINILKGEMSLVGPRPSLPKEVAKFEPWMLE
FT                   RLEVKPGLTCYWQVMGRNDIDFEDWMKLDIKYVHDRNFWLDIKLIFKTFFVLFGDESAS
FT                   "
FT   gene            553761..554760
FT                   /pseudo
FT                   /locus_tag="CPF_0467"
FT                   /note="UDP-N-acetylglucosamine 2-epimerase, degenerate;
FT                   this region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to SP:P27828"
FT   gene            554774..556003
FT                   /locus_tag="CPF_0468"
FT   CDS_pept        554774..556003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0468"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82954"
FT                   /db_xref="GOA:A0A0H2YRC3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRC3"
FT                   /protein_id="ABG82954.1"
FT                   /translation="MKKLNIIGLGYIGLPTALSFASAGIEVIGTDYNKEIVNTLNNGRV
FT                   TFKEDGLYNLYKKALNKGIEFSTEYAKTNKYIITVPTPYIKESKKLDARYVISAVESVL
FT                   EVCDKGTILVIESTVSPGTMDKFVRPIVENRGFVIGEDIHLVHAPERIIPGNMVNELKN
FT                   NSRTIGSDNIEIGYEVKRWYETFCKGEIVVTDIKTAELSKVVENTFRDINIAFANELSR
FT                   ICRKENMDVYELINIANKHPRVNILTPGPGVGGHCISVDPWFLVGDYPEIVNIIKAARE
FT                   VNDSQPDFVIDRIRDIMNENGITDISKVGLYGLTYKENVDDLRESPTLQILEKLERYFV
FT                   KGIKLYDPWIEEKIFENQYNNFNEFLDNIELVVVLVAHDHIKEFKDMLEGKLIFDTKNI
FT                   LRNLNGIYKL"
FT   gene            556017..557166
FT                   /pseudo
FT                   /locus_tag="CPF_0469"
FT                   /note="glycosyl transferase, group 1, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to
FT                   GB:AAD24452.1"
FT   gene            557181..557780
FT                   /locus_tag="CPF_0470"
FT   CDS_pept        557181..557780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0470"
FT                   /product="bacterial transferase hexpeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83066"
FT                   /db_xref="GOA:A0A0H2YRM2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRM2"
FT                   /protein_id="ABG83066.1"
FT                   /translation="MKIFKLSILKTIWYSIKFKSKILVGKRCKIYLKKGSKIIVKNGVL
FT                   RIGIEHNTLVHTILEINESGILNIDGNVSIGKGCKVVIANRAKLEINNDSYINECSKIV
FT                   CLKNIHIGKKCAISWGVNILDTDYHYLIKKGIKNVKEKNIYIDNHVWIGCNSTILKGSF
FT                   IGENTVISANSLVNSKIKKNGLFINGVFKEGYNWSK"
FT   gene            557796..559688
FT                   /locus_tag="CPF_0471"
FT   CDS_pept        557796..559688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0471"
FT                   /product="heparinase II/III-like protein"
FT                   /note="identified by similarity to GB:BAC93122.1; match to
FT                   protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85036"
FT                   /db_xref="GOA:A0A0H2YV70"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV70"
FT                   /protein_id="ABG85036.1"
FT                   /translation="MFFKIIKILKQDGFNILYIKIKKKLYEKFKYLKYLITKEKLYNKL
FT                   EFVSSKKRLLLDNNILRKNICYKTEIINIANKVLDNKLEFLGIKICETDNKIEWNKDYL
FT                   NNFYWKNKYYKNIQLTDKNFKADVKIPWEISRLHHLVFIGEAYILSNNEKFVNKFVSII
FT                   NDWKKNNPYKMSVNWTCAMEVAIRAVNIITSLEFFEESKSLKKEIPNINGILYKHGEFI
FT                   FENLEIVDGIKSNHYLSDICGLFWIAIYFKGFNNETKKWLEFSFKEIENEMKNEVNNDG
FT                   SSYEGSTSYHKLVTELFLFTAIFAKKNGYRFSKEFDNKLKLMVEFLYNISNQDNTIPLL
FT                   GDNDDGRFIILSNYYSKEKYCIDYIIDLFNGYSSKNYNFIRNEKIKYYDSKFVFEENDK
FT                   LEKKFFNNITQYYYGGYYILKNNRFKLLIRCGELSFRGQGAHSHNDQLSFILSIDGKEI
FT                   FIDPGTYVYNSNYEMRNKFRSTCMHNTVQIENEEQNLIDFDNLFALKERTFSKKLVFNE
FT                   TFFSGEHYGYFKSKGIVHKRNIEIQNNILLLNDIFYDNKKYKKTINFNLAKNCCVEIIN
FT                   NEIIIDSKVKIVTDMEYCVDVGKFSARYGVLEDTKRITFTTKENFCSLKLKLID"
FT   gene            559699..561078
FT                   /locus_tag="CPF_0472"
FT   CDS_pept        559699..561078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0472"
FT                   /product="putative capK protein"
FT                   /note="identified by similarity to SP:P39860"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84639"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU85"
FT                   /protein_id="ABG84639.1"
FT                   /translation="MYKSFVDKIPEIFFAPLEFLNNKIFKKLIKSRKYKKIYKNTINEI
FT                   KRFEIMNSSEIEEFSFKKLKKLLIYAFENVPYYNNLFNSINFNPNYMKNISEIKKIPLL
FT                   DKRIINENYNNLISNEFKNNKSKLIKLSTGGSTGKPLEFLSLKYYNEARENAFIDYIFS
FT                   KNGYKKDMRTIILRGDKVRNIDKKKAKNIYWRKKRGTNDLIMSTYMLNDVSCIFYIKKL
FT                   IKYKAKCIKAYPSALELLANKMISMNLKNKDVELIICASENLSCMQIDIFKKVFCNAKI
FT                   FDFYGHTEHCCLAELNNKNKYTFIPNYGYVELEENDDGSFEIVCSGYNNYVMPFIRYKT
FT                   GDLVKDFNFIDGKLEVNKIEGRKKEYIIDKLGNKIVFTGSYKILDCVINKILAGQIIQE
FT                   NIGHLYVDVIVNEKFEDNDKNSIILAFKSKYKDRFDVDVRIVKELRKTSRGKINFFIQC
FT                   I"
FT   gene            561106..562176
FT                   /locus_tag="CPF_0473"
FT   CDS_pept        561106..562176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0473"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83834"
FT                   /db_xref="GOA:A0A0H2YSV1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSV1"
FT                   /protein_id="ABG83834.1"
FT                   /translation="MKITIIGPYPPPIGGISIHIKRLKRFLYNNGLKVKVLNEETYINI
FT                   SENIIPLNGYKNLFKLLRKDNSELIHFHTINKYIRSLLWLIKIIFKKKIVLTIHGQSMV
FT                   NQYKNSNIFIRKMLIKTLNDIDATIFVDKNNLNFFDKIVKNRDKLKYINPFIFPCISEN
FT                   NIERPNLKSFFNNNDFKILMSGNIRFFEGKELYGFKSMINATKKLKEKGENIKVLMIIM
FT                   ESNNQSIEEKEYYKFIKKQVLDNELQNYIFFYEPINEEIFDLFGKVNLFVRPTIVDGFG
FT                   ISLAESIYMKTPAIATDVCIRPNGTILYHDNEELANIIYNVKNNYDYYKNSLDNIKIQD
FT                   SSKDILELYNNLLKKV"
FT   gene            562178..563644
FT                   /locus_tag="CPF_0474"
FT   CDS_pept        562178..563644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0474"
FT                   /product="putative polysaccharide transporter protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82583"
FT                   /db_xref="GOA:A0A0H2YPV6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPV6"
FT                   /protein_id="ABG82583.1"
FT                   /translation="MGKKVKNAAFIYAFGQILSKSINFIFIPLYTNKLGTYGYGQLALI
FT                   DMLFSLISVFIILGINSGYIRFYKTYNELEKKRLMNTTLTFSIIFSIVFIIVNMIISQF
FT                   YINKILSLENLNLIFFLLLIRCATEQIIYLMILEYSMNYEAKIVVKLECFKLILNLTLI
FT                   VYFVAIVNQGILGMYKGYVISNCIILAFLIFKNINKFKLEIDFKMLKNMLKYSIQLIPS
FT                   GISAIVLNLADRYILEFFSGLSITGIYSLGYKFGTLIDPLFILPFKKVFTPFKFEIYRD
FT                   NDANEKLNEWYYKYNIIGIAVVFMISILGKLIIIITSPVEFINAYKIIPLILISYFIYG
FT                   KSEFYSLGIYISNKTRFDCYIMILSGIINIILNFILIPFAGMYGATIATIISYYLSNIL
FT                   FKIVSKRCCEFRYNLNKNIVKFYVISIILYLSYFILTYNNTNLLMELLLCIFIILIWAI
FT                   ITNYLKIIDKKVYYKIIYLIKKKVLKNENM"
FT   gene            563631..564848
FT                   /locus_tag="CPF_0475"
FT   CDS_pept        563631..564848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84199"
FT                   /db_xref="GOA:A0A0H2YT36"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT36"
FT                   /protein_id="ABG84199.1"
FT                   /translation="MKICKWYKNAISPVIFMIDDLANVWVDSNNNDSLDIGEDWGFFKR
FT                   HEKSSITYLENDILEKFENVKTTFFVPVGERVGMIKNSKIKSISRAINFDEKSKEFFRE
FT                   LHNCKKYELAYHGTNHGRVGIKNTDFIQEWALFKDLNEALDKISLGVSIFNDAVGQLPL
FT                   GGKYCGYISNEFSDESIDESGFIWWCRFCNLDVYDDIKKNSMKINFNGGDKNFITNNDV
FT                   KYFGKNKVIDIPTTVNGGLLTGIYNLNGNFLKKSIKKIFPNLLIKRKLKLIDKLLQNNL
FT                   VISIQEHISPARDDGRRQTPNIYDDKLSLIKIFSYLHDKNVWFCTCSELASYVYYRDNL
FT                   KLTIENDTFEFNIKELKDYKFKNISIKSDKYNKIITPKGKVIKEENGVLNIPIEYGKYK
FT                   LKKGEL"
FT   gene            564848..565999
FT                   /locus_tag="CPF_0476"
FT   CDS_pept        564848..565999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0476"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84432"
FT                   /db_xref="GOA:A0A0H2YUC0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUC0"
FT                   /protein_id="ABG84432.1"
FT                   /translation="MLVSLIYVFKQVLSANLDLFYILSLILLIKSLIKKEKYLIKLLYV
FT                   IYIILFYTGIQIIFLNTSIDLIRYFVSSFKLILNFNLLFYIIKKIKFININKIIKNISY
FT                   IFFIILVFALILRNNNILWRLNDYVNTFEEVRLRFFYYEPSELGFQVAIIIIIFVFKIY
FT                   TKKIINKKDFCIIIFLSIILSLTSAYGAIISLMLALIPILFKSFKLNSYKKLLIAYSII
FT                   LISIVIIYLNFYKISDSYIVQRGLSIISGEDGSVNYRFDIGLNIMINALKNTNLLGVGL
FT                   SNANTDNFIIEYSNFGLVEVIANSFMYVITELGVLAVVFLVYLLIKCLISAKINNSILK
FT                   LSLIIYIFSYQIAGGYFSNPTNWIIYGIILSNIKDEELFGRKD"
FT   gene            566079..567206
FT                   /locus_tag="CPF_0477"
FT   CDS_pept        566079..567206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0477"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82226"
FT                   /db_xref="GOA:A0A0H2YMY6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YMY6"
FT                   /protein_id="ABG82226.1"
FT                   /translation="MEYYKERYKVIVINDKKFGENTSNLCIKNFKYYTGESIFKSNNYK
FT                   EKYFKLKSLLKKSFLIKLARGYKLSELKFLKDNSDTINEIINYIREERITLVYITVPDL
FT                   YPIYIAKCIKKELSNVKIITEVRDILNHNIGGGNPKFVLKKAEKIMLNISDELIVLSEG
FT                   IYDYYKDNFNETKISIIKNGYNEKLFENLNKINLKKDKLTLAHIGSIYKGRNIKNFILA
FT                   LNKFSIEESKNIVFNIVGYLDDIAQKDLEELDIDNLNIEINIIGTVTHEKAVEYLINSD
FT                   IAVILTHIKGSGYAIPGKVFEYIGAEKPILAVTEDLPLINLINSKYGVCSKHNINSIVL
FT                   SMKKLLKMNFDFEDKIKFTRKKQAEKILKILEKYI"
FT   gene            567223..568551
FT                   /locus_tag="CPF_0478"
FT   CDS_pept        567223..568551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0478"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82822"
FT                   /db_xref="GOA:A0A0H2YPT5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPT5"
FT                   /protein_id="ABG82822.1"
FT                   /translation="MKILHYNLGLPPYRSGGLTKYSTDLMIEQSKNKEIYLLFPGRYTI
FT                   NNKFKIKKFKKFRNIKVFEILNPKPVPLMGGVENIDEFIKPIENCRKESLKFLNTINPD
FT                   IIHIHTLMGLPIEFIRAAKELKIKIIFTTHDYYGLCPKVNFLKCNGCLNMCYECNKNSY
FT                   SITKIKIMQSGVYRTFKESSIIKYIRKNVKKNDLKKESNKVLNGDSVLEKNSEYEKLRG
FT                   YYIEILNLFDKLHFNSSITKDVYNKFCKTNGDIISITHSSIKDNRLIKDFKNKKLRILF
FT                   LGSLDEYKGCLYLINVLKEINSSLWELNIYGNDYQIDFGNENIHLNGRYMQKELSSIMK
FT                   NNDILIVPSLWKETFGFTLLEGLSNAIPIIATDTVGSKDLIKNNKTGIIIKKDLMKETI
FT                   KNLIYNREILEEINKNIIKDKYVFEMKNHEKIIEEYYKNIIKE"
FT   gene            568563..569444
FT                   /gene="rfbA"
FT                   /locus_tag="CPF_0479"
FT   CDS_pept        568563..569444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="CPF_0479"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by similarity to SP:P55254; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83457"
FT                   /db_xref="GOA:A0A0H2YSK7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSK7"
FT                   /protein_id="ABG83457.1"
FT                   /translation="MKGIILAGGSGTRLYPVTKAMSKQMVPIYDKPMIYYPMSVLMLAG
FT                   IREVLIISTERDLPNFKELFKDGSELGLNIEYKVQEAPNGLAEAFIIGEEFIGDDNVAM
FT                   ILGDNIFYGQNFSSNLKEAAALENGAMVFGYYVQDPKAFGVVEFDENGKVISLEEKPEH
FT                   PKSKYAVPGLYFYDNTVIEKAKGLKPSARGELEITDLNRLYMEEGTLKVNLFGRGMAWL
FT                   DTGTHASMLQASNFVEAVQNTQGTYIACLEEIAYRKGWISSEKVLNLAKPLMKTGYGKY
FT                   LVDIIEELEQKK"
FT   gene            569550..570119
FT                   /gene="rfbC"
FT                   /locus_tag="CPF_0480"
FT   CDS_pept        569550..570119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="CPF_0480"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by match to protein family HMM PF00908;
FT                   match to protein family HMM TIGR01221"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83836"
FT                   /db_xref="GOA:A0A0H2YRI0"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRI0"
FT                   /protein_id="ABG83836.1"
FT                   /translation="MSNFKFIETKIKDLYIIEPKVFGDERGYFMETYSQKAFEEAGLTM
FT                   KFVQDNESKSKKGVLRGLHFQTKHTQGKLVRVTQGEVWDVAVDLRKGSPTFGQWEGVHL
FT                   SAENKRQFYVPEGFAHGFVVLSDEAVFNYKCTDFYAPEYDSGLLWNDKYVNVEWPLEGI
FT                   EEIILSEKDKKQKTLKELDIPFIYEG"
FT   gene            570133..571017
FT                   /gene="rfbD"
FT                   /locus_tag="CPF_0481"
FT   CDS_pept        570133..571017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="CPF_0481"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84646"
FT                   /db_xref="GOA:A0A0H2YUI0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI0"
FT                   /protein_id="ABG84646.1"
FT                   /translation="MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVD
FT                   KLDITSLENVKNVLNEEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEI
FT                   GAKLVQVSTDYVFSGFGEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWL
FT                   YGYVGHNFVYTMMRLGKEKESLNVVNDQKGNPTHANDLAYHILKLIETEEYGIYHCTGK
FT                   GECTWYDFAKEIMELAGNKCIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWK
FT                   EALKSFFENQQNQ"
FT   gene            571045..572094
FT                   /gene="rfbB"
FT                   /locus_tag="CPF_0482"
FT   CDS_pept        571045..572094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="CPF_0482"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82897"
FT                   /db_xref="GOA:A0A0H2YPT8"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPT8"
FT                   /protein_id="ABG82897.1"
FT                   /translation="MKTYLVTGGAGFIGSNFVLYMLKKYKDIKIINLDKLTYAGNLENL
FT                   KSIENDERHIFVQGDICDKELVSSLFEKYEIDYVAHFAAESHVDRSIREPEVFAKTNVL
FT                   GTVNLLNCAKNAWETEEGWKEGVKFLHVSTDEVYGSLGETGYFMETTPLDPHSPYSSSK
FT                   ASSDLMVKAYADTYKMPVNITRCSNNYGPFQFPEKLIPLLINNCLNHKDLPVYGDGMNI
FT                   RDWLFVEDHAKAIDMVINGGRLGEVYNVGGHNERTNIQIVKTVIEYLHDNVDEEITENL
FT                   IKYVEDRKGHDRRYGIDPTKIKEELGWYPETTFEVGIKKTIKWYLDNKEWMENVTSGDY
FT                   QKYYEKMYK"
FT   gene            572270..573190
FT                   /gene="galU"
FT                   /locus_tag="CPF_0483"
FT   CDS_pept        572270..573190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="CPF_0483"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83366"
FT                   /db_xref="GOA:A0A0H2YSC4"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSC4"
FT                   /protein_id="ABG83366.1"
FT                   /translation="MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEE
FT                   AIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIR
FT                   QKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYKTSVLGVQT
FT                   VPQSHVSKYGIVDGKYIEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENT
FT                   KPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPEIREGF
FT                   IEYLNNLSEKESLFKKEVEKDIVTV"
FT   gene            573555..574202
FT                   /locus_tag="CPF_0484"
FT   CDS_pept        573555..574202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0484"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /note="identified by similarity to SP:P17869; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84234"
FT                   /db_xref="GOA:A0A0H2YTX7"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTX7"
FT                   /protein_id="ABG84234.1"
FT                   /translation="MAEKKQRFINKTAREIRLLGEKGNKEALNELIIMGKKGDKCAMAE
FT                   IVSIYEGLINKYSTRFFINGYDVDDLKQIARSVIIESISKFDGDHGSEFIFFISTNVKN
FT                   KLGTMCKKKENRLDFSSLDSPIGEGITIGETIKDDISIEDEYVEREKMRAFVKALANIS
FT                   KSDREFILYVYKDRGNFQKYCQEHKHITTYSKARWRKERILKKLREEMKNFE"
FT   gene            574617..576845
FT                   /locus_tag="CPF_0485"
FT   CDS_pept        574617..576845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUT7"
FT                   /protein_id="ABG84837.1"
FT                   /translation="MNKLREKGVSLLEPKNKGVLTVNFKHPILKDYKGNGRVITKSLGA
FT                   DVGKDYEAANKFLNEIKSIINNSDCYENYYGFLKSLEKYSEKSMKIVFDNTHFIEEFYY
FT                   DSKKSILEKFIGISHNNINKKLEEELKDVFKLLELEQFELIHKGDKSFEVFAEEEIRSR
FT                   FNFEFKKKIQLLGGDYGYRKKLISNLIGSIGEFSEGYKNTNEAKEDKLVNKFFYNIGAP
FT                   NFEVIFKQDSNKFKFIGTPYSQCIINKKIDLKRILEEFLFRINSLDNIFQYKLEFRERK
FT                   SGKSYVFNNEFLVKGNLICNKDLDKHSLDNIGELAYIYFHIGYKEKSQEELKSKFFYIL
FT                   ESLFNEKYNPNNSNLIFSDIRLEGNFMGEEILHNKEKDFILADYSGNINEFRNQLLSYE
FT                   TRRNLASSDEIIWLFNSEEEAFERNLEVLKYLIINGYLSKTNIYIYEKPIYKDYFSSEF
FT                   DNSESNFMNGLNEKEAYHMPNIFNSFLKDNFQNLLEELGEEEPSIIIRGREEYYLNLIM
FT                   ERVIFPCDEEKKVLSNKWEIEKIINQSEEVLINKIKEKSSLINEYNPSYKYGRLAILSL
FT                   GINRKVKREFIRRVRGSYDKNLKEFSLRMAYNFGGREYKSLCPERLLETSIKNSIKTFL
FT                   LNPYKIRKDINILEFEKSIEYIMESISEEIIEEVEILIREDNLLKWKEAAELLKDDIIE
FT                   GRNLIEEIIEETFVVSNDIFREDRVLKIIKEVLKNNSIFKAIKGEFAI"
FT   gene            576923..577939
FT                   /gene="galE"
FT                   /locus_tag="CPF_0486"
FT   CDS_pept        576923..577939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="CPF_0486"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83942"
FT                   /db_xref="GOA:A0A0H2YT47"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT47"
FT                   /protein_id="ABG83942.1"
FT                   /translation="MNILLTGGIGYIGSHTVIELLKDDNNSVVVIDNLINSKKEVKDIV
FT                   EKITGKSIKFYEGDLVNFEDIDKVFKNEKIDAVIHFASLKAVGESVEKPLEYYNNNIIG
FT                   TLNLLTSMRNHNVKKFIFSSSATVYGESEIVPVHEGLQAGFATNPYGRCKAIIEEILRD
FT                   IYISDNSWDIVLLRYFNPVGAHESGLIGELPNGIPNNLMPYVSKVADGELDYVRVFGDD
FT                   YNTPDGTGVRDYIHVVDLARGHVAAMKKLKDGSGISTYNLGTGQGYSVLDIIKAFSKAS
FT                   GKEIPYKIVDRRAGDIAISFADPSKAEKELGWKAEKNLEDMCKDFWKWQCVGMKNFK"
FT   gene            578221..579165
FT                   /gene="galU"
FT                   /locus_tag="CPF_0487"
FT   CDS_pept        578221..579165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="CPF_0487"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by similarity to SP:Q05852; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82996"
FT                   /db_xref="GOA:A0A0H2YQ99"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ99"
FT                   /protein_id="ABG82996.1"
FT                   /translation="MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEE
FT                   AIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIR
FT                   QKEPRGLGHAIYCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYRTSVLGVQT
FT                   VPEENVSKYGIVNGKHIEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENT
FT                   KPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGF
FT                   IDYLRELSATENIFTEANGKEKKDKEEELVTEA"
FT   gene            579492..580121
FT                   /locus_tag="CPF_0488"
FT   CDS_pept        579492..580121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82296"
FT                   /db_xref="GOA:A0A0H2YNB4"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNB4"
FT                   /protein_id="ABG82296.1"
FT                   /translation="MIIISQNTFLVVGILLFCLFRGAIKIKGIIKEEYIYKQIYSNEEF
FT                   IFDLFCIYLIGVASKVYFPLTIAWGNKLVYNPPEVWLSPLWSIKQIYHQGGLGDVIYQL
FT                   IGNSIMLSPMAFFLCYFYSIDEEKLTLGKGIIDKINKILESFELHNKKKLKEDLYVPSL
FT                   NTVLKFCFFMSLFIESSQVILSLVFPNTKRFFEVNDLMCNTLSGVW"
FT   gene            580328..580403
FT                   /locus_tag="CPF_0489"
FT   tRNA            580328..580403
FT                   /locus_tag="CPF_0489"
FT                   /product="tRNA-Met"
FT   gene            580766..585439
FT                   /locus_tag="CPF_0490"
FT   CDS_pept        580766..585439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0490"
FT                   /product="cell wall binding repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83523"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRB4"
FT                   /protein_id="ABG83523.1"
FT                   /translation="MKKVREKVAIAVAIASITTISSFVISNGKKVYAEEVRVTATANVD
FT                   NIKDNGKQLKNESPKANTQEDTNVKNKDLKTDEKKDIKEVESNFVKNAENKTEKINEDK
FT                   SLENNNNKVSTKLESSDKDVKEIKSDKDSKDKDSKEVKDENVEKVHNKKDTVEEVENKS
FT                   DQNNEDKINTDKKVEVKSKDNETSKRDEESKKIKGENKESESKLDKNKALKSDYININE
FT                   SGQALTVGTESQNNSVTDENEKDGWQTIGGKTYYFENGKVSTGKKEVYDTKNGYYKTYF
FT                   FNEDGTLVTDTGIHDYCESWGGKRKVYVNNKGEVENGWKTIDGKTYYFDQYNGMLTNVH
FT                   EIDNGDKKEAYLFDNDGVLRKGTGLKEIDGKWYYFNKDNSLASGWKTIDGKTYYFDTYS
FT                   GRAKGSIRIYDSNHEKYKVYLFNEDGALITEPGIHTYHENWGGERKIYVNNKGEVQSGW
FT                   QIIDGKTYYFDESNGMVTWVHEINENDKNKSYLFDKDGVLVKGSGWKEINGNWYYLNND
FT                   NSLLEGWKTIDDRTYYLDKYNGMVNGVYEVNSGDKKETYLFNKDGSLVKGNGLKEVNGT
FT                   WYYFNSDNSLENGWKIIDGKTYYFNKYDGRLRGCVRVYDDLNHEKYKVYFFNEDGVLIT
FT                   EPGIHTYHETWGGERKICINNKGEVQSGWQIIDGKTYYFDEHNGMAKGVSCISNGDNYE
FT                   VYLFNEDGSLVTGNGWKEIDGKWYYFNNNNSLANGWKTINGKTYYFSSHMSIGPTLIQG
FT                   NRPEKLDLYYFGEDGELINRKGWAKLNDDWFYFNDDSSLKTKWQTIGGKTYYFNETTGA
FT                   MATGQKTTYDYFNHEEKIYCFTSDGSLLKGKGWFSKYDEYNNYKKVWFYIDEDGVLKTD
FT                   YQTINGKDYYFYCDGKMATGIVNVEGVTGNPKFYYFDNNGDLFKKEGWKKINEKWYYLN
FT                   EDGSLVNEWKKSGSDWYYLNPNYGMAIGPTKVQDDMCLGINVYYFEEDGRLTNRTGWIN
FT                   HINGEFSDWYYVENGGKAALGWNKINGTWYYFNSDAKMVTAPTRIFDKDSSKEKIYFFD
FT                   KNGAYRRYSGWYELKPVDGEPCWYYFGEDGLAKTGWQTINGNKYWFAPNGIMCKGTSTI
FT                   FENEVEDGCYKVDLPTYLFNESGALVTSEGWHKVTLYDGEKWCYTDNTGLCKKRLEKIN
FT                   NKYYYFEPHNGLMETGVISIYGFNGNKEANYFFDESGALNTSKGWHKCKDRYNSHYIWC
FT                   YIDDNGELAEGFKEINGNKYYFESGVMSTGKTEIEGNQYYFNESGLIAKGWSQNKDGEY
FT                   YYTDNNGIIQKGWQKINGIWYYFNDGGVMATGPKYMFDENTYDTKLYYFDNSGALQYKK
FT                   GWVNHIGKYNNDWYYINSNNELSTGWQNINGTWYYFYENGKMAKGSTAVTYSNGDKRYY
FT                   CFDNSGAWVTNPGWHSWQDEGNKTCWAYINNDGSLAEGWKEINNKWYYFYKENKVMAKG
FT                   AIKEWDYKTNKPYIQHFFNEDGSWDASEGWKSFKNLEYSPDLQWAYVESNGRLASGWKM
FT                   IGGQWYYFDEGNGFMVTEKRYIDGKFYEFNSNGTLKN"
FT   gene            585866..588070
FT                   /locus_tag="CPF_0491"
FT   CDS_pept        585866..588070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0491"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by similarity to GB:AAD23585.1; match to
FT                   protein family HMM PF02065"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82594"
FT                   /db_xref="GOA:A0A0H2YPW4"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPW4"
FT                   /protein_id="ABG82594.1"
FT                   /translation="MRIMSINYNENFKTFHLRTKNTSYVLKVMETGHLSHLYWGRKLKA
FT                   DNLEYFVRRRGFGSFAADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSATD
FT                   LRYKSHRIYEGKQRLSGLPAVYVESEEEATSLEITLVDSLKNLEVILTYNVFENFDSIT
FT                   RSLKIVNNSDEKINIERVLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQAIES
FT                   RRGASSHAQNPFMALCSKDANEEYGDVYGFNLVYSGNFLANVEVDMYRNARAQIGINPF
FT                   DFKWLLESKEEFQAPEVVLVYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPVLINNWE
FT                   ATYFDFNEVKIKEIAKEASKLGMELFVLDDGWFGNRNDDKSSLGDWFVNEEKLKGGLSK
FT                   LAKDINNMGLEFGLWFEPEMISPISKLYEKHPNWCIHIPGRTRSQARSQLILDLSMKEV
FT                   CDYIIESVSKILESSNISYVKWDMNRNMTEVGSLGLTSERQRETAHRYILGLYRVMEEI
FT                   TSRFPNVLFESCSGGGGRFDPGILYYMPQTWTSDDTDAIERLKIQFGTSMIYPPISMGC
FT                   HVSAIPNHQANRTTPLETRGVSAMAGNFGYELDITKLSEEEKEELKEQISLYKEIRETV
FT                   QFGALYRLKSPFNSNEVAWMMISEDKNEVVVSYVRQWALVNESFSNLKLTALDKDSEYE
FT                   IIGEDTILSGDELMYIGLNIPELYGDYVSKLWRLKRKTLK"
FT   gene            complement(588204..588953)
FT                   /locus_tag="CPF_0492"
FT   CDS_pept        complement(588204..588953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0492"
FT                   /product="sortase B"
FT                   /note="identified by match to protein family HMM PF07170;
FT                   match to protein family HMM TIGR03064"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84849"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUU7"
FT                   /protein_id="ABG84849.1"
FT                   /translation="MKNSLRIKKIISLILLIIIFFCAMKIYQKRLGYYTDSRDYDNLRS
FT                   LSPLSDSSVNKSPEEHKQDAESEKNLKNINPDYRFWIKVEGTNIDFPVVQGKDNDFYLH
FT                   HNFNKEKSFSGSIFVDSENNLNDDSNIVVYGHNMRNDTMFAQIKHFKNENFFNANKYVT
FT                   LYREGKKSTFEIFSVYQENAKDLESEIKTKFSNKEDYEKYLKEQEAKSLFKREGIDLNS
FT                   NDRILTLITCGYDFVNARIVVVAKEID"
FT   gene            589192..589716
FT                   /gene="sipW"
FT                   /locus_tag="CPF_0493"
FT   CDS_pept        589192..589716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipW"
FT                   /locus_tag="CPF_0493"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02228"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84553"
FT                   /db_xref="GOA:A0A0H2YUN6"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUN6"
FT                   /protein_id="ABG84553.1"
FT                   /translation="MKKGIKIFYNILFYSFLTILIAFLLLGFFAKKSDSGISIGGYRVY
FT                   DILTGSMSPTIKPGNLVVVKETLPNEVKKNDVITFKSDITNNVTTHRAIDIVNSDGKTE
FT                   FITKGDANNTQDPVPLDEKLLVGKVIFQVPHLGSFLISLQKNKLIFIGLLVVIILIDFI
FT                   FNKSLGARKKS"
FT   gene            589770..590405
FT                   /locus_tag="CPF_0494"
FT   CDS_pept        589770..590405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84311"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="InterPro:IPR024008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUN4"
FT                   /protein_id="ABG84311.1"
FT                   /translation="MSKKKIIGLCIAGVLAVGSIGGSLAWFTSSDSVTNPFSTASTDNP
FT                   SNPNSGIKIHEIFNKEDADNTLPGDKVTKQVNVINKATYDQLIRVKIKKVWKDAKGEEK
FT                   PDLDTKNINLNFENNLTDSNKPEEGKWIEGSDGYYYYNGIVNPDGQTANLLESVTLSKD
FT                   TTNEFKGLKFDVVVDSEGVQAANGAVNDSWKDAPQVIKDLGAGTNAHK"
FT   gene            590453..591151
FT                   /locus_tag="CPF_0495"
FT   CDS_pept        590453..591151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC14481.1; match to
FT                   protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82872"
FT                   /db_xref="GOA:A0A0H2YPL0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL0"
FT                   /protein_id="ABG82872.1"
FT                   /translation="MKNLIKSFLFTMVFLLIICKPGVASTFATPNVELEGNADGIVFIQ
FT                   GDEPFLWSDNILPGDKLERNILLNNKHKDSYKIFMRAERINKKESYDLLEKIELKVIYD
FT                   GNCIYDGFVSGQNGLENNIYLGEVKPGESKKLEAFAEFPGKEAGNEYKNKKAQVDWIFT
FT                   AVKDSYGKEDSSLYIENCKENDVINIKDKIDKKTIVPNTGDTGVGIYLVLIIISFLLLA
FT                   IVNSKRKEKN"
FT   gene            591175..591882
FT                   /locus_tag="CPF_0496"
FT   CDS_pept        591175..591882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB80221.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83127"
FT                   /db_xref="GOA:A0A0H2YQ89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ89"
FT                   /protein_id="ABG83127.1"
FT                   /translation="MKKNRFFKVLIGFIIITSIFSITVFAKYFTSSDNVVNNFGTGSIS
FT                   VKIAERFKQNETWNGNEISKNVKVKNTGDNGELVRVSITPRWIDEDGNPWPGDTNLVTL
FT                   NLKNIVDSSNKDKNEGNLWIDGKDGYYYYSSVLPNGSKDDIDAEKNNKFDAASRYEDSL
FT                   TTNNKSNYSSEILSSVSLKLNGLSEYERGRYKGKRLVVDVNVEAIAPKKSEISSKWNEI
FT                   NNDVKNYLESICN"
FT   gene            591902..593644
FT                   /locus_tag="CPF_0497"
FT   CDS_pept        591902..593644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0497"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82530"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNQ0"
FT                   /protein_id="ABG82530.1"
FT                   /translation="MKISKKIILILVAMFLSLNFPYKVTKAVNVNKSERDSNWVQTKSK
FT                   VDLLKTATDLGNEEYEISLKLKGNKRSIVNPVDIIMVADKSGSMEYEMPTLKRAMKNFL
FT                   DDIESSFGDRANISLIEFSGENKTYIGRYCDFNGFNCYEKYFIKGSIDDAKVLCDYTSE
FT                   YSTVKSKIDKITAYGRTDIEAALELVKKKLDDRNSNNKKYVVFFTDGLPIQLLNIETRE
FT                   YPSLDYIEKYIIPHTKEYFYEKGFLDKNKVNFYSIGLFTGRRFDSEKKIAKDFIKSINN
FT                   SGSYFITDDSNRLDSVYNDIAMNIINENRIMDDAVLTDIVPNNFEIVENAYGQGKTSIA
FT                   TNLNDDNDSKFKKELNIRQPKVTSENSEEKLTWNLGTVNYSGMEVKFKIRLKDKYYGGE
FT                   NIPTNTKAAISFYDPLDSKKTRKNEEFNIPKVTIPYQKGTISVSKEFDGNSDLKDKYNN
FT                   ETFTICLNGGEKGKYYLKVFPNGESSVMKFYIKDMKTDISNNKDLSINYLVAGEYKIEE
FT                   LDSLNSDLSTIEVNGIKLEKNNYKFTLDKDNNDINIVIKNKMKNNNGFYDEDKIENSFG
FT                   VFEG"
FT   gene            593925..594641
FT                   /locus_tag="CPF_0498"
FT   CDS_pept        593925..594641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0498"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82542"
FT                   /db_xref="GOA:A0A0H2YNZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNZ5"
FT                   /protein_id="ABG82542.1"
FT                   /translation="MLNIAICDDEKVQRNILKDMLYKICNKNNMDVIIDEFCSGVDLLN
FT                   VYKRNTKKYSIVFCDILMDEMNGIELLRKIGELDAFIQAILITGSEEYVFQGYDVGALN
FT                   YLMKPVSFEKLEKEFLRAIKSLNFTSPSRYAININGKTNFIDLSEVLFFEVNNKTITAN
FT                   LEKESIDFNMKIATLEEELKGRNFLRCHRSYLVNISHIDSILQNKIILKNSVEIPVGRV
FT                   YKKELKTFLMNRIGDM"
FT   gene            594646..595941
FT                   /locus_tag="CPF_0499"
FT   CDS_pept        594646..595941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0499"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84387"
FT                   /db_xref="GOA:A0A0H2YTI6"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTI6"
FT                   /protein_id="ABG84387.1"
FT                   /translation="MYVRNVIELFYIIYISFIGISSFFYLDKKIDLKKRVFTTIILNFF
FT                   LLLINYIFYINELSCFFEALIIYIYYVYLYKKNTTSILMSSIYLLNLSLGKYILMFIYS
FT                   VMIFDLEVLKIMNNIMFLCFIILLILMITVVVFIVNFFKECIINVNDLTIKKQTKLVFA
FT                   IGIAVLLSEKVFDNIALNAGLVYRVNISTISIAVNLAIIHFITYKRFKEYKANSQINIL
FT                   EKQLDYQKNYYEKVINNYGEARKALHDMNNHMSVIKYFLENKDYKNMDDYIQSLSERIV
FT                   TNKDNNICSNKVINAICLDKCERCKKEGINIRFDTIINKKLKIDDLDLCIVLGNLIDNA
FT                   IEACEKINDKEIQKVIQVSARIYLNQIYIKVINSKNNKVEKRNNKFLTSKKDKKNHGIG
FT                   LENVKEAVHKNHGDIEIKDSKNTFEVSLYMKC"
FT   gene            596119..596925
FT                   /locus_tag="CPF_0500"
FT   CDS_pept        596119..596925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83520"
FT                   /db_xref="GOA:A0A0H2YRH2"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRH2"
FT                   /protein_id="ABG83520.1"
FT                   /translation="MKNGRRVKNPKRNSSSRSKSKVLDISIIILIIALALVIAVGTIRD
FT                   KKTLAKNMEIYSSDSSNNSEDNKKQATTSNPYEKIKKGEEVNILVLGNGVGISEGKTDE
FT                   SGNWTSSLSKWLEETYKSKANITNLSQDKATVKVGLEELEKNKDNFDLAYIIFGENDQK
FT                   EIKPNEFKEDYEKIIKNLKERNKNISIVPIIENSLRKKNEYTNLIEDIGKDNDIKVLDM
FT                   ATVFTKDPAPYAKLTTKGGIYPNNVGYSLYFSNIKSLIEANIAALN"
FT   gene            597293..597736
FT                   /locus_tag="CPF_0501"
FT   CDS_pept        597293..597736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0501"
FT                   /product="PTS system, L-Ascorbate family, IIA component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83840"
FT                   /db_xref="GOA:A0A0H2YS33"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS33"
FT                   /protein_id="ABG83840.1"
FT                   /translation="MNFIRDLLNENNIILKAKAFNKEEAVRLAAEPLLKDGSITEEYVK
FT                   DILEKINDLGPYMAIMPGVVIAHSRPGDYVLKDCISMLTLENPVEFGHEDNDPIEIIFV
FT                   IGAKENTGHLDALQDLARVLINEDSVNKIKNAQNKEEIMELFM"
FT   gene            597914..598186
FT                   /locus_tag="CPF_0502"
FT   CDS_pept        597914..598186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0502"
FT                   /product="PTS system, lactose/cellobiose-specific IIB
FT                   component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83102"
FT                   /db_xref="GOA:A0A0H2YQ69"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ69"
FT                   /protein_id="ABG83102.1"
FT                   /translation="MKIMTVCGFGVGTSLLLKMTVDSILEEEGINGEVEAIDMTSACGN
FT                   SADLILTSKEIGKEIEGQVSGKLVYISNFMDKEEVKEKILKAIRN"
FT   gene            598227..599498
FT                   /locus_tag="CPF_0503"
FT   CDS_pept        598227..599498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0503"
FT                   /product="PTS system, L-Ascorbate family, IIC component"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83756"
FT                   /db_xref="GOA:A0A0H2YRV7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRV7"
FT                   /protein_id="ABG83756.1"
FT                   /translation="MKEILDFCVSFFRNPALFMGLVVAIGLILQRKPIDAILKGIFKGI
FT                   IGMVILLKGVDIVVSSITPLANAFSGLFNTQSNSTLGDFNVFLGQYGSYVGLILLCGFV
FT                   INIIIARYTRFKTIYLTGNILFWYPMLFLAVGIENNVSGLKLFIFTLIMYILVITIFPY
FT                   ILRKHVKYVTGNDSFTIGHTASIYCLLGSYIGKLVGQKDKNIENLNLPKSLSFFRDTNI
FT                   TAAIVMFIVYIIVGLFIGKESRIAIYGSEPLITYSLIQGITFAAGMIILLTGVRMILGE
FT                   IIPSFKGIADKLAKGSIPALDIPMIFPYGPNALLIGFIIALITSIGTLFLLGASGVLTF
FT                   ALIPLVVACYFDVAPGAIFANARGGWPAAIITSALGGIILMVLAAISLNLVSGTVGNFI
FT                   QTYGGNEFSIWVIISDLVGKIFSI"
FT   gene            599856..600650
FT                   /locus_tag="CPF_0504"
FT   CDS_pept        599856..600650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0504"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF02358; match to protein
FT                   family HMM PF05116; match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84408"
FT                   /db_xref="GOA:A0A0H2YTP6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTP6"
FT                   /protein_id="ABG84408.1"
FT                   /translation="MENLKGIVFFDVDGTLIDCGKGLYKPSNKTKEAIKKLKENGYLTI
FT                   LATGRPMSFVDDGLKELELDGYIASNGTYIELNNEVILNDDIKLEKLKEIMDYCVEHNI
FT                   NFILEGQKTSYVLNNDVAKKMVENFSLPEESFTGDWTEEELSANKLVIVDNNKDDFKDI
FT                   FERFKDEFVFMQHPGHSSYDMYRRGCTKAHGIEHLIKELGLSDKDTYAFGDGENDIEMF
FT                   QRVKYGIAMGDAHETLIPHAYKQTENVPNEGIYKALLELGLI"
FT   gene            complement(600784..601230)
FT                   /locus_tag="CPF_0505"
FT   CDS_pept        complement(600784..601230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0505"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82886"
FT                   /db_xref="GOA:A0A0H2YR49"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR49"
FT                   /protein_id="ABG82886.1"
FT                   /translation="MNTLENLMGATEELYTLLLCLNRKVFSHDDIIKRLSIPPSHAKVI
FT                   FHLHCGGEASVSEIAKNLSISKSNMTPIIDKLIQENLVERFTDPNDRRIIRVRVTEKGH
FT                   EFCLKQREKTKKHLEEKISSLSPEELERIKDLAKELNSIFSKIE"
FT   gene            601555..603852
FT                   /locus_tag="CPF_0506"
FT   CDS_pept        601555..603852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0506"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83378"
FT                   /db_xref="GOA:A0A0H2YR33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR33"
FT                   /protein_id="ABG83378.1"
FT                   /translation="MSKLIKYLKPFTASILAVIVLLFAQAMFDLSLPDYMSNIVNVGIQ
FT                   QGGIENAVPKVISKSEFDKLTLFMSKDEKEKVESNYTLLDKGNLSQSEYDEYVKDYPAL
FT                   EKENICKLNTKDKEIINELNPIMGKAMIVVGGIEEKGLQGVMGNSSLTGASDNSKANME
FT                   ESAPKEGQIQGMPANTDPFFMIKNMPEAQKNDMLKQINEKFESMPESMVTQTAATFIKA
FT                   QYTDLGMNIEKIQSQYILKTGGIMILLAFGSMIAAVSVTLIAARVAAGFGRNLRSKVFG
FT                   KVVRFSNAEFDKFSTASLITRSTNDIQQIQTLMVLLLRIVFYAPILGLGGIFRVVKTDT
FT                   GMSWIIAVALAAILSLVIVLFGLAIPKFKLVQKLVDKLNLVARESLTGMLVIRAFNTEK
FT                   YQENKFDGVNKDLTRTNLFVSRIMGGMMPLMMLIMNLITILIVWVGAHNVNDGVMQVGD
FT                   MMAFIQYTMQIIMAFLMISMVSVMLPRASVSGQRIAEVLETKESIKDPEKNDEFNKNKK
FT                   GYIEFKNVSFKYPGAEEYVLKDISFTAKPGETTAFIGGTGSGKSTLVNLVPRFYDVTEG
FT                   EILVDGTDIRKVSQHDLREKIGYVPQKGILFSGTIESNLKYGNEDALLEELEEAANIAQ
FT                   ASEFINTKALKYAEEISQGGTNVSGGQKQRLSIARALVKNPDVYIFDDSFSALDFKTDA
FT                   AVRKALNEKTSHSTMLIVAQRISTIMGANQIIVLDEGKIVGKGTHKELLENCEVYKQIA
FT                   LSQLSKEELSNE"
FT   gene            603845..605701
FT                   /locus_tag="CPF_0507"
FT   CDS_pept        603845..605701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0507"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84036"
FT                   /db_xref="GOA:A0A0H2YTE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTE5"
FT                   /protein_id="ABG84036.1"
FT                   /translation="MSKERKGGMGGQMGRMGGGPRAVEKAKDFKGTMKKLGVYLKPYSL
FT                   SIAIVILFAIGSAAFSIVGPKILGKATTKIFEGLVQKITGVPNASIDFGYIGNIAMILV
FT                   ALYLVSSLFGIIQSFIMSGVAQKVSYNLRKQISEKMDTLPLNYFDTRTNGEVLSRITND
FT                   VDTVNQTLNQSLSQIITSVVTLIGVLIMMFSISWIMTLATFIILPVSMVLISLVVKKSQ
FT                   KYFKSQQEYLGHLNGQVEEVYGGHNIMKAFNREEASTKDFDELNNTLYKSAWKSQFLSG
FT                   MMMPIMSFVGNLGYVLVSILGGWLTIKSVITVGDIQAFIQYVRSFNQPISQMAQVANIM
FT                   QSTAAAAERVFEFLDEEDEVKDPVNSVDPSEIRGEVEFEDVHFGYNEDKIIINDFSVDV
FT                   KPGQKVAIVGPTGAGKTTIVKLLMRFYDINSGSIKIDGHDIRDFKRADLRNLFGMVLQD
FT                   TWLFNGTIMENLRYGRLDATDAEVKEAAKAAHVDHFVKTLPDGYNMVLNEEASNISQGQ
FT                   KQLLTIARAFLKDPKLLILDEATSSVDTRTELLIQKAMEKLMEGRTSFIIAHRLSTIRD
FT                   ADLILVMKDGDIVEQGNHEELLEKGGFYSSLYNSQFEQSSAS"
FT   gene            606198..607079
FT                   /locus_tag="CPF_0508"
FT   CDS_pept        606198..607079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUR6"
FT                   /protein_id="ABG84848.1"
FT                   /translation="MKFRFLYVGDKILSHREEGLFRVLNCEEYSLNKKVLDYKEICNRK
FT                   KYKNGFSEEKFNRIYLSKRGSVINFYSLGSKEFNETYLNDTNRFKDLLDLNKNSENEEI
FT                   KIIFFDLFNKDANKDQLFITSFMNKLGEILKYINWDKILIIFNEEIIFNKVTNIDSRFR
FT                   ECSLVLNNYDVNLNEFIHILIDFLLLKDDLGDKWTEYRKKIANSKLTLGKVKGEDFSGD
FT                   VIMRILGEFSKIQRDNLFKLILMSKEGINLNEIALIEDALKEYISLDSKLIIKQLTKDF
FT                   FNDEVRYILLSK"
FT   gene            607334..608383
FT                   /locus_tag="CPF_0509"
FT   CDS_pept        607334..608383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0509"
FT                   /product="transporter, auxin efflux carrier family"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82777"
FT                   /db_xref="GOA:A0A0H2YQC8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQC8"
FT                   /protein_id="ABG82777.1"
FT                   /translation="MLEIIQKTLTDNAIIGAIFSSIAIIFLGFYIRKRNILTGAASKIL
FT                   TKVVLTVAIPALAFTSFMKDINQKELHEGINILIWGFVIYILLIVLTKFIFARVKGDKQ
FT                   DVFRVLTIFGSTTFFGVPIVKAVYGSVGAMYSSIFNIAYRVFLYSYGYIKMSGVKMDKE
FT                   NLKKNLKEMLLNPVIIATFLGLFIWLFQGMLPQVQIGDKSYAFLRIDQTLPWLYKPLTY
FT                   LDKLCSPLAWLAIGITLAEVPFKQAVGQKEPWVYSLIKIILVPVINLGLLVVLNKTGIL
FT                   PVSFEGMATTVIMLATPTATVAAAYAISFDKEALLTSNCSLLSTVVAVVAMPFWIVILQ
FT                   IIKNIGLFA"
FT   gene            608710..609708
FT                   /locus_tag="CPF_0510"
FT   CDS_pept        608710..609708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0510"
FT                   /product="putative D-lactate dehydrogenase"
FT                   /note="identified by similarity to SP:P52643; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84726"
FT                   /db_xref="GOA:A0A0H2YUI8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI8"
FT                   /protein_id="ABG84726.1"
FT                   /translation="MIKLVCYGVRETEVPYFHKLNEEFGYDLTLVEKNLNHENVEEAIG
FT                   AEAIMVRGNCMADRQNLELLKSKGLKYVLTRTVGFDHVDLDAAKDLGLQVARVPGYSPN
FT                   AIGELAVSLAMMLLRHTAYTTNRTSNKNFVVDGFMFSKEIRNCTVGILGAGRIGLTTAK
FT                   LFKGLGAKVVAYDVFQSDAAKEIVEFMPLDEVLKVSDVISVHMPYIKGQNYHMINEEFI
FT                   SKMKNDAIIINTARGELQDIEAIVKALEEGRLGGFGADVLEGESAVFFKNLEGQKLENE
FT                   SYEKLISLYPRALVTPHMGSYTDEALRNMIGISYENLKEYLEGNTCKNAIA"
FT   gene            610004..611554
FT                   /locus_tag="CPF_0511"
FT   CDS_pept        610004..611554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0511"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84925"
FT                   /db_xref="GOA:A0A0H2YV09"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="PDB:4ONX"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV09"
FT                   /protein_id="ABG84925.1"
FT                   /translation="MKVKFENKILLWAILITFIPLALSFTLFIEDKLSYMDEDVRNTLK
FT                   ETAFSISEIPFIQEDLSNGEINSRIQEYTKHFIEAINDVDIIVVADMRGVKYSHLDEKQ
FT                   IGQVFVNEDKKEVLTQGSSYYSLMKGSMGETLRWFQPVMYNGKQVGFIMVGKYYNEIQL
FT                   LTHKTLIKYMGLFILVFLITILISKLFARKVKKAILGMEPEEIAALYKEKKIILNTVSE
FT                   GIIALNKNNEITEINDNCYKLIDGFSKYKVLKKLLPYIEENKPVEMKEIILQGKKVFVT
FT                   IQPIMKKGEYLGSVITLMDRNDIRKIAKEITGVDEVVKNLRANVHEFRNNLHVILGLIQ
FT                   LGEYEEARKYILKTQKVHENNSLKFSNVEDYYVRGLLLSRELVAKERGVNFILTEESFL
FT                   FGNHNYVDSYDIVTILGNLIENAFDSCVCSSSYNKEVEVTLYEDDEKIELQVRDNGKPI
FT                   DNNIKERIFELGVSSKGEGRGTGLSLVKNRVELYDGCIDIEEFNEEKIFIITILKGEK"
FT   gene            611554..612222
FT                   /locus_tag="CPF_0512"
FT   CDS_pept        611554..612222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0512"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82353"
FT                   /db_xref="GOA:A0A0H2YNB9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNB9"
FT                   /protein_id="ABG82353.1"
FT                   /translation="MGKKILIVEDDPMVALINKRFLENMGFKDILGPVQTEEEIIKVLD
FT                   KENIDLILLDVYLPKKNGIDILKSLRYKKYLTDVIMITAANSVEEVKRAFAYGVTDYLV
FT                   KPFEFERFEEAINKYKQKNNLLNKREALSQQDIDVISKSLEEKIELPKGLNQKTLDRIM
FT                   EFLKENQGKVWTLREIAYELKISNVTIKKYMDYLEDVKKVNVTLTSGNVGRPEYKYTLG
FT                   "
FT   gene            612303..612482
FT                   /locus_tag="CPF_0513"
FT   CDS_pept        612303..612482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83285"
FT                   /db_xref="GOA:A0A0H2YQU2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQU2"
FT                   /protein_id="ABG83285.1"
FT                   /translation="MEYNKHRYLGFLGLLSLIGLKGFTGGNALWYIFFLNFLWFTLFYE
FT                   NSWLYVGAPFKFNK"
FT   gene            612640..613170
FT                   /locus_tag="CPF_0514"
FT   CDS_pept        612640..613170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0514"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84348"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTJ6"
FT                   /protein_id="ABG84348.1"
FT                   /translation="MNKRKIVASILTTSLLVTSLVGCVGSNNKANTSSNDSKVQESVEN
FT                   QSDFNDLRTYVGKTYNEVSENKGTGNENIEEVAGKKVIVSSSYSTRMFNYNANLILELD
FT                   DSKNISAVSVHFKGIEPENILENIKKVLGEPKISKDKENGDSKVYSWEKDGYQYKLSQV
FT                   GEETIITVNKSAI"
FT   gene            613635..613775
FT                   /locus_tag="CPF_0515"
FT   CDS_pept        613635..613775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU23"
FT                   /protein_id="ABG84585.1"
FT                   /translation="MSKHHRISHCDAEHTMKIEKEKMAEVRKEEEKMANKVKCHKKSCG
FT                   K"
FT   gene            614301..614942
FT                   /locus_tag="CPF_0516"
FT   CDS_pept        614301..614942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0516"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02659"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84757"
FT                   /db_xref="GOA:Q0TTS0"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTS0"
FT                   /protein_id="ABG84757.1"
FT                   /translation="MSILSIVLTGFGLAMDAFAVSVAKGITLTRVKAKDALKVALFFGG
FT                   FQALMPLIGWGAGRYFADYIKAFDHWIAFILLGFIGGKMIFEALKEDDEEKAEVAVSME
FT                   VSKNKEREFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLGISIVQTIIIIGIIT
FT                   FVLCFLGVIIGEKLGDIFKNYAEIVGGVILILIGINILLEHTGIIEKLFS"
FT   gene            615154..615567
FT                   /locus_tag="CPF_0517"
FT   CDS_pept        615154..615567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82997"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQY8"
FT                   /protein_id="ABG82997.1"
FT                   /translation="MYVAFGNRVLDSEEIKKEIELNTDAKVVSDLCKSSKREDIIAFKL
FT                   SIDMDILRGLMKENSDLKDLNDEELFEDYLDLAEEVAGMIFEYMPEDAILDIRSYKWDM
FT                   SYNDVKLIMVMAHEDLGIAKVNDVMKRLLRQVD"
FT   gene            615878..616993
FT                   /locus_tag="CPF_0518"
FT   CDS_pept        615878..616993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0518"
FT                   /product="NAD-dependent 4-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.61"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83967"
FT                   /db_xref="GOA:A0A0H2YSI0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSI0"
FT                   /protein_id="ABG83967.1"
FT                   /translation="MKLLSLNTEILGFDTSSEFAKELNLNEKDLVFTNRRIYEGSFKSL
FT                   DLKCNYVLKDKYNFNEPNDEIIDEIFKDIKNIDFNRVIAIGGGSILDVGKLLALKDVDS
FT                   TKKLFKRELPIIRDKELIIVPTTCGTGSEVTNISIVEIKSENTKLGLAVDELYADKGVL
FT                   IPELCKTMPYKAFVYSSIDALIHSIEGFLSPNSTPYTDLFAFKAIEMILSGYKEIIEKG
FT                   EEYRNTIMDKFLIASNYAGIAFGNAGVGAVHALSYPLGGKYHVPHGEANYQFLMAVLNF
FT                   YKKNNGDGKISELTKLISSIINAKEEDCYLELENLLNNLIRRKNLKEYGMTIDEIEKFS
FT                   HSVMKNQQRLLKNNYVSMEIKDMEEIYKSLY"
FT   gene            617002..617190
FT                   /locus_tag="CPF_0519"
FT   CDS_pept        617002..617190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU72"
FT                   /protein_id="ABG84117.1"
FT                   /translation="MKFFRMILIAGEVLLVILLLLGIVFKVAECEKKDKSLSNIKEQHI
FT                   KLDDEQQEKLLYCSIIR"
FT   gene            617226..617906
FT                   /locus_tag="CPF_0520"
FT   CDS_pept        617226..617906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0520"
FT                   /product="TrkA domain protein"
FT                   /note="identified by match to protein family HMM PF02080"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83815"
FT                   /db_xref="GOA:A0A0H2YTG4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTG4"
FT                   /protein_id="ABG83815.1"
FT                   /translation="MVLVLTFILFLMIFLIIVDFFAILFRLTGVPIEKARFQVTSLLTG
FT                   TGFTTKESEIIVQHPTRRKLAIWLMGFSYASTATIISFAVNIITSSVIDVGSIAVIVLF
FT                   IIFVLFFHKSSLLEKFENKIEKFIVQSKIWDKINSKHLTLITNTKGFGVYEIYLSNKAT
FT                   LIGKSIRDSDLKANEIEVLNIDKGDKFVNFPTPDYTFEVCDKVTVYGNVKNIKAMFKHI
FT                   NEVK"
FT   gene            complement(618021..618473)
FT                   /locus_tag="CPF_0521"
FT   CDS_pept        complement(618021..618473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0521"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01978"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82880"
FT                   /db_xref="GOA:A0A0H2YR45"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR45"
FT                   /protein_id="ABG82880.1"
FT                   /translation="MDLKALNPNGNAFLVSFTKAKKTYKKFISPTLNDLGLTHNEFEIL
FT                   VFLQENLEYNTAKDIVEFSGLSKGLISRSIESLLKKEMLSIKKDDKDKRIFRLYISPSA
FT                   NETLNVLNKVSNRFFKLLLEDLKDEELMFFDEVLNKMIKNLNNLKI"
FT   gene            618727..619860
FT                   /locus_tag="CPF_0522"
FT   CDS_pept        618727..619860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0522"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82214"
FT                   /db_xref="GOA:A0A0H2YMX8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YMX8"
FT                   /protein_id="ABG82214.1"
FT                   /translation="MEFKNNKIKDYIFLSTYIILLIFFFINIKDIMNFLYKFLGILKPF
FT                   IWGIAIAFILNIPVKLIEKNLGNGKFFKGMKRSFSITLTFLFFILAITLFILFVIPQLL
FT                   SSISTLMNSIPEYLSQFEKFLEVNAINNSQSQVMMQNIINELLNMWKEILKVTSQIVGT
FT                   SLGYLLDFTLGITYGVINFFLSLILAIYMLASKEILISQLKLIIYAFVSKNKADRIIEL
FT                   GNMCNEMFSKFILGQCTEALVIGVLCFIGMIILKMPYALLISVVIGVTALIPVFGAFLG
FT                   TIPSAFIILIIDPIKALWFIIFIIVLQQLEGNLIYPRVVGSSIGLSALWVMFAMIVGGS
FT                   LFGIIGMLIGIPIFGVVFKILKRVANRKINEKGIERR"
FT   gene            620264..621655
FT                   /locus_tag="CPF_0523"
FT   CDS_pept        620264..621655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0523"
FT                   /product="amino acid/peptide transporter"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84945"
FT                   /db_xref="GOA:A0A0H2YUY0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUY0"
FT                   /protein_id="ABG84945.1"
FT                   /translation="MAEAIKSTDFEVEKGNGRLKHPAGLYLLFFTEMWERFSYYGMRAL
FT                   LMLYLTASFVTGGLGYDVPSAARIYGAYTFLVYFTPIIGGEIADKFLGQKKSIMLGAAV
FT                   MILGNLTLFGWQTRWALYLGLGFIIVGNAFFKPNISTIVGQLYEDGDKRKDSAFTIFYM
FT                   GINLGSLIAPIICGLLAENFFATKSGEVILHYGFRYGFLAAGIGIILGEIIFITLSPKY
FT                   LAHVGEIKREKNKKDVAKEKKPLTKQEKKRVAVILILASFVVFFWAGFEQAGTTLTLFA
FT                   ENATNRSLFGWTVPVAFFQSINPLFILILAPLFSKLWFTLANSKRGDLSIPTKMAMGMI
FT                   VLGCGFLLMVFATMSLGGNVENPAVKASMFWLVGTYLFNTMGELCLSPIGLSMVSSLAP
FT                   AKYASLLMGVWLASNGVANYLSGFIASFVEKLGALELFGSIAGVSIVLGLVLLLLSKKI
FT                   TAMME"
FT   gene            complement(621817..622032)
FT                   /locus_tag="CPF_0524"
FT   CDS_pept        complement(621817..622032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPH9"
FT                   /protein_id="ABG82391.1"
FT                   /translation="MSDNKLKEDLVKVYKEWKDLEKKAGKKIKHHHELKKEEKEDEIQR
FT                   FSDYAGLSVPITEEMLLYLDEEYFRV"
FT   gene            complement(622046..622285)
FT                   /locus_tag="CPF_0525"
FT   CDS_pept        complement(622046..622285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0525"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAY61763.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRT7"
FT                   /protein_id="ABG83144.1"
FT                   /translation="MNFMGEEKIKKELLDLYSKWRVSEKSFFEKLKLNHDFKKLEKEQI
FT                   KLITKKFSEFAKIDTPLTEKEILELEEYYNNTFI"
FT   gene            622525..624075
FT                   /locus_tag="CPF_0526"
FT   CDS_pept        622525..624075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0526"
FT                   /product="nitrite/sulfite reductase homolog"
FT                   /note="identified by similarity to GB:BAA06530.1; match to
FT                   protein family HMM PF01077; match to protein family HMM
FT                   PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83661"
FT                   /db_xref="GOA:A0A0H2YRT3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRT3"
FT                   /protein_id="ABG83661.1"
FT                   /translation="MNTLNDILSKEIEEFREKGHKFLNKEMTVGEFKKASGGMGVYAHR
FT                   GGKEFMVRLRVPSGVAGLSLLEEAYNWAKKYNLEKIHLTTREAIQLHGISIDAVCDIMQ
FT                   EGLTKGIYTRGGGGNFPRNVALNPLSGVQIGETFDVTPYALASNAHYMSKIYTYNLPRK
FT                   IKTAFSNTEEDSAHCTVTDLGFLAVDNNGKRAFKLYIGGGLGRNPRTSVEFDELIDEKD
FT                   VLYCLEAMTNLFVAEGDYKNHGKARIRYIVERMGEEEFKNCFRKHLEEVKAKGGLDLKV
FT                   EDIKYSKKGEKTNIKHERLIPQKQEGLYTVLFHPVGGQLSLDVLKELIEKIEKIEEVEV
FT                   RLGMDENLYVRNLNGKEAEAILDFTQGKGGETLAERSVSCIGTPICQMGVLESQKTLRE
FT                   FVELLKENSIKEGTLPRVRFSGCPNSCGMHEIGDIGFAGKKKKVCDALSNVFELHFGGK
FT                   LGIGETRLGDYYGDILQDKVPEFLIKVAKAVEAKNSTFEEWIKDNSEEFKAIVEEYNV"
FT   gene            624388..625203
FT                   /gene="speD"
FT                   /locus_tag="CPF_0527"
FT   CDS_pept        624388..625203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="CPF_0527"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by similarity to SP:P09159; match to
FT                   protein family HMM PF02675; match to protein family HMM
FT                   TIGR03331"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84466"
FT                   /db_xref="GOA:Q0TTQ9"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTQ9"
FT                   /protein_id="ABG84466.1"
FT                   /translation="MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYIDE
FT                   QYNSERLTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPVALIDPSCNKGE
FT                   LSYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPLNALDYLIG
FT                   SFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDGETLKKYDAMDVNVYQSNIF
FT                   HTKMMLKDIVLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY"
FT   gene            625221..626675
FT                   /locus_tag="CPF_0528"
FT   CDS_pept        625221..626675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0528"
FT                   /product="Orn/Lys/Arg decarboxylase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM PF01276; match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82459"
FT                   /db_xref="GOA:A0A0H2YNS4"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNS4"
FT                   /protein_id="ABG82459.1"
FT                   /translation="MKRLSQENAPIYEALKWYKNQRIVPFDVPGHKQGRGNTELREFLG
FT                   EDCVSVDVNSMKPLDNLCHPTSVIKDAEELAAEAFGADKAFFMVNGTTSAVQAMIMSVC
FT                   KDGDKIIMPRNVHRSAINSLIITGVTPVYINPGIHGRLGISLGMAMEDIKKAIKENPDA
FT                   KAIFVNNPTYYGICSNLREIVKLAHENNMYVLVDEAHGTHFYFDKRLPVSAMEAGADMA
FT                   AVSIHKTGGSLTQSSMLLMKCNRIKPDYVRTIINLTQTTSGSYLLLSSLDIARRNLALN
FT                   GEKIFEEVVGIAEYAREEINKIGGYYAFSKEINNGDDIYDFDVTKLTINTLETGLAGIE
FT                   VYDILRDDYGIQIELGDVANILAIISVGDTRYNIERLVSALSEIKRIHEKDKKDIFDHE
FT                   YIDPIVKVKPKEAFYADKKKVLLRESEGLISGEFVMCYPPGIPILAPGELITKETIDYI
FT                   EYSKKKGSLVTGPEDMEIEYINVLDC"
FT   gene            626690..627541
FT                   /gene="speE"
FT                   /locus_tag="CPF_0529"
FT   CDS_pept        626690..627541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="CPF_0529"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83476"
FT                   /db_xref="GOA:Q0TTQ7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTQ7"
FT                   /protein_id="ABG83476.1"
FT                   /translation="MELWYTEEHTDKVRFSIKVDEQLYSGKSDFQRIDVFKSQEFGTFF
FT                   TLDGLMMVTEKDEFIYHDMIVHVPMATNPNIKNVLVIGAGDGGTVRELTRYETIEKIDM
FT                   VEIDKLVVDVCREYLPQTANKLDDPRVSLFFEDGLKFVRSVENKYDLIIVDSTDPFGPG
FT                   EGLFTREFYGNCFKALKEDGILVNQHESPYYEEYARGMKRAHKRIKECFPVCRVYQAHI
FT                   PTYPSGHWLFGFASKKYDPLNADIEKWNDLGLKTKYYNTELHKGCFALPNYVKEMLENV
FT                   DE"
FT   gene            627528..628385
FT                   /gene="speB"
FT                   /locus_tag="CPF_0530"
FT   CDS_pept        627528..628385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="CPF_0530"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82607"
FT                   /db_xref="GOA:A0A0H2YP98"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP98"
FT                   /protein_id="ABG82607.1"
FT                   /translation="MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQV
FT                   MRGESWGLESYSPYQDLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKIPA
FT                   MIGGEHLVTLGAFKGVFKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLVGDN
FT                   KIFQFGIRSGEKEEFLWAKDHVYTNKFNCDTLDYALEMVKDKPVYVTIDLDVLDPSVFP
FT                   GTGTPEPGGIQFNELLNSILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLREMLLV
FT                   ANNK"
FT   gene            complement(628699..628962)
FT                   /locus_tag="CPF_0531"
FT   CDS_pept        complement(628699..628962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB80258.1; match to
FT                   protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84793"
FT                   /db_xref="GOA:A0A0H2YV97"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV97"
FT                   /protein_id="ABG84793.1"
FT                   /translation="MKELFVGYLIVINLVAIILMYIDKQKAKKHQWRISEDTLIGVSII
FT                   GGGIGALWGMHVFRHKTKHAKFTIGIPLIIAIQALLILYFIR"
FT   gene            629171..632692
FT                   /gene="nanJ"
FT                   /locus_tag="CPF_0532"
FT   CDS_pept        629171..632692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanJ"
FT                   /locus_tag="CPF_0532"
FT                   /product="sialidase"
FT                   /note="identified by similarity to SP:P29767; similarity to
FT                   PDB:2V73_B; match to protein family HMM PF00041; match to
FT                   protein family HMM PF00754; match to protein family HMM
FT                   PF02012; match to protein family HMM PF02973"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84247"
FT                   /db_xref="GOA:A0A0H2YT71"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004124"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="PDB:2V73"
FT                   /db_xref="PDB:2VO8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT71"
FT                   /protein_id="ABG84247.1"
FT                   /translation="MKSKKIIATLVASLVISNMGGYLVKANPNVNHKAVIIEDRQAIIE
FT                   TAIPQSEMTASATSEEGQDPASSAIDGNTNTMWHTKWNGSDALPQSLSVNLGSSRKVSS
FT                   IAITPRTSGNNGFITKYEIHAINNGVEALVAEGTWEENNLVKTVTFDSPIDAEEIKITA
FT                   IQGVGGFASIAELNVYEIKGEVDEIANYGNLKITKEEERVNITGDLEKFSSLEEGTIVT
FT                   RFNMNDTSIQSLIGLSDGNKANNYFSLYVSGGKVGYELRRQEGNGDFNVHHSADVTFNR
FT                   GINTLALKIEKGIGAKIFLNGSLVKTVSDPNIKFLNAINLNSGFIGKTDRANGYNEYLF
FT                   RGNIDFMNIYDKPVSDNYLLRKTGETKAPLEDSLLPDDVYKTQPVELFYPGYLESRGYR
FT                   IPALETTKKGTVLASIDVRNNGDHDAPNNNIDVGIRRKEVNGEWEEGKVILDYPGKSAA
FT                   IDTSLMSATIEENGIEKERIFLIVTHFPEGYGFPNTEGGSGYREIDGKYYFILKDAQNN
FT                   EYTVREDGIVYNSEGNQTDYVMKNDKTLIQNGEEVGNALLSNSPLKAVGTAHIEMIYSD
FT                   DDGKTWSEPEDLNPGLKKEWMKFFGTAPGKGIQIKNGEHKDRLIFPIYYTNQNNFQSSA
FT                   VIYSDDFGETWKLGESPIDTASVSSETVSSGTQLTECQVVEMPNGQLKLFMRNTGSYTR
FT                   IATSFDGGATWHDEVPEDTSLREPYCQLSVINYSGKINGKDAIIFSNPDASSRVNGSVK
FT                   VGLINENGTYDNGEPRYEFDWIYNKTVKPGSFAYSCLTELPDGNLGLFYEGEGAGRMAY
FT                   TEFDLNYLKFNASEDSPSASVQSIEVLDEDLAYNSGEEVSIKVNFNQLVSIIGDRKITL
FT                   DIGGVDVPLNMVNYEGKSSAIFKGTIPEGINQGNYEIKLKENNTLELNTVYNKVSTFNG
FT                   LDNTGINVQIGELKTTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYN
FT                   AEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELE
FT                   VLGLTTALVGAGDGNTHDLELSSKEVKINEEASGEIVVNPVQNFEIPEINKKNVKLTWN
FT                   APITTEGLEGYVIYKDGKKLSEVPAESTEFVVSKLNRHTIYNFKVAAKYSNGELSAKES
FT                   KTIRTAR"
FT   gene            632838..633479
FT                   /locus_tag="CPF_0533"
FT   CDS_pept        632838..633479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0533"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM32797.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83907"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTN7"
FT                   /protein_id="ABG83907.1"
FT                   /translation="MKKKLLGMLLAGTLMVGAVGSYAWFSDKAEVDSGIKLTMGTLDVD
FT                   VKEISDGWNIVDETSEIINKKSTKHFKNVRPGDSFQREFVIANSGTLKQKVSVKLNPEV
FT                   ARKVVTTIGDQAVLFDDLFNLKFELGELELPMKINENETFEFELDSLYTEAEDSDKVTS
FT                   AADLKVTLEVDKDAMDNRFNHDGNKFVEIFDFLKDKSVPLVLVEAEQVNK"
FT   gene            complement(633592..636261)
FT                   /locus_tag="CPF_0534"
FT   CDS_pept        complement(633592..636261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0534"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR00003;
FT                   match to protein family HMM TIGR01494; match to protein
FT                   family HMM TIGR01511; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83462"
FT                   /db_xref="GOA:A0A0H2YR41"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR41"
FT                   /protein_id="ABG83462.1"
FT                   /translation="MSAIIFMINKSIKIKGMSCAACAARIEKVLGKMDGISKANVNLAT
FT                   EKLNLEFDENKISFKEIEEKINKLGFSVVRNLKKESFKVSGMSCASCASRIEKVLNKLS
FT                   GIYNATVNFANESLQVEYDEDEISLKEIKEKVKKLGFELKGNNKSTSFKVEGMTCSACA
FT                   ARIEKVTSKMDGVESSNVNFANSTLNISFDKDKVSANDIKAKVEKLGYKLLDASQEDEH
FT                   EKAKENETKRMKNRLIGSAIFTIPLFIISMGHMVGLHLPNIIDPMHNPLNFALIQLLLT
FT                   TVVIFICRDFFIHGFKNLFMRSPNMDSLIAIGAGAAYVYGLFAIYHIYMDDSNYAMQLY
FT                   FESAGTILTLISLGKYLETLTKGKTSDAIKKLMGLAPKTATLLVDGKEKIVSIDEVKVF
FT                   DLVLVKPGEKLPVDGKVVEGYTSIDESMLTGESIPAEKKVGDTVFGASINKNGRIIYEA
FT                   TKVGKDTVISQIVKLVEDAQGSKAPIAKLADTISGYFVPIVISLAVIASLAWYFSGESK
FT                   TFALTIFISVLVIACPCALGLATPTAIMVGTGKGAENGILIKSGEALESTQNLNTVVFD
FT                   KTGTITEGKPRVTDIICENISKDELLLLAASAEKGSEHPLGEAIVRDAEEKNIKLKNVL
FT                   DFEAIPGKGIKCSIENKSILLGNYKLMKDKNINLKNLLETSEELASKGKTPMFIAINEK
FT                   IAGIIAVADTVKETSKKAIETLQKMGLEVVMLTGDNLKTAKAIAKEVGVDRVIAEVLPQ
FT                   EKAEKIKTIQDEGKKVAMVGDGINDAPALAISDIGMAIGSGTDIAMESADIVLMKGDIL
FT                   HVVGAIQLSRQTMKNIKENLFWAFGYNTLGIPVAMGVLHIFGGPLLNPMIGAFAMSFSS
FT                   VSVLLNALRLKKFKPNYK"
FT   gene            636553..637209
FT                   /locus_tag="CPF_0535"
FT   CDS_pept        636553..637209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0535"
FT                   /product="flavodoxin family protein"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84571"
FT                   /db_xref="GOA:A0A0H2YTZ7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTZ7"
FT                   /protein_id="ABG84571.1"
FT                   /translation="MKKLLYITVNSKPEKLSSSKTIGRAFISRFVELNPEFEIEEVDLY
FT                   KDFIPRLEHKHFSGRSSVVDCETASIDAKTKEEVKRIIELSEQFKNADLYVIAAPLWTL
FT                   SFPAPLKEYIDCVVQNKITIKVTPEEVKGLLDDKQREMVYIQSSGGEIPWLTKGIFNKG
FT                   LNYVEDIMKFLGIKKFHQLLVDGTGFSIEEKFKAEDKAVEKIDNVIKDIHFSNKG"
FT   gene            638161..638265
FT                   /locus_tag="CPF_0536"
FT   CDS_pept        638161..638265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTY5"
FT                   /protein_id="ABG84011.1"
FT                   /translation="MLIYNICNEFSKSKKNKRRTSTDVKNILNEAKNK"
FT   gene            638514..639650
FT                   /locus_tag="CPF_0537"
FT   CDS_pept        638514..639650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0537"
FT                   /product="glycine betaine/L-proline transport, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84871"
FT                   /db_xref="GOA:A0A0H2YVV3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVV3"
FT                   /protein_id="ABG84871.1"
FT                   /translation="MIEIKNVSKQIGDRKILDNISLTIDKGSLVVLIGSSGCGKTTTLK
FT                   LINKLITPTSGEIFINGKSLAKENPIELRRNIGYVIQNNGLFPHLTIKENIELIPRLKK
FT                   GKDVEKIEKTTLDLLNMVGLDPEIYLNKYPSELSGGQQQRVGFARAFATDAEIILMDEP
FT                   FSALDPITRTSLQEELFNIQEELKKTIIFVTHDMDEALKIADKICIMNGGKIAQYDTPE
FT                   NILRNPANDFVRDFIGSDRVWNNPDFIKAKDIMIKNPVSVKGARTILQGIEIMRSNKVD
FT                   SLLVIDKENVLKGIVTFKDIKITNEKSRALSEIMSENPLRVNEDDSLVDILTVMNENSV
FT                   GFIPVVNSEEKLVGLITRSSLLSILSDQFLDMEVNIFE"
FT   gene            639643..641196
FT                   /locus_tag="CPF_0538"
FT   CDS_pept        639643..641196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0538"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   permease/glycine betaine/L-proline-binding protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83933"
FT                   /db_xref="GOA:A0A0H2YTQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTQ8"
FT                   /protein_id="ABG83933.1"
FT                   /translation="MNSLLQYVISQKTQILDLLVQHIYLTITAIGIAILIGVPLGILVS
FT                   RVKFLRKPIIGFVNLVQAVPSMALLGLLIPILGIGSTPAIFMVVVYSLLPIVKNTYTGI
FT                   SGIDPVVLESAKGIGLTKNQSLFKIQLPLALPIIMSGIRISAVTAVGLMTLAAFIGAGG
FT                   LGYLVFSGVQTVNNNMILAGAIPACILALIVDFIFGKIEVAVTPKGLSNDNKKKNTFVL
FT                   KIISVIMIIAILFMGISSFISSKKDKVVIGSKNFTEQLILGNMYADLVQDKTDLQVEKK
FT                   LNLGGTSVAFGALEKGDVDMYVDYTGTLLVNVMKENNIDNSVDYYNSIKENMNKEHGLT
FT                   VMEPLGFNNTYNIAISKELADKYKINTISDLSKYSNDFVLSPTIEFQNRQDGLVGLKNY
FT                   YGMDFKNVKSLDGSLRYSALSNGESQAIDAFSTDGLLKKFDLKTLEDDKKFFVNYSAVP
FT                   IVNNKTLEKYPQLKDVLNSLSGKINEEKMIDLNYEVDVLGKSPEEVAKAFLIREGLIEQ
FT                   "
FT   gene            641467..642030
FT                   /locus_tag="CPF_0539"
FT   CDS_pept        641467..642030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0539"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937;
FT                   match to protein family HMM TIGR02954"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83204"
FT                   /db_xref="GOA:A0A0H2YRZ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014300"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRZ5"
FT                   /protein_id="ABG83204.1"
FT                   /translation="MSISYLDIDRKNKLNEIKLIKESMKGNKESFGILIKNNKEYLYKM
FT                   AFLYVKDEQDALEVIHETVYRAFLNIEKLKKAKFFNTWITRILINVSIDFLKKKGKNEM
FT                   LDESTPIRKEKCEISTEEKLDLYNAIDLLNDNYKTVIIMMYFNDMKIKDISKVMEIPEN
FT                   TVKTYLRRAKQALGEVLKEGYLNE"
FT   gene            642023..643114
FT                   /locus_tag="CPF_0540"
FT   CDS_pept        642023..643114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35222.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82815"
FT                   /db_xref="GOA:A0A0H2YPM7"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPM7"
FT                   /protein_id="ABG82815.1"
FT                   /translation="MNKKDLDKINLPNNLDDIIDEAINMAHEDKKKNKIKGKGYKKVFK
FT                   NIAAGLAIITGIGVGTTTLAYGVPVIKNAFERIQKEIWNKGDYSKYATEVNQTVSNNGV
FT                   GITLSEILCDGQNLYVSYVIESKEPFKYIKYKYDPVKDYDITKEQAEKIEQMQLDYGAE
FT                   AKVSFTDSELDNSGVSGLEGRFIDDHTFVGVEEYNLTSLNMRIPDEFEFIINFNSIVEE
FT                   GWNSERDKDNVLEGTWNFKVPVKVDKSLSKCIEVNDMNKEGVGIKEVIATPIKLKLVTT
FT                   GYDREKNNYWVRVYDEKGNILRTSSGEELSSYGEYLSTIAKEGEDIKKIKVEIYKPFVD
FT                   ENGKDYFHDPRETILYSKEINLE"
FT   gene            643462..644883
FT                   /gene="treB"
FT                   /locus_tag="CPF_0541"
FT   CDS_pept        643462..644883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="CPF_0541"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by similarity to SP:P36672; match to
FT                   protein family HMM PF00367; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00826; match to
FT                   protein family HMM TIGR01992"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84462"
FT                   /db_xref="GOA:A0A0H2YTP9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTP9"
FT                   /protein_id="ABG84462.1"
FT                   /translation="MSKFEKDAKLLTEYIGGKENVAAVTHCATRMRFVLNDTSKADVEK
FT                   IKAIPCVKGTFTQAGQFQVIIGPEVATFYNDFVGQTGVSGESKEEVKKAAKKNMNIVQR
FT                   AVAGLAEIFAPLIPAIIVGGLILGFRNVIGDMKLFEDGTKSLVEISQFWAGTHSFLWLI
FT                   GEAIFHFLPVGVVWSIAKKMGADQMLGIVIGITLVSPQLLNAYSAGNGAAAPVWDFGFA
FT                   QVPMIGYQAQVLPAIMVGFTFVYLERLFKKITPGPIQMIIVPFFSVIPTVLLAHTVLGP
FT                   IGWKIGSVISGAIVAGLTSSFGWLFAGIFGMIYAPLVITGLHHTLLPVDLQLISDIGGT
FT                   FLWPIIALSNIAQASAVLAMIYVNRKDEDEKQISIPACISGYLGVTEPAMFGVNLKYLY
FT                   PFIASMIGAGVSGMFSMAMGCMANSVGVGGLPAILSMQSSSMLMYLVAMGIAIVVPFIL
FT                   TIVFSKTKLANMASK"
FT   gene            645087..646754
FT                   /gene="treC"
FT                   /locus_tag="CPF_0542"
FT   CDS_pept        645087..646754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="CPF_0542"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /EC_number="3.2.1.93"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02403"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84049"
FT                   /db_xref="GOA:A0A0H2YU20"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU20"
FT                   /protein_id="ABG84049.2"
FT                   /translation="MKDFKKSVVYQIYPKSFKDSNGDGLGDLRGVIEKLDYLKNLGVDY
FT                   IWMTPFYVSPQKDNGYDIADYYKIDPRYGTMEDFEELVKEAKGRNIDIMLDMVFNHTST
FT                   EHEWFKRALKGEEKYKNYYIFKEGKKGEPPTNWISKFGGNAWEYVEELGEYYLHLFDVS
FT                   QADLNWDNKELREEIYKVVNFWIDKGVKGFRLDVINLISKPEKFENDYEGDGRRFYTDG
FT                   HRIHEYLKELNERTFGKDVEIVTVGEMSSTTIENCIKYSNPKEKELSMVFNFHHLKVDY
FT                   KDGQKWSLMDFDFIELKKLFNNWQRGMINGGGWNAVFWCNHDQPRVNSRFGDVKKYFNE
FT                   SSKMLATSIHMMSGTPYVYQGEEIGMTNPGFESIEEYRDVESINYFNILKEEEIDEKEI
FT                   MEILKSKSRDNSRTPVQWNEEKNAGFTTGTPWINIANNYREINVERALENKDSVFYHYK
FT                   KLIELRKNEDVIAYGDYIQFLEDHPKVYAYERNYNGEKLLVINNFYGEECLVDLSKEIE
FT                   GLENYNKSILISNYKDSTLDLLSLKLRPYESIVYKLEK"
FT   gene            647019..647726
FT                   /gene="treR"
FT                   /locus_tag="CPF_0543"
FT   CDS_pept        647019..647726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="CPF_0543"
FT                   /product="trehalose operon repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR02404"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83559"
FT                   /db_xref="GOA:A0A0H2YRD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRD5"
FT                   /protein_id="ABG83559.1"
FT                   /translation="MSSKYLKIYNDIVGKIDSGIFEANTKLPSESQLMDEYNVSRDTVR
FT                   KSLNLLEQNGYIEKSKGKGSFVLDMNKFDFPVSGIKSFKEIENSLGKECETILEELTLK
FT                   SPSDSLMKKLEVSPNKYVWSVVRVRNIDGEKIILDKDYLNAEFVPRLTEEICKDSLYKY
FT                   IEGELGLKIAYAEKEITVQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYTESRH
FT                   RPDKFKFVDFARR"
FT   gene            complement(648176..650341)
FT                   /gene="spoVD"
FT                   /locus_tag="CPF_0544"
FT   CDS_pept        complement(648176..650341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVD"
FT                   /locus_tag="CPF_0544"
FT                   /product="stage V sporulation protein D"
FT                   /note="identified by similarity to SP:Q03524; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717; match to protein family HMM PF03793; match to
FT                   protein family HMM TIGR02214"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84313"
FT                   /db_xref="GOA:A0A0H2YTH2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR011927"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTH2"
FT                   /protein_id="ABG84313.1"
FT                   /translation="MAIIRKRLSFILAFIIIMCFILSIRLSYVMIVKGPEYAELAVEQW
FT                   TNEVKISARRGKILDRDLNELAVSSNVYRVDFNLNAIRSYTKKTGKTNEELALEISKVL
FT                   EMDKDTVLKKLEFKLPSGAPAGAAILARRIEKEKADKVKELEIPGVMVSPDTQRYYPND
FT                   NFLSHVLGTTNSDGVGLNGIELKYDRVLSGSPGLKITEMVKDGAEYPYTISRFTAPVDG
FT                   KDVVLTIDEKLQYFAEQIAEIGLVHHNADAASVIIMNPNNGEILAMSNKPDFNPNKPYD
FT                   GAENFSGNTSSDRIQKMWRNRSVSDSFEPGSIFKIITASAAVQEGVAGKDETYTCSGGL
FT                   QKGDRFIKCWKRGGHGTQTFEEIIQNSCNVGFMNLGEKLGAEKLNEYIKKFGLGKKSGV
FT                   DLPGESPGIVKKTENITDMDLATISFGQTNTVNPIQFMTAVNAVANGGTLIQPHVVKEI
FT                   SYIDENNDRVIDETFVPKKTENLISKETADQIKLALENAVKNGSAKGAYKEGYGVAGKT
FT                   GTAQKVNPETGGYGGGYVASFVGFAPYDNPQISVMVSVDNPKNGEYYGGRVAAPLAGML
FT                   LQNIFNYIDLTEFHLDEKLPEKETVIIPEVRGLPINDATSMLKELSISYEIEGEGEFIV
FT                   ESNPAPGYPISPDTKITLIAGDSSNLNSDVIIPDFKNYSKESAEKLLNQLGLIGEFVGE
FT                   GPSVTKQSISPDEVVNGNSKITLTLGY"
FT   gene            650904..651377
FT                   /locus_tag="CPF_0545"
FT   CDS_pept        650904..651377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0545"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="identified by similarity to SP:P00806; match to
FT                   protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84195"
FT                   /db_xref="GOA:A0A0H2YT59"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT59"
FT                   /protein_id="ABG84195.1"
FT                   /translation="MRQELDIKEVDYKWGSGLKKGNSPKRLIIHHSATDSPETPEDIHK
FT                   FHLDNGWSGIGYHFYIREDGTIYKGRDENVIGAHAKNANYNTLGICIEGNFEKEGLKEA
FT                   QKNSLVKLGTYLSLKYPIKDILPHREVVDTLCPGTLFPMDNIKSSIIEEIKNM"
FT   gene            651933..653048
FT                   /gene="ribD"
FT                   /locus_tag="CPF_0546"
FT   CDS_pept        651933..653048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="CPF_0546"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83871"
FT                   /db_xref="GOA:A0A0H2YS59"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS59"
FT                   /protein_id="ABG83871.2"
FT                   /translation="MEGEDNLDEFFMKKALELARKGEGYVNPNPLVGAVIVKGGEIIGQ
FT                   GYHEFFGGNHAEINAINSSIKSTEGATIYVTLEPCCHYGKTPPCIEAIIKNKFKRVVVG
FT                   TLDQNPLVSGKSIKILRESGIEVKVGVLEKECIRLNEIFNFYIKENRPFIALKWAMTLD
FT                   GKIATKEFKSKWITNRKSREFVHSLRNKYSSIMVGINTVLKDNPDLRCRLNKNKELERK
FT                   HFRIVLDSKLRIPLDSEILKNQNESKTLIFTTNKKDKIKNEKLKDIGIEVIEVNLDEGK
FT                   ININQVLECLKEKNIDSVLIEGGGNLNFTFLENKKVNKIYAFVAPKVFGGKNAITPVEG
FT                   EGIRNVLDAFEFPEVNLKNFDKDILIECGLS"
FT   gene            653070..653723
FT                   /gene="ribE"
FT                   /locus_tag="CPF_0547"
FT   CDS_pept        653070..653723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CPF_0547"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to SP:P50854; match to
FT                   protein family HMM PF00677; match to protein family HMM
FT                   TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82998"
FT                   /db_xref="GOA:A0A0H2YPY7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPY7"
FT                   /protein_id="ABG82998.1"
FT                   /translation="MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNG
FT                   VCLTITTKGKDYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDS
FT                   TGEIISFKDEGEAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHS
FT                   QEETTLTKRKIGDLVNIECDSIGKYVEKLLGFKKDSRKKKSVLTEEFLTINGFI"
FT   gene            653875..655074
FT                   /gene="ribA"
FT                   /locus_tag="CPF_0548"
FT   CDS_pept        653875..655074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="CPF_0548"
FT                   /product="riboflavin biosynthesis protein RibA"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by similarity to SP:P17620; match to
FT                   protein family HMM PF00925; match to protein family HMM
FT                   PF00926; match to protein family HMM TIGR00505; match to
FT                   protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82360"
FT                   /db_xref="GOA:A0A0H2YNK2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNK2"
FT                   /protein_id="ABG82360.1"
FT                   /translation="MKKFNLVEEAIEDIKNGKMVIVIDDEGRENEGDLVMAGELVTGEK
FT                   INFMATYGKGLICAPVSERIAENLGLNPMVLNNTDNHETAFTVSIDYKDTTTGISAFER
FT                   AHTIKELINEESKAEDFRRPGHVFPLIAKNGGVLKRAGHTEAAIDLAKLAGLKEVGVIC
FT                   EIMKDDGTMARTDELLEFANSHNMKIITIEDLIAYRTERDNFVYRVVETNMPTKYGEFK
FT                   AIGFIDKLTGEHHVALVKGEIKSEEPVLLRVHSECLTGDVFGSRRCDCGEQFHRAMEKI
FT                   NEEGKGILLYMRQEGRGIGLINKLKAYKLQDEGLDTVEANIALGFPEDLRDYGVGAQIL
FT                   KELSVREIRLMTNNPKKITGLEGYGLKIVERVPIEIKCNEENEFYLKTKKEKMHHLIMQ
FT                   "
FT   gene            655201..655662
FT                   /gene="ribH"
FT                   /locus_tag="CPF_0549"
FT   CDS_pept        655201..655662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="CPF_0549"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82771"
FT                   /db_xref="GOA:Q0TTN7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTN7"
FT                   /protein_id="ABG82771.1"
FT                   /translation="MRILEGNLIGQDKKFAIVAGRFNEFIVSKLIDGALDAFKRHGVEE
FT                   DNIDLAWVPGAFEIPLIAKKLAKSGKYAGVVCLGTVIRGATSHYDYVCGEVSKGIANVS
FT                   LDTEVPVIFGIVTTENIEQAIERAGTKAGNKGFDAAMAAIEMANLLENI"
FT   gene            complement(655789..656781)
FT                   /locus_tag="CPF_0550"
FT   CDS_pept        complement(655789..656781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0550"
FT                   /product="cell wall binding repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84044"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU15"
FT                   /protein_id="ABG84044.1"
FT                   /translation="MKINHKITSIVLTLGLISSSIYTINVNAETLNSKIQVSNLNLSNS
FT                   YNIKNENLIKSSKEGWINTNGIWYFYKNGIIQTGWLNDNGIWYYLNENGSMATGWYKVD
FT                   SNWYYSNSNGVMQTGWLNDNGNWYYLNDNGSMATGWYKVDSNWYYSNSSGVMQTGWLND
FT                   NGNWYYLNDNGSMATCWYKVDSNWYYSNSNGVMQTGWLNDNGTWYYLNDNGSMATGWYK
FT                   VYSKWYYSNSNGVMQTGWLNDNGTWYYLNSSGEMVTNTIIDGWKIDSNGIATPLKDENH
FT                   SIVYVTPNGKSYHYSKDCTALKRSSSILSMSLNEAINKGKSDPCNLCVK"
FT   gene            complement(656885..657292)
FT                   /locus_tag="CPF_0551"
FT   CDS_pept        complement(656885..657292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0551"
FT                   /product="conserved hypothetical protein TIGR00149"
FT                   /note="identified by similarity to GB:BAD76119.1; match to
FT                   protein family HMM PF01894; match to protein family HMM
FT                   TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83607"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRH5"
FT                   /protein_id="ABG83607.1"
FT                   /translation="MNNFFKHTLETHTPQSMSKITSYIREDIKNSNIENGIVVVYCPHT
FT                   TAGITINENADPDVVKDLIYGFEKVYPTNDHKYRHFEGNSHSHLKSSTVGVSQQLILHR
FT                   GRLILGQWQDVYFCDFDGPRNRTFYVKILEG"
FT   gene            657691..657939
FT                   /locus_tag="CPF_0552"
FT   CDS_pept        657691..657939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F72407"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82733"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP87"
FT                   /protein_id="ABG82733.1"
FT                   /translation="MYTIMAIKISPRTVAAPRVQEILTKYGCIIHTRIGLHEATENTCS
FT                   TSGLILLNLTPSAEEEIKNLDNELNSLEDVTAKLLNL"
FT   gene            658230..660434
FT                   /locus_tag="CPF_0553"
FT   CDS_pept        658230..660434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0553"
FT                   /product="conserved hypothetical protein TIGR02336"
FT                   /note="identified by similarity to GB:AAN25428.1; match to
FT                   protein family HMM PF09508; match to protein family HMM
FT                   TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83511"
FT                   /db_xref="GOA:A0A0H2YRA5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRA5"
FT                   /protein_id="ABG83511.1"
FT                   /translation="MGELKGRVTIPTDSNMKEEIKSIIDRWGADALRDCDGTKLSKDIV
FT                   DLGVKLYSTYLTVRSDQKWASENKDELQQLYLMSEPVIAKSEKTEIKILAGYYSEQFEI
FT                   DKVHDEKEWWEVIDRTTGEVVDPSKWNFNKESEILTVEETTPYHEYTVNFLVYMIWDPT
FT                   QMYNHITNDWGDKPHEMPYDCRQAKTRVHVKEALKKWIDENPEVDVVRFTTFFYHFTLC
FT                   FNEVAKEKFVDWFGYSSSVSPLALEQFEKEKGYKLRPEDIVDAGYYNSTFRVPTKQYKD
FT                   FIDFQCKHVSKMAKELVDLCHENGKEAMMFLGDNWIGTEPYGKYFPSIGLDAVVGSVGN
FT                   GTTMRMIADIPGVKYTEGRFLPYFFPDVFNETGDPVGEARENWLQARRAILRSPLDRIG
FT                   YGGYLGLAVKFPEFVEQVEKICDEFREIHETIKGTKAYVAPFKICVLNCWGKLRSWQTQ
FT                   QVAHALWYKEIYSYAGIVECLSGMPVEVEFISFDDILENGIPEDTGVIINAGDAYTAWS
FT                   GGEYWKNPKLVSMIRKWVHNGGGFIGVGEPTAIHYENKFFQLADVLGVDKEVGFSLSTR
FT                   KYNELNPHHFITEEIGEKAIDFGEGMKGVYGKGDSYQVLRMDFGNCHCLKNNFRGDTTC
FT                   AVNTYGKGRSVYFAGFPYTPENCRILLRAIYWAASKEDEMKKFYVTNIDTECAAFLEVG
FT                   KMAVINNTQEEKITDAYINGVKVETLTLAPMEIRWLNINK"
FT   gene            660619..662370
FT                   /locus_tag="CPF_0554"
FT   CDS_pept        660619..662370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0554"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84477"
FT                   /db_xref="GOA:A0A0H2YTS1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTS1"
FT                   /protein_id="ABG84477.1"
FT                   /translation="MRKIIKKITNTLRGISNFLRKTSIKNRLIASFSVGIIFCSSILGI
FT                   LLYKKATNALKNNAINYSENMLSIMSEDIYKNKEFLERASIELSMNEEIANNLINYKFM
FT                   DGKEKNGFLKYMNDYLSKKLSLLPNLAEVEIISKDYEVTYMQGFKYFKREDIERYADES
FT                   ENGLFWFSTILNNEPHICIVTPVKQDNSIVGYVFMAIKSEVFASSFSLFNIGKGSEIFI
FT                   IDDKNNIIISENNLNSNFILEETDLNKFLKDKGAKDTARSIVVNGENYVATYRKLKGFN
FT                   WYIASMTPYDFINADIQSLRKEMTIIGLLFTLVVLIFSYFLYSSIKVPLYNLLNKMKRV
FT                   SEGDLKVLVNDTYEDEIGVISDNFDSMLKRVNELIEKTKLQEVEKRDLEIRMLQAQINP
FT                   HFLFNTLNSLKWTALMNQDYTVSEGLSSLAELLRNTIIDKNELVTIREELENIKNYVVI
FT                   QKIRYGNSFDVQYEVDELLLENKVIKFILQPIVENSIIHGIDENKENQKIIIKIMSEEE
FT                   NILISIKDNGKGFNSKEKVKDNKLSGIGWNNVDERIKLTFGLGYGTTIYSEVNKGTIVK
FT                   IVIPKSI"
FT   gene            662383..663972
FT                   /locus_tag="CPF_0555"
FT   CDS_pept        662383..663972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0555"
FT                   /product="DNA-binding response regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83052"
FT                   /db_xref="GOA:A0A0H2YQE1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQE1"
FT                   /protein_id="ABG83052.1"
FT                   /translation="MFKVIIADDEKIVRIAMRNIIDWESHGFNIVGLAQDGSEVLNILN
FT                   ENGADLIITDLKMKGLNGIELIDKLKEKNFRGKILVLSNHGEYELVREAMKKGADDYLL
FT                   KITLRPKELEDIIDKFRESLEERKEEEEKEAQFKNEFDKTKKLAEISLLKEYLKDDLSY
FT                   EELLNEFPKINFLDDNCEYYTGACIYIDNYKKIYEEKIKDKNKLAITIENIIKEEFSVN
FT                   GVKIIPINNHKYIFISKMDFNSLKIKTINIQNLIMLYLNIKVSAVLIKRIESVKGLKES
FT                   FKKVEEILSLKFYGKENFLIISEEFLGFGDAIKLRKEVTDAILENIELGEISANKELIK
FT                   EFARRCSNMNVKPSALINYVNFMCELIENHEYVQDDLNCIKELKGKILKSDNIEELINN
FT                   STILIDYINQRYIKSKELSYKKEVNEIIKFIEKNIDKRITLVMVANAVNLNESYLSRIF
FT                   KNETGKNLMYFINEVKMKKAKELLKQQDTLVKEVANSIGMTDQFYFNRVFKKFYGVSPS
FT                   KFKKDYSNKVLS"
FT   gene            664125..665510
FT                   /locus_tag="CPF_0556"
FT   CDS_pept        664125..665510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0556"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83819"
FT                   /db_xref="GOA:A0A0H2YS15"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS15"
FT                   /protein_id="ABG83819.1"
FT                   /translation="MKRKLVKMLTVACVTAIAASAFVGCGNKEEAPKDNEKPSTEQAEG
FT                   SGEKKVLEIAVFEGGFGKDYWDACIDAFEAEHPDVEVKMEANPKIGDIIRPKLSSENTP
FT                   DFIYLSTNDQSGIANALIKDKALVDLSDVFDREDPDNPGQKLKDKILPGFLDTPLTTPY
FT                   GDGKVFLAPLYYNVTGMWYNKALFKEKGWEVPKTWDEFFELGKKAKDEGIALYTYQGQA
FT                   PGYNEAVIFPMLASAAGEEAVEKIFNYEEGAWKDPNVKKALDVFQRMADEDMVLNGTVG
FT                   MTHTQAQVEFLNGKALFLPCGSWLEGEMKDAIPEGFEFGFMAPPAFKEGDTPYVTTTIE
FT                   QMYIPAKSDQVELAKEFLAFQYTDAMVQKNAEIAKAVVPVKGAVEKAKSSLDASGYESY
FT                   KFVEEGAKPIPLSFKPTNSKLDFRNDSLFGPVGSIINKELTVDEWINNLESDSQTLAKE
FT                   VVE"
FT   gene            665589..666515
FT                   /locus_tag="CPF_0557"
FT   CDS_pept        665589..666515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0557"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84640"
FT                   /db_xref="GOA:A0A0H2YVF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVF9"
FT                   /protein_id="ABG84640.1"
FT                   /translation="MNSNKRKIFLAMCVLPALILFTIFMLYPIGKGFMMSLYEWSGISG
FT                   EPVFVGLDNFKALLNDRYFKEAFGNTFFIIVLFPAITITLSLFLAVVITQSKLKEKNFY
FT                   RVILFFPNILSMVVIGVLFTYVYDPSIGILKAFFEMIGLDKLAGLAWLGDSKLVLWALV
FT                   ITMVWQAVGYYMVIYIAGLDGISPSLYEVCYLEGASAWQKFRYVTLPLLWDVVRVTFAF
FT                   FITGALNLSFIFVTVMTKGGPNGKSEVLLTYMYKQAFTNSQYGYAMAVGVTIFAFAMIL
FT                   ALIINKLSDSDAREEKRVKRLQQKGVI"
FT   gene            666517..667398
FT                   /locus_tag="CPF_0558"
FT   CDS_pept        666517..667398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0558"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84763"
FT                   /db_xref="GOA:A0A0H2YUM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUM3"
FT                   /protein_id="ABG84763.1"
FT                   /translation="MLETKKRKNVGLDTENKTKKVISNTLLRIILIAATILVIVPIIWT
FT                   IMSSFKTTKEFYASPWALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMVLSLCLSV
FT                   PASYVLARQKFFGCSFIKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVL
FT                   SLPFSIYIMSGFMKGIAKDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYW
FT                   NEYAMAMTFITDADKKTLPVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKK
FT                   LTEGVNIGGVKG"
FT   gene            667634..668329
FT                   /locus_tag="CPF_0559"
FT   CDS_pept        667634..668329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0559"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85054"
FT                   /db_xref="GOA:A0A0H2YVD6"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVD6"
FT                   /protein_id="ABG85054.2"
FT                   /translation="MKKIVKPWVATLIILIVAFLVYFFVPTANSKINQMIFYLSSMNLD
FT                   MIKEYILSFGIWAPITSFLLMVLQSVIAPIPAFLITLSNAAIFGWVKGAILSWSSAMAG
FT                   AALCFYIARGLGRDAVEKLTSKFALKDIDGFFEKYGKHTILIARLLPFISFDLVSYAAG
FT                   LTSMNFWSFFIATGIGQLPATIVYSYVGGMLTGGAQLLMSGLLILFALSIAIYVGKKVW
FT                   NEKRGKNDK"
FT   gene            668319..669431
FT                   /locus_tag="CPF_0560"
FT   CDS_pept        668319..669431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0560"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83426"
FT                   /db_xref="GOA:A0A0H2YR72"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR72"
FT                   /protein_id="ABG83426.1"
FT                   /translation="MTNKELKKNLEDCVNCRLCYKVCPMMNTFGESPKNILRDIDKNKI
FT                   SYDEIAYSCMLCNACTEACPKDINLKEMFQNLRIKSYRENLKNTSKKFNLKVVQNHQKG
FT                   SFSKFLTSKNNHKKIKRVFIPGCSLSGYNNEIIFKIKDYLIENLGKVEILLKCCGKPSK
FT                   DIGNLELFESNLNDIENNLKIKEVDEIIVACENCYKTFGSAFKDIKVITLWEVINEFGV
FT                   PKELKNKYSDLKEEFALHDPCPIKKEEQIHEAVRSILKDLGIKIVEFEKNRSKTECCGC
FT                   GGMVGVTNKELWLSQKNKRANSTECENIVSYCESCVNTFKSSDKNALHILDFIFNEDVI
FT                   NGKAKSQKNISTINQWINRIKLANKVGKES"
FT   gene            669595..670182
FT                   /locus_tag="CPF_0561"
FT   CDS_pept        669595..670182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0561"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01066"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84081"
FT                   /db_xref="GOA:A0A0H2YTL1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTL1"
FT                   /protein_id="ABG84081.1"
FT                   /translation="MLDTYGRKYVNPIIDLGANTLLKLRLTPNGVSIIALIIGVLSSVF
FT                   LYFDKLILSVVFLWISGYLDSVDGAMARKKNLTSPFGTLLDITFDRIVELSIIFVLALK
FT                   FQNSRLYLLILTMMILISMTIFLTVGALAQNNGMKSFRYQAGLAERSEGFICFSLMILL
FT                   SSIKLNLVTNIFSLIIFITIIQRALEAKRLLK"
FT   gene            670467..671099
FT                   /locus_tag="CPF_0562"
FT   CDS_pept        670467..671099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR33720.1; match to
FT                   protein family HMM PF01865"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82538"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YP50"
FT                   /protein_id="ABG82538.1"
FT                   /translation="MFNLNPKDDKFYDMFIDEAKNVEKAAVILSEALGDLENKTSHVAR
FT                   VEELEHKGDEIVHRLIEELNNSFITPIDREDIFSITKRMDDILDSIESTMHRFTMFNIN
FT                   ESKEGAKVLGSLIVDASRELVSLMEEFKHMKKKNKEITERVISINKIENKGDIFYRQMI
FT                   SELFAEDGKTPVLDIIKWREIYKFLEATLDSCEAVANIVEGVVMKYV"
FT   gene            671092..672090
FT                   /locus_tag="CPF_0563"
FT   CDS_pept        671092..672090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0563"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83161"
FT                   /db_xref="GOA:A0A0H2YRV3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRV3"
FT                   /protein_id="ABG83161.1"
FT                   /translation="MSSTLAVTVVIILLTLAFDFINGFHDTATAVATSISTRALSPKAA
FT                   IALCAVFNFVGAFLGTEVAKTVGDGIVDQNKIPLWVIAAVILGAIIWNLITWYFGIPSS
FT                   SSHALIGSLIGGGIAYSHSINIVSWGTLFDEVILWLILSPIIGLIVGYIFMILLNWALR
FT                   RCKPGPVNRIFSKLQVVSGALMALNHGGNDAQKSMGIITMALLSGGFLSTFEVPTWVIA
FT                   LCAIAMATGTSIGGQKIIKTMGSGVAKLNAVNGFAAQTGAAGVIGIATMFHAPVSTTHI
FT                   ITTTIMGVGASKNPKAVKWGVAKNIVWAWILTIPISACIAAIVVEIFKFVL"
FT   gene            complement(672372..674264)
FT                   /gene="fruA"
FT                   /locus_tag="CPF_0564"
FT   CDS_pept        complement(672372..674264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="CPF_0564"
FT                   /product="PTS system, fructose-specific, IIABC component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83931"
FT                   /db_xref="GOA:A0A0H2YT35"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT35"
FT                   /protein_id="ABG83931.1"
FT                   /translation="MKISQLLSLDTIKLNLAASNKNEVIDQLVDVLWDAGKLTDKNLYK
FT                   EEILKRESLSSTGIGERIAIPHAKTKAVKNASLALGIYKYGVDYDSLDGEPVNIVFMIA
FT                   APAGANDEHLETLSRLSVLLMNPDFKNGLLNAKTPEEVISLLDKFEENEESDETQASNE
FT                   AENNSNKKYILAVTACPTGIAHTYMAADSLNKTAKEMDVHIKVETNGSTGVKNRLTQED
FT                   IDKADGIIVAADKQVEMARFNGKKVVIVPVVQAMKRPQELINEALSGSAPVYSHSGDSS
FT                   NQSSGKTERRGFYKHLMNGVSNMLPFVVGGGILIAISFMFGIHSAEINDPTFNPIAKLL
FT                   KDIGGGNAFFLMIPVLAGFIGSSIADRPGFAPAMVGGLIAANSGSGFLGGLIAGFLGGY
FT                   VVVLLKKIFSKLPQSLEGIKPVLLYPLFGILITGALMYLVIVGPVTALNNNIAIWLQNM
FT                   GTGNLVLLGIVLGGMMAIDMGGPINKAAFTFGIAMIASGNYYPHAAIMAGGMVPPLATA
FT                   LATTFFKNKFTKDERDAGTTNYIMGLTFITEGAIPFAAADPFRVIPACVIGSAIAGGLS
FT                   MVFKIGLPAPHGGIFVVPVVEGNPLLYLLSILVGSIVAALIIGFLKKPVNEINK"
FT   gene            complement(674268..675188)
FT                   /gene="fruK"
FT                   /locus_tag="CPF_0565"
FT   CDS_pept        complement(674268..675188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="CPF_0565"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by similarity to SP:O31714; match to
FT                   protein family HMM PF00294; match to protein family HMM
FT                   TIGR03168"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84376"
FT                   /db_xref="GOA:A0A0H2YTM0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTM0"
FT                   /protein_id="ABG84376.1"
FT                   /translation="MIYTLTLNPSIDYVIDVENLELGKVNRTSKDFKFPGGKGINVSRI
FT                   LGNQKIDNIALGFLGGFTGKFIEDNLKALGVKTEFIKVKGDSRINVKIKSNKETEINGA
FT                   GPMITSEELDSLFNRLDQLVEGDILVLAGSIPSTLPKDLYLQIQKRVSKKNVKVVVDTS
FT                   GKALLEAIKNKPFLIKPNNHEIEEIFDVKINSEKELIKYGKDLVSLGAENVIISMAGDG
FT                   ALLINKDGVFKGNAPKGEVKNSVGAGDSLVGGFLAKYVETKDLIASFKNGIASGSASAF
FT                   SLDLALAEDVNKLLPIIKIEKYEEV"
FT   gene            complement(675188..675934)
FT                   /locus_tag="CPF_0566"
FT   CDS_pept        complement(675188..675934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0566"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82809"
FT                   /db_xref="GOA:A0A0H2YPM4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPM4"
FT                   /protein_id="ABG82809.1"
FT                   /translation="MLSEKRHEIILNLLKLKGFVSLTELLEATESSESTIRRDLSYLES
FT                   INLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTT
FT                   YELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFR
FT                   FDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDIN
FT                   KCVIITNEKPKDNTYDKKTDIKVVDI"
FT   gene            676225..676677
FT                   /locus_tag="CPF_0567"
FT   CDS_pept        676225..676677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83614"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSZ2"
FT                   /protein_id="ABG83614.1"
FT                   /translation="MLNKSDNEIYIMAPSEGNVLDYIVLNKAFNLEDLEEIISLNSHNE
FT                   FLFSPIEGKVINISKDYGFIEIGMKEGVNIIVSTHINKNIKAIEPMVDIGGNVLTGQIL
FT                   MYFEKDNDCHMPITVAIKKSNLIKKSIKSTNRNININEYIMKLNLI"
FT   gene            complement(676728..677828)
FT                   /locus_tag="CPF_0568"
FT   CDS_pept        complement(676728..677828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0568"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84316"
FT                   /db_xref="GOA:A0A0H2YTD4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTD4"
FT                   /protein_id="ABG84316.1"
FT                   /translation="MNNFFRNNKSYIKMVLVIIVSYLSIKLIDNIPSVMSAIHTILAVL
FT                   LPFLLAFIIAYILNPIVNLFSKKFKLSRGISIVITYLIFVTSISLAATYLLPKLYTSLI
FT                   ELIDNIPAFTNYVQNLFTEIMASFKVPEGINSYLPYGDTNKLITFIGSMVTVLSNWLLD
FT                   AAISLTSSIINWIFGFLISIYVLVDKDKFLAHSSKVTRIVFGKNLGNEILEFVKILNEK
FT                   IGTYVGIKAIDSLIIGVLAFIGLTIMKSEYALLLSVVVGITNMIPYFGPFIGMVVGFFI
FT                   NVFISPMKAVIVLIYLFILQQFDAWYLDPKLIGNRVGLSPFLVILGVTLGGAIYGPIGM
FT                   ILGSPVMSVIRIYTLKLIKKFEYRAE"
FT   gene            678125..678745
FT                   /locus_tag="CPF_0569"
FT   CDS_pept        678125..678745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0569"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84886"
FT                   /db_xref="GOA:A0A0H2YVF4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVF4"
FT                   /protein_id="ABG84886.1"
FT                   /translation="MISGIYERLQSLESLDLKSLDKNRTMLLIVDINKGFAKEGALYSD
FT                   RIEKLISPISNLANYALNSGIRVKAFTDYHTEDSIELKAYPKHCMKDTDEWELVDELNL
FT                   EGIEVIKKNSTNGFLEENFILNKEEIDNVIIVGDCTDICIYQLAISLRAEFNRVNKDGE
FT                   IYVPKKLVDTFDMPMHKANFMNYVFLNSMLDNGVKVIEDIILD"
FT   gene            679123..680436
FT                   /locus_tag="CPF_0570"
FT   CDS_pept        679123..680436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0570"
FT                   /product="voltage-gated chloride channel family protein"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84071"
FT                   /db_xref="GOA:A0A0H2YSS0"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSS0"
FT                   /protein_id="ABG84071.1"
FT                   /translation="MKQKSKKYLKYISRNNTFLLGKTFLKWLLIGSLIGIFIGGVIAIF
FT                   LKSLEWATDYRVNHGFVLFLLPIGGALVSFLYYKFGRNSVKGNNLIIENINNYCGDVPL
FT                   RMVPLVFFGTVVTHFFGGSAGREGTGVQIGASIAETIGKLLKLNKEDSKIMLMAGVSGG
FT                   FSAIFGTPLAGTIFGLEVSVLGKMSYEALIPSFFASIVGNEVVKILGVHHSHYKVLGVP
FT                   DISVLIILKVIISAICFGLASRLFSELTHKLKGLFSNKFKNTSLKSFVGGCIVILLVYL
FT                   VGSRKYLGLSLPLLSEAFDGHVSPFDFLGKLIFTSITLGAGYQGGEVTPLFVIGSTLGN
FT                   TLSGILNLSPSFLASLGLVGVFAGATNTPIASFVLGIEMFGVGGAPYLFMACAISYIFS
FT                   GHTGIYTSQKIGVSKSNLINFSHDSTLASLSKREEVKL"
FT   gene            680740..681663
FT                   /locus_tag="CPF_0571"
FT   CDS_pept        680740..681663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0571"
FT                   /product="glutaminase"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82561"
FT                   /db_xref="GOA:A0A0H2YNT1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNT1"
FT                   /protein_id="ABG82561.1"
FT                   /translation="MDINLDALVEANRRYTKEGHVATYIPALAKVNPDQLGVCIYDLKE
FT                   NKEFSAGEYDVRFAIESISKVPTLILAILDNGIEKVFSEVGTEPSGFAFNSIMNMQINH
FT                   KNKPSNPFINAGAIKVVSLLKGKNDEERFKRILDFYRKIMNDDEITLDTEIYLSERETG
FT                   DINRSLAYYMKGNGIMEGDVTDILDSYFKQCSVLVTAKDLARLGAVLANEGVMPWNGER
FT                   LFSVETATVVKSLMTTYGLYDESGAFSVHIGLPSKSGVGGGILSSVPNKCGIGLFSPAL
FT                   DVPGNSVASMKLLKEIADKLKLDIFR"
FT   gene            681964..682686
FT                   /locus_tag="CPF_0572"
FT   CDS_pept        681964..682686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0572"
FT                   /product="MgtC family protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83576"
FT                   /db_xref="GOA:A0A0H2YSB4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSB4"
FT                   /protein_id="ABG83576.1"
FT                   /translation="MGLTLSFKDIIIRLLLATIVGGVIGYEREYHNRAAGFRTQILVCV
FT                   GAAIVSLIEIRLGQDVFEAIKDNYYIRSVIKIDYARLGAQVISGIGFLGAGTILQNKGS
FT                   VKGLTTAASLWVVACLGLAIGMGYYNLGILGFLFIFLTLVSLKKFQSKFITKAGEKCFE
FT                   IIYEKDSQVLEFIDKIFTQKGVKIKSIEFLGRNNNEAAQYKNAIYRVELPNYIEVGEII
FT                   NKLSINDGIIKISEYNDI"
FT   gene            683146..684663
FT                   /gene="rrsF"
FT                   /locus_tag="CPF_3013"
FT   rRNA            683146..684663
FT                   /gene="rrsF"
FT                   /locus_tag="CPF_3013"
FT                   /product="16S ribosomal RNA"
FT   gene            684849..687753
FT                   /gene="rrlF"
FT                   /locus_tag="CPF_3014"
FT   rRNA            684849..687753
FT                   /gene="rrlF"
FT                   /locus_tag="CPF_3014"
FT                   /product="23S ribosomal RNA"
FT   gene            687806..687923
FT                   /gene="rrfF"
FT                   /locus_tag="CPF_3015"
FT   rRNA            687806..687923
FT                   /gene="rrfF"
FT                   /locus_tag="CPF_3015"
FT                   /product="5S ribosomal RNA"
FT   gene            687930..688004
FT                   /locus_tag="CPF_0573"
FT   tRNA            687930..688004
FT                   /locus_tag="CPF_0573"
FT                   /product="tRNA-Glu"
FT   gene            688429..689121
FT                   /gene="sfsA"
FT                   /locus_tag="CPF_0574"
FT   CDS_pept        688429..689121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="CPF_0574"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82808"
FT                   /db_xref="GOA:Q0TTL3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTL3"
FT                   /protein_id="ABG82808.1"
FT                   /translation="MKYNSVIRKAIFLRRPNRFQAYVVLDDEELLVHVPNTGRCREILK
FT                   EGCTVLLRKGTTPNRKTPYDLIAAYKGEVLINIDSQIPNKVVEEALINKKIEKLVNFNN
FT                   ISREKTFGNSRFDFKLQDDNENTYFLEVKGVTLEENGETRFPDAPTERGKKHILELIEI
FT                   KKLGMGAGIIFLIQIDNVNKFSPNDETDPKFGEALRLAKKERVDIFAYNCKVTEEEIEL
FT                   LNPVEIVL"
FT   gene            689535..690074
FT                   /locus_tag="CPF_0575"
FT   CDS_pept        689535..690074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0575"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83943"
FT                   /db_xref="GOA:A0A0H2YSC7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSC7"
FT                   /protein_id="ABG83943.1"
FT                   /translation="MKFKYCPLCGEKLELKNSWDEGMIPYCSKHDMMFFDLPKPCIVVA
FT                   VIKGDEIILLKQSYIYENSKVLISGYVGVDECAEETVYREVKEETGITVKDIKYLGSDF
FT                   VKGKELLMLTYLAYYESGEIEKSTEVEGAAWYNIEDALCELNEDSIGKRVVKKVLKEIG
FT                   YEGTNAFRCEGNNCNV"
FT   gene            690485..691780
FT                   /gene="lysA"
FT                   /locus_tag="CPF_0576"
FT   CDS_pept        690485..691780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="CPF_0576"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by similarity to SP:P23630; match to
FT                   protein family HMM PF00278; match to protein family HMM
FT                   PF02784; match to protein family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84043"
FT                   /db_xref="GOA:A0A0H2YSM9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSM9"
FT                   /protein_id="ABG84043.1"
FT                   /translation="MKLFGSMKVEENELYVGGVKASALSKEYGTPLYVIDEELVRSNCR
FT                   RYYNAMKCEERGNRVTYAGKAFINMSMCNLVNEENLYLDVVSGGELYTAYKAGFPLERI
FT                   YFHGNNKSDYEIDLGVRLGIGRFIVDNIHELEVLNSIAQEYGRVQKVYLRITPGVEAHT
FT                   HEYIKTGQLDSKFGFPVIGDTVYDAIKRAMELEYIELNGLHCHIGSQIFDLEPFEDTTE
FT                   IMLNLINDIKETLGYEIKELDLGGGFGIYYTEGDKPKEIEEYCSVIINKADEICRKLNM
FT                   NVPILSIEPGRSIVGNAGLTLYTVGAIKEIPNIRKYVSVDGGMSDNIRPALYSANYESL
FT                   IANRVFDNSKEIVTVAGKCCESGDVLLNSIEMPRMETGDILAIMSTGAYGHSMANNYNR
FT                   IPKAAVVSVSNGISKVMCKRETYEDLLRNECF"
FT   gene            692189..692455
FT                   /locus_tag="CPF_0577"
FT   CDS_pept        692189..692455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82268"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YN27"
FT                   /protein_id="ABG82268.1"
FT                   /translation="MSLKISHTNIRSKEYKMKKIIVDRIEGHFIVCEDEKENILELKKD
FT                   DVIGDVKEGDVLVKGKDGKFCLDKALTEKRKKEIEDLMKGMWE"
FT   gene            692458..692988
FT                   /locus_tag="CPF_0578"
FT   CDS_pept        692458..692988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0578"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83067"
FT                   /db_xref="GOA:A0A0H2YQA8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQA8"
FT                   /protein_id="ABG83067.1"
FT                   /translation="MSSSNTKKKSFFLDWIIPILAALLLAALIHQFLLFKIKVPTGSMM
FT                   PTVEIGDQLFVTKIYNPNNIKRGDIVVFNSDELKEPLLKRVIGLPGEHVEIKSDGSVYI
FT                   NGNKLEEDYVKYQGGKTDMSFDVPSGKFLMLGDNRNNSDDARYWSNPYIDGKDIEAKAQ
FT                   LTVYPFDRIGFVK"
FT   gene            693013..695166
FT                   /gene="ftsH"
FT                   /locus_tag="CPF_0579"
FT   CDS_pept        693013..695166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="CPF_0579"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83666"
FT                   /db_xref="GOA:Q0TTK8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTK8"
FT                   /protein_id="ABG83666.1"
FT                   /translation="MFKDKKMLKYIVIYSIIAFGILLTFNMVKDEMLYEKVDYSTFMQM
FT                   LDKKEVKSVNFSGNQIEITPSDSSNLKGKILYTTNPAVAGITQPELIKDLTVAGVEFNV
FT                   TKPENYQLLGLLMSWVFPLILIFFVGRMMFSKMNNKMGGGVMSFGKNNAKLYAENETGI
FT                   TFKDVAGQDEAKESLVEIVDFLHDTRKYVEIGAKLPKGALLVGPPGTGKTLLAKAVAGE
FT                   AKVPFFSMSGSDFVEMFVGMGAARVRDLFKQAEEKAPCIVFIDEIDAIGKSRDGAIQGN
FT                   DEREQTLNQLLTEMDGFDSSKGVVILAATNRPEVLDKALLRPGRFDRRIIVDRPDLIGR
FT                   EEILKVHSRDVKLSDDVSLEEIAKSTPGAVGADLANIVNEAALRAVKHGRKFVIQEDLD
FT                   EAVEVIIAGQEKRDRILSPKEKKIVAYHEVGHALVAALLNNTDPVHKITIVPRTMGALG
FT                   YTMQLPEEEKYLVSKEEMIDQISVMLGGRAAEEVVFNSITTGASNDIERATQSARNMIT
FT                   IYGMSERFDMMALEAMSNRYLDGRPVRNCSETTAAIADEEVLQVIKKAHEKSIKILIEN
FT                   RELLDEITGVLLDKETIMGDEFMEIVYGKYPEKREADEKAKKEIQSLREQALAKRKEKE
FT                   EAIKKAREEALRLEEEQRKQDELKAMIEAQEEAAKLARANNEANNDALDSSKENEEVKS
FT                   NVNDGATEEKKDDSSTNNKVDGE"
FT   gene            695386..697506
FT                   /locus_tag="CPF_0580"
FT   CDS_pept        695386..697506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABR36889.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82445"
FT                   /db_xref="GOA:A0A0H2YPL6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPL6"
FT                   /protein_id="ABG82445.1"
FT                   /translation="MTDKKDIEFLVEEKKLEEVSNILNEEMLSYINKRKFVTQYILDYR
FT                   KNAVEEYKDDEDKLIEYFDHERYVKEQAFTTIDKKLKELTILKESPYFGRVTFNDLEFD
FT                   QKDTLYVGRFGVTPEGSYEPVIVDWRAPVASLFYHGSLGEASYTSPDGPIKCDIEGRRQ
FT                   IIVKKGELKGVFDSAIDVKDDILQMVLSNNSSDKLKDVIMTIQQEQDEIIRKERTSNIV
FT                   VNGVAGSGKTTIALHRVAYLLYNYRKELEDKVLILGPNGIFMEYISQVLPSLGEVGVKQ
FT                   ETFASFALKEMDSELYIMSFDKYLEKILSEDKEFIEDAKYKNSYEIIKDLDNLVKEMDK
FT                   DYFHVEDVKYFGDLVISKEEIEEMFNKHYEYMPLFRRSEKIKRIILSKIKDKRDEKVWE
FT                   LNEELRKEKEKLTPEELLIEENNLEFRRKLRIREIVKEVMDSRAKLDSWISREDVLDIY
FT                   DRFNGNKKEYTINDLAPILYLAIKLEGKKATKDYRHVVIDEAQDYSPLQFKVVRELTGT
FT                   KYFTVVGDVNQRLIKYSDLAPMMELGKIFDDVNPDIYNLNKSYRSTYEIMEYANKYLDE
FT                   DRIIPIVRHGKPVEEIEFHNDEELSESIIESLKEFSNEGLESIAIITRDKEELEKVYNL
FT                   ISNKVHLVKFDNEDVLYKGGNVIIPSYFAKGLEFDGVIIVDNGSLKDENEDLIKYIMST
FT                   RALHRLKEIQFK"
FT   gene            697962..698798
FT                   /locus_tag="CPF_0581"
FT   CDS_pept        697962..698798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0581"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83818"
FT                   /db_xref="GOA:A0A0H2YST6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YST6"
FT                   /protein_id="ABG83818.1"
FT                   /translation="MKKNIFKKILSVAMIGGLTLSLAGCGAKTAKENGSNDKVAKIKES
FT                   GKLVVGLSADYAPYEFHIIKDGKDQIVGLDIDIAKEVAKNLGVDLEIKEMEFGAIIQSV
FT                   KNGMIDMGISGITPDEKRKEAVDFSDIYYEAEQGILINKDNKESIKGIGDLKGKKVGAQ
FT                   MGSIQAEIAKGIEGADVKLLDNVNTLILELKTGKLDAVITELPVAKIASEVNSELAVAD
FT                   EVIKNSEGGSAIAIQKGNKDLVDEVNSTIKELKESGKIDQFTNDAIELVPYQKKEE"
FT   gene            698829..699500
FT                   /locus_tag="CPF_0582"
FT   CDS_pept        698829..699500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0582"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84097"
FT                   /db_xref="GOA:A0A0H2YU65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU65"
FT                   /protein_id="ABG84097.1"
FT                   /translation="MGGLDFSFLKEYFPVFLEGAKWTLIISAITVILGALLGTILCFMK
FT                   RSKFSIFKVKILRVISTAYVEVIRGTPLLLQIYIVYFGLPSFGIQLEVLPSCIIAISLN
FT                   SAAYVSEIIRAGIDAVDKGQLEAARSLGMAEGMAMRLIILPQAIKNILPAIGNEFVAII
FT                   KESSMASTIGVAELMYSSKIVTGATYKGFEPLIVIAMFYFVMTFSLGRVMSYVEKRLSK
FT                   S"
FT   gene            699497..700219
FT                   /locus_tag="CPF_0583"
FT   CDS_pept        699497..700219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0583"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82827"
FT                   /db_xref="GOA:A0A0H2YPN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPN7"
FT                   /protein_id="ABG82827.1"
FT                   /translation="MINVRNLYKSFGKNEVLKDINETIKKGEVVVIIGPSGSGKSTFLR
FT                   CLNLLEEPTSGVINFEGEDITDKNVDINKIREKMGMVFQQFNLFPHKTVMENLTIGPTK
FT                   IKNISNGDAVKKGSELLEKVGLLDKKNVYPNSLSGGQKQRIAIARALAMEPDVMLFDEP
FT                   TSALDPEMVGEVLGVMKSLAKDGMTMVVVTHEMGFAKEVGDRILFMDEGRIIEEGTPEE
FT                   IFQNPKNSRTKDFLSKVL"
FT   gene            700437..702245
FT                   /locus_tag="CPF_0584"
FT   CDS_pept        700437..702245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0584"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84334"
FT                   /db_xref="GOA:A0A0H2YU49"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU49"
FT                   /protein_id="ABG84334.1"
FT                   /translation="MKEKVKSFFKCNWVFIFLVITLQIKSMLLLSMLRTPGSRGINFDL
FT                   MYFTPPAWWAHIAIVTLIASFVYLFKGKGRMWAGIVIDILVTILFVADIWYYRVNGTFL
FT                   SIRHIIEPGIFNPVGKSLFNLAKVDVVFIVDFIILFLVYNFTGLKNVKYKNNIKTRLIA
FT                   FICLFGISATVIGVSHYYIDIQRKSDKSFLRISWAPFQTISDSSPLGYHGYDIYYYANR
FT                   KETLTDAQKNEIKTWFDENKEDLPDNKYKGMLQGKNVIALQVESLENFVIGKKVYGQEI
FT                   TPNINKLLKNSLYFDNIKEQNNSGTSSDCDIMVNTSILPVREGTTVFGYPWAEYNTLQK
FT                   ILKSKGYSTVSTHPEVPGNWNWAEVHKAFKADEIWDAHQFDQSEIIGLGMSDESYLRQV
FT                   GERLKSQKQPFYTFLVTLTSHGPFDMPKDKQYLNLPEDLNENMLGAYFQSVRYTDEAIG
FT                   EFINQLKEEGLLDNTVIMIYGDHGGVHKFYEDKIKDAPLEGDWWKDDEKEIPFLIYNPS
FT                   INGETISKEGGQIDFLPTIAYLLGFNRDTFDSTAMGRVLVNTNRNASILNNGEIVGNPT
FT                   PEEKAHLEKSFNIADMIIQGNYFKNN"
FT   gene            702497..704341
FT                   /locus_tag="CPF_0585"
FT   CDS_pept        702497..704341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0585"
FT                   /product="sulfatase domain protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83506"
FT                   /db_xref="GOA:A0A0H2YRA1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRA1"
FT                   /protein_id="ABG83506.1"
FT                   /translation="MAKSNGLLSKIGGFFKKFPLEILFYILLVFKITVFCTMLKSNSGM
FT                   ELNLGFVYGLIDYKIIYLLFPLIFISFGFLFKRWGKFIYLYIVDLGISALLIFDLLYYR
FT                   LYGTFPSIKFLIYPDLFNPLNKDLIFFRSRMLLFIIDLVLLPILYILFRKYTKDWYFGK
FT                   VKYRVIAFLLTFLVPSGCVLGKYYLYDVKDITNGEKGFLRVAWTPTSGIFRATPLGYHF
FT                   FDIYKTLVLDKDIKLSNEEKQEVKNWLDANYENLPDNQYKGELKGKNLVVLQIESLEDF
FT                   VINKKIDGQEITPTLNSILKNSYYFPNIYEENLTGFSSDADLMVNTGMLPITNTATSFA
FT                   YPSRTLTTLPSILEKNGYTTVSAHPEVAGSWNWGEVHHSLLKFQNSYTLYDFNEDEIIG
FT                   LGISDKSYLTQLATKAGDLKQPFYLFTVTLTNHGPFEIDDAHTTIKIPSEIEGTLIGQY
FT                   FKTVRYTDEAIKMFMDKLKEEGRFDDTVFVIYGDHAGPNKYYKDQLKDVNFDGNYWKLN
FT                   EKKVPLIIYNPSIQGKTIETKGGLIDVMPTVSYLLGVNDGSLRNVIGRNLLNTNRNIVA
FT                   LPGGEVVGEAKSQDELNHVKQSYDISTKIIRSDYFKNN"
FT   gene            complement(704443..705624)
FT                   /locus_tag="CPF_0586"
FT   CDS_pept        complement(704443..705624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0586"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82319"
FT                   /db_xref="GOA:A0A0H2YND7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YND7"
FT                   /protein_id="ABG82319.1"
FT                   /translation="MFSNLIIKTFIKDYKNTENESVRSSYGYLASIVGIIVNIILFLIK
FT                   FSVGLISASIAITADAFNNLSDAGSSVITMIGFKLAKMPADKEHPFGHGRIEYISALIV
FT                   AFMVMLVGFQFTKSSIERILNPTPVTFEVIPFILLVVSIFFKFWLSRFNKLTGNRINSS
FT                   ALKAASVDALGDVFTSTCVVISFLAAKFTTFPIDGYIGVIVSLAILYAGFTLVKETINP
FT                   LLGEAPDPELAKNIREMVLSYDHIIGVHDLIIHNYGVGKCMASIHAEIPSDINVMKIHD
FT                   IIDMAEREISNKLKIYLVIHMDPICLEDGEIKQAKEEIDKIIKYNPLIESMHDFRIVGH
FT                   GNKKNLIFDIVVNPEKLRKVMSESELKEEIIKAVKETHPQYNCIITIDKDFTC"
FT   gene            705867..707528
FT                   /locus_tag="CPF_0587"
FT   CDS_pept        705867..707528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0587"
FT                   /product="putative enterotoxin, EntD"
FT                   /note="identified by similarity to GB:AAP08924.1; match to
FT                   protein family HMM PF00018; match to protein family HMM
FT                   PF01510; match to protein family HMM PF06347; match to
FT                   protein family HMM PF07653; match to protein family HMM
FT                   PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83751"
FT                   /db_xref="GOA:A0A0H2YTA8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTA8"
FT                   /protein_id="ABG83751.1"
FT                   /translation="MNRRKISALLLSCTLAMNISSFNEIVLADENKGEEVQKESHNESN
FT                   CIAGDYHEVNNGNAKNTENTPVINGIKVNKQLIDINYSQGITINPKYIVIHDTDNRQAG
FT                   ANAMANRNYFANHPNAKASVHYIIDEGNIIQALEDTWKGWHVGDGNNPNINNSTTIAIE
FT                   LCVNKGNDFDKTLENGIELTKYLMNKYNIPAENVVMHRDASGKTCSRMMIEDRPSLWPY
FT                   FKDRISGGDGSLEDDGLKPKMQGKVTNASVLNVRESPSTSGRIVHKLNRNQVVGIYEEL
FT                   NGWYKIDYIDGVKKKYGYVSKDYISIINENPEDEETNGDIEIEKPSVSVNKKGIVKVNS
FT                   ALNMRSGPGSNYGVIGTLRNNDEVEIIKEVDGWYEIKFNGKSGYVSSQYIKVVDNESNE
FT                   EKPVEPEKPSVSVNKQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEI
FT                   RFNGKVGYASKSYITIVNEGSNNGTDSVIKEGTVYGVSTNLNVRTGPGTSYQVIGYLLS
FT                   GDKVKILEEENGWYKVQFNASTGTKNGYVSKDYIKV"
FT   gene            707670..708965
FT                   /locus_tag="CPF_0588"
FT   CDS_pept        707670..708965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0588"
FT                   /product="zinc metalloprotease, aminopeptidase I family"
FT                   /note="identified by match to protein family HMM PF02127"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84682"
FT                   /db_xref="GOA:A0A0H2YUF0"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUF0"
FT                   /protein_id="ABG84682.1"
FT                   /translation="MEKVIANELINFLYESPTAFHAVKNVKDTLEFEGFKELKEADRWN
FT                   LEVEGKYFVSKNDSALIAFRVGKGDIAENGFKIIGAHTDSPGFRIKPNPEITVENTYVK
FT                   LNTEVYGGPILNTWFDRPLALAGRVSLVSKNPLKPVNKIVNINRPILIIPNLAIHMNRE
FT                   VNEGYKINRQKDTLPLLSLVNETLEKGNYLVELLAKELYCEKEDILDFELYPYEYEKGC
FT                   LMGLNEEFISSGRLDDLSMVHAGIKALMDAEVSQATNVMVCFDNEEVGSATKQGGDSDF
FT                   LKTILERIVLALGKDREDFLRSLSESFMISADLAHAVHPNLGEKHDPVVRPVLGKGPVI
FT                   KIAASQSYTSDSDSSAVYEMICRNAGVNVQKFVNRSDMRGGSTIGPISSTHLPIRSVDM
FT                   GTPILAMHSIREFGAVKDHFDCIKSFTEFFRI"
FT   gene            complement(709058..709252)
FT                   /locus_tag="CPF_0589"
FT   CDS_pept        complement(709058..709252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E96976"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNY2"
FT                   /protein_id="ABG82438.1"
FT                   /translation="MSKKYPPRDRDFYSPEKHDLVSYSKTGKTYTKLPNPLEDDIVCNN
FT                   ISYSEFDYIEGDMLDDDDI"
FT   gene            709644..710483
FT                   /locus_tag="CPF_0590"
FT   CDS_pept        709644..710483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0590"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82686"
FT                   /db_xref="GOA:A0A0H2YQ37"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ37"
FT                   /protein_id="ABG82686.1"
FT                   /translation="MSYKLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGR
FT                   LFASAKYYAGLLGVKTPIISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINM
FT                   AYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFKEAFKTYGKHILKAIC
FT                   IENDSNKLEDLFKAKEELKKYEDLEVVSSSPSNFEVMNKGTSKGRAVKVLADILNINRE
FT                   EIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDTNENDGVAKAIEKFVLD"
FT   gene            complement(710691..714020)
FT                   /locus_tag="CPF_0591"
FT   CDS_pept        complement(710691..714020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0591"
FT                   /product="membrane protein, MmpL family"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84184"
FT                   /db_xref="GOA:A0A0H2YT50"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT50"
FT                   /protein_id="ABG84184.1"
FT                   /translation="MKDNILKKIKLNKPLSFFILIIWCAVVAFLFLTAPSLSKLVSEKG
FT                   GIQLPDDYSSKISDILQSDNKFNSKDSYIAVFHSSNKLTDENLKNIKDTIDRLKSKENS
FT                   DYIQSINDSFDTPQLKNQLNSENGKTIIALMTVNPKDSSVSTIEKTLNDELKTPGVETY
FT                   VTGQSLIENDVNVAAQKGLNKTQTITVIFIFIVLILLFKSVVTPFIPLLTVGISYLGAQ
FT                   SVVGILADKFNFPLSNYTQIFMICIMFGIGTDYSILLLNRFKEELANGNNRLDSVKITF
FT                   KTAGKTVLSSATPVFVVFASLNFIGFNLYRSAVAVAIGILFLIAALFTIFPAVMIILGK
FT                   NIFWPVKGTFKAEENRLWAKLANKAFSKPIPILGAIFTILLLPILFNNFHQSFNNLNEI
FT                   GDTYSAKEGFNIIADDFGIGQASPVSIYIENDDDMRKPEYVALIEKLSNNLQNSSNDIK
FT                   SVLSVTRPTGVRLDEIYVNDQAGQVSQGIDKANNGLNKINDGLSDASKKIDSSKSKLKG
FT                   AEEGTAKLQEGTKKTETGVSELQSALNKLVESIREEHNGATELKDSIDGALNKVNSLKL
FT                   SKSQLEEDYSAIVNSANDVLDNLNKIGSLTGNPNSVNVDTSKLKESLSSLNSHLSEYSK
FT                   SHPEVLNDENFKKFSDDINNLNNNSNNLQGTFNNTPEIKAINESIGALKVLINTLNSKK
FT                   DTVINDLDKFNSGISEIENGLKALDSGLGKSLAGGEEISSKVPEISNALNQIANGQSKI
FT                   QDGFKEFSGQINELSNGLEAGSNGLTEIQNGLKYANGFINDWSNLSYNLSGICVPIEVF
FT                   SNDEFKKSLNQYMSSDGKLAVINVITTKNPYSNEAVNEIPNLKSLVQDGVKGTKLENAN
FT                   IGIGGMASTTYETKRMADSDYDKALIFVIVGVFITLIIILRSLTMPIYLMISLLLTYFT
FT                   SISVIQFVVTKIMGYPGISWITSFFGFVVLMALGIDYSIFIMTRFNQDLNGSIKERIIR
FT                   TMKSMGGVIISAVIILSGTFAALLPSGVLSLIEISMVVLTGILLYVVFVLPLFIPAMVK
FT                   IFGRANWWPFKPALSKEDKALDDSTTIVTTVVTTTTTTTTTTKNGSSTITKKESKTTTT
FT                   KE"
FT   gene            complement(714281..715876)
FT                   /gene="prfC"
FT                   /locus_tag="CPF_0592"
FT   CDS_pept        complement(714281..715876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="CPF_0592"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84826"
FT                   /db_xref="GOA:A0A0H2YVB9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVB9"
FT                   /protein_id="ABG84826.1"
FT                   /translation="MSDLIKEIEKRRTFAIISHPDAGKTTLTEKFLLYGGAIRMAGSVK
FT                   ARKAATHAVSDWMEIEKQRGISVTSSVMQFNYGGYCINILDTPGHQDFSEDTYRTLMAA
FT                   DSAVMVIDGAKGVEDQTRKLFQVASLREIPIFTFVNKMDRETRDPFQLLEDIESELGIK
FT                   SYPMNWPIGCGSHFKGVYDRATNTIHLFDGGNHGQSEVSTITGDLEDPKFKELLGEDLH
FT                   NKLMEDVELLDIAGDEFDLEKVRKGELTPVFFGSALTNFGVEPFLNDFLKLTTSPLPRN
FT                   SSIGEIDPMTEPFSAFVFKIQANMNKAHRDRLAFMRICSGKFEKGKDVFHVQGGKKVKL
FT                   AQPQQFLAQDREVVEEAYAGDIIGVFDPGIFSIGDTLCLNPKKFKFEGIPTFAPEHFAR
FT                   VKPVDTMKRKQFIKGVTQIAQEGAIQVFKELHIGMEEIIVGVVGVLQFEVLEYRLKNEY
FT                   NVDIKMERLPFRYVRWIENDNIDVDSLNLTSDTKKVKDFKDRNLLIFQNDWGISWAIDH
FT                   NPGIILSGVGKSND"
FT   gene            complement(716090..716695)
FT                   /locus_tag="CPF_0593"
FT   CDS_pept        complement(716090..716695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0593"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQK9"
FT                   /protein_id="ABG82862.1"
FT                   /translation="MPVRIAILGGPRCGKTTLIQQLYVEFKIRGLDVGAATEYSTEYLK
FT                   EKGMIETISEQYGIYLGQLRLEESLNQFDYALTDYATFVPYIYGRFMLGDKKRSEKEIE
FT                   ILKDLYHLALKDLQKYDHIFFVPREFGYTQDGVRWQDESTASAVDNALKQFLDSENVKY
FT                   TTIEGSTKDRAKQILSIVGLDNKDALPTMRELKKKNSK"
FT   gene            717071..717871
FT                   /locus_tag="CPF_0594"
FT   CDS_pept        717071..717871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0594"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82934"
FT                   /db_xref="GOA:A0A0H2YQ48"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ48"
FT                   /protein_id="ABG82934.1"
FT                   /translation="MYKLVAIDMDGTLLKEDKTVSEKTKEAIKKAREKNVKVVLATGRP
FT                   VDGVKRYLEELDLCHDDEYVLTFNGAIVKEVGPDRVICRDTLKGSDLKYLYEISKNVGV
FT                   NIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNDIKEDEEIIKIMMIDEPEVLEEG
FT                   IKKLPEEVYEKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDL
FT                   HMIEYAGLGVAMGNAFEEVKEKADFITKSNEEDGVAFVFEKFVL"
FT   gene            717912..718574
FT                   /locus_tag="CPF_0595"
FT   CDS_pept        717912..718574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0595"
FT                   /product="bacterial sugar transferase family protein"
FT                   /note="identified by similarity to GB:AAD22526.1; match to
FT                   protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84443"
FT                   /db_xref="GOA:A0A0H2YTN8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTN8"
FT                   /protein_id="ABG84443.1"
FT                   /translation="MQNINDIPIKSECSKEKSYLFYNVAKRCFDLICSLIALILFSPIF
FT                   LILYIWVKVDSKGPAFFGHKRIGKDRKYIDVYKFRSMVSNAKEVFDNFTPEQKAEFEKN
FT                   FKLDDDPRITKCGAFLRKTSLDELPQLINIIKGDMSIVGPRPIVDKEVEKYGEYADKLF
FT                   SVTPGLTGYWQANGRSDTTYEERVQMDMYYIDNRSLWLDIKIIFKTVISVIKKEGAV"
FT   gene            718575..719489
FT                   /locus_tag="CPF_0596"
FT   CDS_pept        718575..719489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0596"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84032"
FT                   /db_xref="GOA:A0A0H2YSL9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSL9"
FT                   /protein_id="ABG84032.1"
FT                   /translation="MKISIICPLYNAENYIMSLHNKILEQEKPEGTEVEVSYVLTRCKD
FT                   KTEEMLKNMNLQYTLIEPKDFSHSKTREMMAFKSTGDIIVFISQDVMMKNNFWLKNLVQ
FT                   PIIDGECEASFSRQLCTNNTIEKYIREKNYPEESRVVSKKDINKYGLLTFFYSDASSAV
FT                   KTSVYKELNGYDNKRLLINEDMYFAEKLIQAGYRIKYCSDSEVYHSHVFTLKSLYERYF
FT                   DTGVFFRQNSQFLNYKGNKSGKDLAIHVLKRSLEDKNFKVTLNILPNFGARFIGSFLGK
FT                   KYESLPRSFVMASSMSKKVYSQI"
FT   gene            719512..720393
FT                   /gene="rfbA"
FT                   /locus_tag="CPF_0597"
FT   CDS_pept        719512..720393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="CPF_0597"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by similarity to SP:P55254; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83684"
FT                   /db_xref="GOA:A0A0H2YRN9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRN9"
FT                   /protein_id="ABG83684.1"
FT                   /translation="MKGIILAGGSGTRLYPVTKAMSKQMVPIYDKPMIYYPMSVLMLAG
FT                   IREVLIISTERDLPNFKELFKDGSELGLNIEYKVQEAPNGLAEAFIIGEEFIGDDNVAM
FT                   ILGDNIFYGQNFSSNLKEAAALEKGAMVFGYYVQDPKAFGVVEFDENGKVISLEEKPEH
FT                   PKSKYAVPGLYFYDNTVIEKAKGLKPSARGELEITDLNRLYMEEGTLKVNLFGRGMAWL
FT                   DTGTHASMLQASNFVEAVQNTQGTYIACLEEIAYRKGWISSEKVLNLAKPLMKTGYGKY
FT                   LVDIVEELEQKK"
FT   gene            720499..721068
FT                   /gene="rfbC"
FT                   /locus_tag="CPF_0598"
FT   CDS_pept        720499..721068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="CPF_0598"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by similarity to SP:P37780; match to
FT                   protein family HMM PF00908; match to protein family HMM
FT                   TIGR01221"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83267"
FT                   /db_xref="GOA:A0A0H2YRI0"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRI0"
FT                   /protein_id="ABG83267.1"
FT                   /translation="MSNFKFIETKIKDLYIIEPKVFGDERGYFMETYSQKAFEEAGLTM
FT                   KFVQDNESKSKKGVLRGLHFQTKHTQGKLVRVTQGEVWDVAVDLRKGSPTFGQWEGVHL
FT                   SAENKRQFYVPEGFAHGFVVLSDEAVFNYKCTDFYAPEYDSGLLWNDKYVNVEWPLEGI
FT                   EEIILSEKDKKQKTLKELDIPFIYEG"
FT   gene            721082..721966
FT                   /gene="rfbD"
FT                   /locus_tag="CPF_0599"
FT   CDS_pept        721082..721966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="CPF_0599"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by similarity to GB:BAA21509.1; match to
FT                   protein family HMM PF01073; match to protein family HMM
FT                   PF01370; match to protein family HMM PF02719; match to
FT                   protein family HMM PF04321; match to protein family HMM
FT                   PF07993; match to protein family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84493"
FT                   /db_xref="GOA:A0A0H2YUI0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUI0"
FT                   /protein_id="ABG84493.1"
FT                   /translation="MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVD
FT                   KLDITSLENVKNVLNEEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEI
FT                   GAKLVQVSTDYVFSGFGEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWL
FT                   YGYVGHNFVYTMMRLGKEKESLNVVNDQKGNPTHANDLAYHILKLIETEEYGIYHCTGK
FT                   GECTWYDFAKEIMELAGNKCIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWK
FT                   EALKSFFENQQNQ"
FT   gene            721994..723043
FT                   /gene="rfbB"
FT                   /locus_tag="CPF_0600"
FT   CDS_pept        721994..723043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="CPF_0600"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by similarity to SP:P55295; match to
FT                   protein family HMM PF01073; match to protein family HMM
FT                   PF01370; match to protein family HMM PF02719; match to
FT                   protein family HMM PF04321; match to protein family HMM
FT                   PF07993; match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83717"
FT                   /db_xref="GOA:A0A0H2YT79"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YT79"
FT                   /protein_id="ABG83717.1"
FT                   /translation="MKTYLVTGGAGFIGSNFVLYMLKKYKDIKIINLDKLTYAGNLENL
FT                   KSIENDERHIFVQGDICDKELVSSLFEKYEIDYVAHFAAESHVDRSIREPEVFAKTNVL
FT                   GTVNLLNCAKNAWETEEGWKEGVKFLHVSTDEVYGSLGETGYFMETTPLDPHSPYSSSK
FT                   ASSDLMVKAYADTYKMPVNITRCSNNYGPFQFPEKLIPLLINNCLNHKDLPVYGDGMNI
FT                   RDWLFVEDHAKAIDMVINGGRLGEVYNVGGHNERTNIQIVKTVIEYLHDNVDEEITENL
FT                   IKYVEDRKGHDRRYGIDPTKIKEELGWYPETTFEVGIKKTIKWYLDNKEWMENVTSGDY
FT                   QKYYEKMYR"
FT   gene            723068..724282
FT                   /locus_tag="CPF_0601"
FT   CDS_pept        723068..724282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0601"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83586"
FT                   /db_xref="GOA:A0A0H2YRF2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRF2"
FT                   /protein_id="ABG83586.1"
FT                   /translation="MNLRNKSNTKYELFIYFVLFSIFIRDFKIYIPLFVLNILYVIYLI
FT                   FKKEIHINLKKWNITLALFIIWTVINTIIASFIFKHPVYYSNVIKLLLNMSFLLSTYFV
FT                   VDGTNMKFHKKTLVRFLEFIILINFIQIIYIYFDGKLFNDFFSGALTESSDAAYTISSY
FT                   HNIIGAENKNIWATKFALIYMIYLYICAFDNFNINLIEKISFIILGIVTVVLLLSRTAQ
FT                   VAIIIPIVFLAFYSMRNLNYKYRIGIYAVSGILFLGALFVFFDKFFHLEFNMTDGGFTR
FT                   LYIWKEFIISVFDTHFIVGNGIGYSAYFIQDILGRFESNLHNVFLNIFFELGIIGIVLY
FT                   ITFIIQFFKDFITRKNILKNLFMIIFPMLAIVCLQYLGYDNDLVVTLTLLIIINMIMKK
FT                   DEQRI"
FT   gene            724279..725127
FT                   /locus_tag="CPF_0602"
FT   CDS_pept        724279..725127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0602"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82783"
FT                   /db_xref="GOA:A0A0H2YPC4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YPC4"
FT                   /protein_id="ABG82783.1"
FT                   /translation="MIRKFSLIMATYGRKDEVGCFLESLMNSNYPMDKVEVIIVDQNKE
FT                   IDLEPIISKYKEKIKVVHIKSNERGLALNRNKGLEIATGDIIAFPDDDCEYLVDTLNIV
FT                   NNYFENEHCDLLMGRIVERNGEDSLREWPKEKIEINKNNFYTKCSSVTMFLDSKKCFVK
FT                   FNDQLGAGKYFGACEDADLIYKNCKKGLKIIYNPELQIYHPHYDSNSNMDDKKIYSYGL
FT                   GFGAMVKSNFDFSMLILFIKAEGYHFLKSLIYLITFKTTKSKRSWLAFKSRIKGFFEYK
FT                   N"
FT   gene            725221..725961
FT                   /locus_tag="CPF_0603"
FT   CDS_pept        725221..725961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0603"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:BAA32000.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84308"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YTG7"
FT                   /protein_id="ABG84308.1"
FT                   /translation="MSKVKRKLKNIVRNIMLSETFANTNLVKNMRKNHKEKLEEGRRVL
FT                   FKEHAKDCLETIKENLDKNNLHFWLDYGTLLGAMREKDFIAHDLDIDLGMFYENQVEEV
FT                   EKAFKEANIKKVREFTLDGKVVEQTYSYKGLYFDIFYYFKDENLMWTYGFTFKNNKLNK
FT                   VSYKDKDVSTGFEGMKYFVKKRGLEKIMFKGKEYTVPENPDGYLRENYGPNYMTPIKEW
FT                   DYVEAPTNQEKLKGGDIVMIEYYN"
FT   gene            725970..727421
FT                   /locus_tag="CPF_0604"
FT   CDS_pept        725970..727421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0604"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by similarity to GB:AAK68914.1; match to
FT                   protein family HMM PF01554; match to protein family HMM
FT                   PF01943; match to protein family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83468"
FT                   /db_xref="GOA:A0A0H2YS07"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YS07"
FT                   /protein_id="ABG83468.1"
FT                   /translation="MSKSISKNIIFKFLLNIFNVVVPIIIGPYVLRVLGPDLMGTINFS
FT                   QTIYGYFFIFAGFGVYQYGLREISRVRDDKKKLSQVYTSLFTLTFITNILTTIGYVLFV
FT                   QFNYSGTEIYVACMILTFNLLANIFYTEWVNEGLENYDFITIKTIIIRIVYVVFLFILV
FT                   RSANDLKEYMILLVLSTFLNNIVSFIYIRKRIPFDFSDLKLLRHIKPMFLVVILSNANV
FT                   LYTQLDRYFIGEYINMDSVAYYTTAQNISNIINTLLLTVIYATIPRMSNYIANENHDEY
FT                   KGLLDKISKMYFIVLFPAAIGMLVLAKEVILIYGGSKYLDAIPMLKVFAIYIITLGFET
FT                   ILSNQVMYIRGKEKEQVKITFIGGAVNLILNVTLLWTGYFNGTNAVITTMLANIVVIIL
FT                   EYLYIKFVMNLDFNIFSLDKMKYLAISLLFIPITYFIGKFISGVILFTLAVMIINPLVY
FT                   FLILLVIKDDCLLEIINKFTKKLKR"
FT   gene            727443..729866
FT                   /locus_tag="CPF_0605"
FT   CDS_pept        727443..729866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0605"
FT                   /product="cell wall binding repeat
FT                   protein/mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase domain protein"
FT                   /note="identified by similarity to GB:AAF73795.1; match to
FT                   protein family HMM PF01473; match to protein family HMM
FT                   PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83023"
FT                   /db_xref="GOA:A0A0H2YQ68"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ68"
FT                   /protein_id="ABG83023.1"
FT                   /translation="MIKKFILATVITLSVTSINVLASENVNDKSDENKSSTLVGETYEI
FT                   VKEPNMFFSIPGDNVESYKDENGIEREEFKKDKEGQESINRLVTKTKSKYEIALAHENG
FT                   KYTFLDSANTKEEAEKKVENASEKYNTFAAMPVVLNDSGQVAYSEKSMGRLVKYKNGSP
FT                   AGYGEITNIYANPNLTNDFTYINHGYVDDVPIIEDRGNVAKIEVGGYEGWVNKDTSSGN
FT                   YDLVIVPLNQVKNPSYYIVRDGELIHYISSDLTNYSEGGYEVVIGPAPNFLSENVKYYS
FT                   YDNKYFYKDLSTLIGDLQNDNHNNSVNANNPFYPYYMHLPFRSKTTFTAEELNNFIAKK
FT                   TKSYSKLRGTGQAFIDAQNKYGANALLLLGLAANESAWGTSQIAQQKNNLFGINAIDSS
FT                   PGASANSFETVEGCINDFAKYYISRGYSDPEDWRYFGGYLGNKGSGANVKYASDPFWGE
FT                   KAGQNAYIADYWTSGKGIAGLKDYNYYQLGIYTGASSVTNKDNEKLYDVGSLYTERVEK
FT                   IGATTILTSKEKINHNGKECYEINPVRTTPVISNGSPVAFPGPYDWNDKGFVDASKVKL
FT                   INEGKYSENVMGKWELNNGIWYYYIDGKYVTGWNNIDNNKYYFDQSGKMQTGWLCIDNI
FT                   WYHFRDNGTIDIGWREIDGYWYYFNNDGEMQKGWQTIGKYKYYFNDNGVMNIGWRKIDN
FT                   IWYYFNINGEMQTGWLFENNIWYHFETTGSMTVGWKKINNDWYYFNSNGEMQTGWQNIG
FT                   TPKYHFRDNGVMDIGWREIDGQWHYFNENGEMQTGWQYINGNSYYFDEKGIWKQ"
FT   gene            729995..731647
FT                   /locus_tag="CPF_0606"
FT   CDS_pept        729995..731647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0606"
FT                   /product="cell wall binding repeat protein/zinc
FT                   carboxypeptidase family"
FT                   /note="identified by match to protein family HMM PF00246;
FT                   match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83650"
FT                   /db_xref="GOA:A0A0H2YRS9"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRS9"
FT                   /protein_id="ABG83650.1"
FT                   /translation="MKRKSIALVLSLGLLGSVTLGSIETVYAEGNKNTTNISEVKVDNK
FT                   VELSDKKNKEIKNGWEIINDKWYYHESDGSLATGFKKINDEWYRFDNNGEMQVGWQYIN
FT                   DIWYHFRDNGPMDTGWRKINNDWYYFNNDGEMQTGWQSIGNKRYHFRDNGVMDTGWRSL
FT                   GSDWYLLNSDGEMQTGWQHINNIWYHLEDDGKMNTGWQDINGDKYYFNNSGEMQTGWQY
FT                   INDIWYHLRENGPADTGWRKINNDWYYFDNIGKMQTSWQDIDNSTYYFNDNGVMSIGWR
FT                   TIESEWYYFNNSGEKESNKVIDDWYLDKNGVGNKIVTEGVYGKSGKGRDLEYYRIGHGK
FT                   KVLFSVFGVHGYEDAWSGDSQELKIIAEKSVNRLRSEYNTKGIDLSEWSVYIIPSANPD
FT                   GRIDGWTNNGPGRTTVTTKNDINRSFPTGFSPFYSARNYTGPTALGSPEAKALYSFINK
FT                   TMEGATEKVLLDVHGWENKTIGNPSIARYFDNEFGFRNINKYPGGFVITYGNAIGAKSV
FT                   LVEFPVPYSHQDILRRDFSGKFANGLVNILLNN"
FT   gene            731849..733213
FT                   /locus_tag="CPF_0607"
FT   CDS_pept        731849..733213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0607"
FT                   /product="cell wall binding repeat protein"
FT                   /note="identified by similarity to PIR:A41971; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84914"
FT                   /db_xref="GOA:A0A0H2YUZ8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUZ8"
FT                   /protein_id="ABG84914.1"
FT                   /translation="MKFTKRKIKLFSLTCAITTLCSGFVLGENVQAANNKEWKFENNKW
FT                   SYVDSNNLRSKDWENIKGDWFYFNSKGEMEIGWKYINKTWYHLRENGVMDTGWRKINGD
FT                   WYYFNNSGSMMTGWQNINGSWYHLRDNGVVDIGWRELGGAWYHLNESGAMENGWKYINN
FT                   EWYHLNENGPMDIGWKKINNDWYYFNNNGEMKIGWQNINDTWYHLKENGVMDTKWNKIN
FT                   DYWYYFNYDGKMINNQYIDGWRIDNNGVAHYEKAFRNPKLENSNQIIVVTTNNMSTSYC
FT                   NIEIYEKNDSGEWNNIDSTTGRVGANGLAYIENRVQSTNTTPAGVMSITGAFGVKNNPG
FT                   TKLDYIKVNNNMYWDLNSENSTYNRLINYNPGGDYEHLISYPRQYEYSLITDYNHNQVP
FT                   NKGGAIFVHCLGRGATGGCVSMPREKMIEILKWIDPKKNPKILVIPKDDLDDYWY"
FT   gene            733418..735286
FT                   /locus_tag="CPF_0608"
FT   CDS_pept        733418..735286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0608"
FT                   /product="transcriptional regulator, MarR
FT                   family/choline/ethanolamine kinase"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01633; match to protein
FT                   family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82463"
FT                   /db_xref="GOA:A0A0H2YQ35"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017190"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ35"
FT                   /protein_id="ABG82463.1"
FT                   /translation="MLSYDIEVLKIINDEYNISQRRLAEMLNISLGKINSLLKELLTKE
FT                   YIVKIDIDKRNVKYELTEAGIALLENSLDKVKSTKLSIHKHKYHKVKQAVILGAGGKGD
FT                   FGKPSGFLELEEFRIIDRIIDILKSNGIEKIVIVNGYKKEYYEELAEKDSTIFCVTNSN
FT                   YKWTGTMSSLALAKEYIDDDFILVENDLVFESRAVEQIIKNDNRDCVLITNESGSGDEA
FT                   FVEIRDGYLFKMSKDVHQFNKIDGEMIGISKISYKLFKMMLEEFKHNINPYINYEYTML
FT                   DVARNYKVGYEKINDLVWGEIDNKDQYEKVKKHIIPMIRRKEMQYKIDQVKSAIVNGLK
FT                   VSEEEVKEIVPVGGMTNKNYKAFVNDKAYIVRIPGLGTSSMINRRDEMINSKLAADEGI
FT                   DAKILFFDEESGVKIAELIEGAETLNPATAKKKENMELVVGALRTLHNSEIKMENRFNV
FT                   FEKIEDYESLVKKVNGTLFEDYYEIKTRVLKLEKVLEDNGMEIKPCHNDTVPENFVKDI
FT                   NERMYLIDWEYSGLNDPMWDLAAHSIECDFSEDDEELFLNLYFNNLIEDKHKIRILVYK
FT                   ICQDFLWSIWTILKEAQGDDFGTYGIDRYNRGKKNLDLLDKILMGQ"
FT   gene            735312..736280
FT                   /locus_tag="CPF_0609"
FT   CDS_pept        735312..736280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0609"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83469"
FT                   /db_xref="GOA:A0A0H2YR46"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR46"
FT                   /protein_id="ABG83469.1"
FT                   /translation="MFKSNYKGYGSGIISAMAWGLDTVLVGVILSMAPFINTESAIMLA
FT                   PFVSTFLHDFFSTLWMFIYMIFTRQVGKLFKSLKTPSTKYVILASIFGGPMGMTGYLLS
FT                   VNYIGPSYAATISSIYPAVGAVLAAIFLKEKISRKGYIGLTISILGIALLGFGNDGGKA
FT                   SLIGFLFAGLSVLGWGSESVICSYGMKDEDISPKQALQIRQFISALFSGVIILPLLKAY
FT                   PLVFEVLKGNVTFVIIGTALMGTISYVCYYTAIHKLGPTRAMGLNITYVVWAMIFDKVL
FT                   LGHNITIKMVICALMVMIGSFVVATQPAHEEELTNVTNTAV"
FT   gene            736427..737110
FT                   /locus_tag="CPF_0610"
FT   CDS_pept        736427..737110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0610"
FT                   /product="nucleotidyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84284"
FT                   /db_xref="GOA:A0A0H2YU17"
FT                   /db_xref="InterPro:IPR017189"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU17"
FT                   /protein_id="ABG84284.1"
FT                   /translation="MRAILLAAGMGTRLRPLTLDTPKSLIEVNGRPLLERQIEFLRERG
FT                   VEEIIVVTGYLAEKFDYLKDKYGVKLVNNDKYDIYNNIYTMYLVREYLENTYVVDADVY
FT                   ISENFLLEKPETSMYFSANKQGFKGEWKLSFDEDLKVNDIEVGDDEGYILCGVSYWDKK
FT                   DTDIIVKELEDMVENGDFSELYWDDIVKNNISKLDIRIEKISENSIYEIDNLEELDYVK
FT                   SVVEK"
FT   gene            complement(737229..738521)
FT                   /locus_tag="CPF_0611"
FT   CDS_pept        complement(737229..738521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0611"
FT                   /product="cell wall binding repeat protein"
FT                   /note="identified by similarity to GB:AAF73795.1; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82309"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YNC7"
FT                   /protein_id="ABG82309.1"
FT                   /translation="MKRRRIITTLILTLTLSLQSISVFAQPTKEVSNISSEKTDINNGW
FT                   VHENNNWYYILNNEKITGWKEIDDNWYHFNSEGIMETGWQFINGDWYYLKSNGPMATGW
FT                   QFINDDWYYLKPNGPMATGWQSINDDWYYLKPNGPMVTGWQFINNDWYYLKSNGPMATS
FT                   WQKINDDWYYLKPNGPMATGWQKIDNNWYYLNSNGPMATGWRFLDNNWYHLSENGPMTI
FT                   GWKISDDKWYYLDDNGAMAQDSEKTINGNIYKFDSDGVMITDKWFESTYVNKDGIVLHG
FT                   SPSRSHSYTQYKLFNYMSNEDNRESVHYAAIDLHGGETTNNCVYFTSEALRRAGVKIPL
FT                   YVANTYQLERELLSRGWIRSTNTSDLRPGDVVFSGYKHSFTFMNWYDDDYAYIVDNQKK
FT                   YFDSVLHRRLVSVDDPVNGTIRATHFFYLPE"
FT   gene            complement(738640..739659)
FT                   /locus_tag="CPF_0612"
FT   CDS_pept        complement(738640..739659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0612"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to SP:Q02115; match to
FT                   protein family HMM PF03816; match to protein family HMM
FT                   TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83100"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQH9"
FT                   /protein_id="ABG83100.1"
FT                   /translation="MLTLARKTNKKRSSKKPAKNRKLIIALSIIGLLIVGLVGGVATYG
FT                   LTMLGKVNKVDLNEDNLGIDKAVDEKLSKYDGIANIALFGIDAPEGTDGRSDAIMIATV
FT                   DKIHNKLKLTSIMRDSYVDIQGHGKDKINHAYAFGGHELALKTLNENFDLNLKDFATVN
FT                   FSSLPKIIDSVGGMDLNIRQDEIDASPGINDHIKDLNRLSNTDCPLITSPGVQHVNGTQ
FT                   ALAYCRIRYTAGGDGERTERQRIVLSKLFEKFNQVSPAKYPTILNELMPMVTTSLSSGE
FT                   ILNLAKIVASMGGSGLEQERYPMDQYSKGEMINGVYYLAFDKDVTVKQIHDYIFEDKK"
FT   gene            complement(739939..741213)
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0613"
FT   CDS_pept        complement(739939..741213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="CPF_0613"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84377"
FT                   /db_xref="GOA:A0A0H2YU76"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YU76"
FT                   /protein_id="ABG84377.1"
FT                   /translation="MNNKRSDFLVIGFALFSMFLGAGNLIFPPLLGRNLGADYYLGIIG
FT                   FIITGVGVPLLGILSSMRVNGKFELFGDKVGKKFSLIYSIALFILIGPLLAIPRTAATT
FT                   FELAFAPNFANINYFAVIVVYFLVNLIFVLKPSKVIDVLGKFLTPILLAILFFLIAKGV
FT                   LSPIDALTKSYTPDALSTSLLEGYQTMDAIAAVIFSSIILGSIKAKGYTGKASFKLLIK
FT                   AAVIAIGGLAIIYGGLIFLGAHTGDLALDLSNSQLLLFVAESILGHAGAILIGVSMALA
FT                   CLTTSIGLLSAGGSFFERVSNGKLPYKFNVLLMTVTSILVASMGLDKIISLSATLLGVI
FT                   YPVTIVLILLNLFHKRITNPLTHKVTVYVTLVVSILITLGNFIPGVENLVSLLPLYSKG
FT                   FGWVVPALVGFIIPSIIPTRETATA"
FT   gene            741966..742964
FT                   /gene="trpS"
FT                   /locus_tag="CPF_0614"
FT   CDS_pept        741966..742964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CPF_0614"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by similarity to SP:P00953; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82784"
FT                   /db_xref="GOA:A0A0H2YQW8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQW8"
FT                   /protein_id="ABG82784.1"
FT                   /translation="MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYDCYFCVVD
FT                   LHAITVKQLPADLRRRTLEVLAIYIASGINPDENTLFIQSHVPAHSEASWLLTCNSYMG
FT                   ELSRMTQYKDKSKKMGDSIGAGLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIG
FT                   TRFNNSYSKTFTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVIRKKI
FT                   SRAVTDSIGVVNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKNDVAEAIV
FT                   EELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGLIPR"
FT   gene            743378..743917
FT                   /locus_tag="CPF_0615"
FT   CDS_pept        743378..743917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83290"
FT                   /db_xref="GOA:A0A0H2YQN0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQN0"
FT                   /protein_id="ABG83290.1"
FT                   /translation="MIIRLIVCILILGGLIIYRNNKLKTIKLEKKKTDSKVISLLYDKL
FT                   SNVLLIFSAFDMVIGVMAREANNITSTIWRVLTIIFCFGMFIYVTKESIKSTFIIRKND
FT                   FILFVNGEEKINFHDVKEINIINTANKYVYLITIFLKDGREYSIKGRDQYEMNKVVRLI
FT                   NEKIGYKSLKEELAKA"
FT   gene            744000..745112
FT                   /gene="AnSME"
FT                   /locus_tag="CPF_0616"
FT   CDS_pept        744000..745112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AnSME"
FT                   /locus_tag="CPF_0616"
FT                   /product="anaerobic sulfatase-maturating enzyme"
FT                   /EC_number="3.1.6.-"
FT                   /note="identified by similarity to SP:P25550; match to
FT                   protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83662"
FT                   /db_xref="GOA:Q0TTH1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034485"
FT                   /db_xref="PDB:4K36"
FT                   /db_xref="PDB:4K37"
FT                   /db_xref="PDB:4K38"
FT                   /db_xref="PDB:4K39"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTH1"
FT                   /protein_id="ABG83662.1"
FT                   /translation="MPPLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLE
FT                   SMVKRVLNEANGHCSFAFQGGEPTLAGLEFFEKLMELQRKHNYKNLKIYNSLQTNGTLI
FT                   DESWAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYKVEFNIL
FT                   CVVTSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEEKGKYNYSLKPKDYTKFLKNLF
FT                   DFWYEDFLNGNRVSIRYFDGLLETILLGKSSSCGMNGTCTCQFVVESDGSVYPCDFYVL
FT                   DKWRLGNIQDMTMKELFETNKNHEFIKLSFKVHEECKKCKWFRLCKGGCRRCRDSKEDS
FT                   ALELNYYCQSYKEFFEYAFPRLINVANNIK"
FT   gene            745323..746153
FT                   /gene="pstS"
FT                   /locus_tag="CPF_0617"
FT   CDS_pept        745323..746153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="CPF_0617"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR02136"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83430"
FT                   /db_xref="GOA:A0A0H2YSI2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="PDB:4GD5"
FT                   /db_xref="PDB:4Q8R"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSI2"
FT                   /protein_id="ABG83430.1"
FT                   /translation="MFKKRLIAIIGTIFIGATAMVGCNSGGSEAKSTNSVSISGSTSVG
FT                   PVMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAGLKEV
FT                   EIAYDGIALITHKNNPVKDLTLVQIKDIYTGKITNWKELGGNDAPIVVVSREDGSGTRD
FT                   AFQEIVGFKAEELTVNSQISDGSGNIKSLVQGNENAIGYISFSYVDDSVSAVKVDGVEA
FT                   TPENVLNKSYKVSRPFLAVYKEENLTESGKSFIDFILSEEGQDIVAKEHLIKVK"
FT   gene            746377..747195
FT                   /gene="pstS"
FT                   /locus_tag="CPF_0618"
FT   CDS_pept        746377..747195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="CPF_0618"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR02136"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83197"
FT                   /db_xref="GOA:A0A0H2YRC8"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YRC8"
FT                   /protein_id="ABG83197.1"
FT                   /translation="MNRRRVVIALSSILAMGFLLTGCGGGSRANIIKISGSSSVGPLVE
FT                   AEAEVFKKEMPDITVEVNQLGSSAGIKDAINGTVEIGISSRDLKEKELESGIKEKPIAY
FT                   DGMSVIINNENPVQNLTMEQIRDIYTGKITNWKEVGGEDTPIVLVSREDGSGTRDAFQE
FT                   IVGFNSEEISPQAQISDGSGSIKTMVAGNKNAIGYISFSYVDDSVHAVSIDGVKPTAEN
FT                   VQNKKYKLSRPFLLVYKEENLNENSKKFIDFIMSKEGQEIVEEDGLISVT"
FT   gene            747277..748164
FT                   /gene="pstC"
FT                   /locus_tag="CPF_0619"
FT   CDS_pept        747277..748164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="CPF_0619"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85057"
FT                   /db_xref="GOA:A0A0H2YWB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YWB2"
FT                   /protein_id="ABG85057.1"
FT                   /translation="MEAKSQNNKSKYFIESLTEKIFLISASVAVISLLLIIGFVFYKGL
FT                   RPFIIEGYSFWDFIFGTQWIPSANKYGILPMIVASLGATIGALLIGVPVGILTSIFIAE
FT                   IAPKKIAKIMSGAVELLAGIPSVLYGVFGLAIIVPTIQEVFNLPKGQSLLAVIIVLAIM
FT                   MLPTVITVSETAIRAVPNAYKEGSLALGASKTETIFKVIVPAAKSGIMTGVVLGIGRAI
FT                   GETMAVILVAGNTPVIPSSIMDSVRPLTTNIALEMGYAFGTHQEMLFATGVVLFTFILI
FT                   LNLVLSKLSNKGGK"
FT   gene            748167..748991
FT                   /gene="pstA"
FT                   /locus_tag="CPF_0620"
FT   CDS_pept        748167..748991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="CPF_0620"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83007"
FT                   /db_xref="GOA:A0A0H2YQA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQA9"
FT                   /protein_id="ABG83007.1"
FT                   /translation="MRKVKDNILNGLVWLSAIFTIGILVIILGFIFIKGIGKINLTFLT
FT                   SNYSAGGGGGILPMIVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATES
FT                   LAGIPSIVYGLFGGIFFVVALKMGYSILAGSLTVSIIILPVIIRTTEEALKTVPESYRE
FT                   ASLGLGATKFQTLYKVILPSAMPGILSGVILSIGRIIGESAAILLTAGTVAQMPKGIFS
FT                   SARTLTVQAYLVTKEKGDIETAAAVGIVLIVIILALNISAKLIAKKFNKANY"
FT   gene            749009..749770
FT                   /gene="pstB"
FT                   /locus_tag="CPF_0621"
FT   CDS_pept        749009..749770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="CPF_0621"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84192"
FT                   /db_xref="GOA:Q0TTG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTG6"
FT                   /protein_id="ABG84192.1"
FT                   /translation="MSDKKTKIQVRDLDLFYASNHALKKINIDIKENEVTALIGPSGCG
FT                   KSTFLRTLNRMNDLIPIVRIEGEIQVDGKDIYKDDDVIALRTKVGMVFQKPNLFPMSIY
FT                   DNVAYGPRVHGIKDKKVLDKIVEESLRDAAIWDEVKNRLKSSALGLSGGQQQRICIARA
FT                   IAMNPEIILMDEPTSALDPISTLKVEELIRKLEDKYTIVIVTHNMQQAARISDKTAFFL
FT                   NGELVEFSDTNTIFTNPRDKRTEDYITGRFG"
FT   gene            749795..750448
FT                   /gene="phoU"
FT                   /locus_tag="CPF_0622"
FT   CDS_pept        749795..750448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="CPF_0622"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84589"
FT                   /db_xref="GOA:A0A0H2YUS5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUS5"
FT                   /protein_id="ABG84589.1"
FT                   /translation="MSIDDLRISIKELKSETKEMMELCELAIEKSVDSIVNKDLELARE
FT                   VIKMDDDIDNLRNKIIEKSIELTALKQPMAKDLRNVYALSTIAMELERVGDYSVNIAME
FT                   TIKIDNEEHITGMVGIPKMKSVCLNMLNAAKNALDSNETKLAYDAALEDNIVDDLYNDV
FT                   YVNLLAAMHKDSNNINQGVKLIFVARYLERIGDHITNVCENIVYAIKGDMTELG"
FT   gene            750608..751303
FT                   /locus_tag="CPF_0623"
FT   CDS_pept        750608..751303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0623"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84753"
FT                   /db_xref="GOA:A0A0H2YUH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUH6"
FT                   /protein_id="ABG84753.1"
FT                   /translation="MTNKKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKLIRE
FT                   IKFDLILLDLMLPEIDGLEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYI
FT                   TKPFSIRELMARVKALLRRSNVKKEENIIKFGDVVVNFKTREVTKGTQNVELTLKEFEL
FT                   LKLLIKNKGNILTRELLLDKIWGYEYIGETRTVDVHIRHLRKKIESDDKNPQYIQTIRG
FT                   VGYKFTSNE"
FT   gene            complement(751474..752097)
FT                   /locus_tag="CPF_0624"
FT   CDS_pept        complement(751474..752097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C96972"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84105"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YSV2"
FT                   /protein_id="ABG84105.1"
FT                   /translation="MNNDFLNLLETLNNEKYMRSFISYLISPVITGIKPSSTITLSKQG
FT                   HNLYKLWDMYGEDFLKDLNLKHILLRETVNSKVVLIYDEINLMNTVYKKSSMDFLEKLD
FT                   YRLTMSIDEILTHLVNRYDSFHCPHELGIFLGIPVKDVECFMECTKSKCLLCGYWKVYE
FT                   EEKKAQEIFELYDSSKEIIMNHLLSGKDLKEVYNLTNNVYKFTI"
FT   gene            complement(752131..752547)
FT                   /locus_tag="CPF_0625"
FT   CDS_pept        complement(752131..752547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0625"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM TIGR01753"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84749"
FT                   /db_xref="GOA:A0A0H2YVN0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVN0"
FT                   /protein_id="ABG84749.1"
FT                   /translation="MKKLNIIFWSGSGNTEAMANLIAEGAKENGLEVKLLNVSDASTLD
FT                   VEGCDVLALGSPAMGCETIEEGEMDPFVEEISGLVSGKPTLLFGSYDWGTGEWMDTWKD
FT                   RMEGYGANVVNTLIVNNTPEGEDIENCKAAGKAL"
FT   gene            complement(752961..754619)
FT                   /gene="glnS"
FT                   /locus_tag="CPF_0626"
FT   CDS_pept        complement(752961..754619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="CPF_0626"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="identified by similarity to SP:P00962; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   PF03950; match to protein family HMM TIGR00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84703"
FT                   /db_xref="GOA:Q0TTG1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTG1"
FT                   /protein_id="ABG84703.1"
FT                   /translation="MSNAEHSSNFIRNIIIDDLDSKKHDTIITRFPPEPNGYLHIGHAK
FT                   SIVLNFELGKEFNGRTNLRFDDTNPTKEDTEYVESIKEDVHWLGYNWSELHFASNYFDE
FT                   MYKRALLLIKKGKAYVCDLTPEEIKEYRGTLTEPGKESPYRNRSVEENLDLFERMRKGE
FT                   FEDGSKVLRAKIDMSSPNINFRDPIIYRIAHASHHNTGDKWCIYPMYDFAHPLEDAIEG
FT                   ITHSICTLEFADHRPLYDWFVKECEMESVPRQIEFARLNITNTVMSKRKLKQLVDEGIV
FT                   DGWDDPRMPTVAGLRRRGYTPKSIRNFCKAIGVAKADSTVDSQMLEHFIREDLQETAPR
FT                   AMAVINPLKLVITNYPEGESEILEIENNPKDESAGKRAVTFSREVYIEREDFMENPPKK
FT                   YFRLFPGNEVRLKGAYFVKCNEVIKDENGEVTEIHCTYDPETKSGTGFTGRKVKGTIHW
FT                   VDANNCIPAEFRLYEPLILDDCEENEGKHFLEQINPNSLTICKGFIEPSAKDAKPQDKY
FT                   QLFRHGYFNVDPNFTSDDNLVFNRIVSLKSSFKLK"
FT   gene            complement(754873..755028)
FT                   /locus_tag="CPF_0627"
FT   CDS_pept        complement(754873..755028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:A96978"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82314"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YND3"
FT                   /protein_id="ABG82314.1"
FT                   /translation="MEDKNLVCKDCGKEFVFTVGEQEFFKEKGFENDPVRCPACRKARK
FT                   AQKMNR"
FT   gene            complement(755183..756271)
FT                   /locus_tag="CPF_0628"
FT   CDS_pept        complement(755183..756271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0628"
FT                   /product="spore germination protein"
FT                   /note="identified by match to protein family HMM PF03845;
FT                   match to protein family HMM TIGR00912"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82916"
FT                   /db_xref="GOA:A0A0H2YQS7"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQS7"
FT                   /protein_id="ABG82916.1"
FT                   /translation="MSLGKLTARHFIFFIIAAISTSLVNYTSLFIKIGGRDTWIFTIIS
FT                   GIIFFFVTSFIFSVISKIEYYDFKETCYIVLGKPLGNIYILIFSLTLVLMCIESASVSS
FT                   SSINVNIFAESPIWYCLLFFIITVFLIGKNRFNSILIICIVCVSIVLAINLLLALLNIR
FT                   YIDYTLLLPIFKDRRISEYILCALTQLGSLSSLAIVLPILPRIDDKKNLKKISINTILL
FT                   TSIFCALCVVILISTLGSLRSANVFYPQFVQTQRIYFGGFVENGNVFVMISSTLSWVVK
FT                   YLITIFSLYTIWKDRVKYKRNFIALISVIVYAFSYLAAKNAYTLFILLRYYQYILLIVL
FT                   FICPIIIYTLAYFKRQKFKYLK"
FT   gene            756367..757788
FT                   /locus_tag="CPF_0629"
FT   CDS_pept        756367..757788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0629"
FT                   /product="spore germination protein"
FT                   /note="identified by match to protein family HMM PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84269"
FT                   /db_xref="GOA:A0A0H2YUJ8"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YUJ8"
FT                   /protein_id="ABG84269.1"
FT                   /translation="MQKQLDFLKDKLKDSFDVKYREVDTALGPATIVFMDVLCSTQFIS
FT                   EYIVKPLTLVKDGIKDENDIMTKVIDINITNWSKDKNDTLLHVLSGDVVIIFDKFDKVI
FT                   YCETKGYTRRGVGIPITEAVIKGPREGFNEAFVDNVTLLRRRIKNHNLKFEPLYVGEDT
FT                   QTVVCISYIKNKAPKELIDEIREKIKNLDYKFILDTNYIEAKLREDRTLFDTVGYTEKA
FT                   DEVAAKLLEGRVAIIVDGTPFVLTVPFFFIENFQTPDDYYLNRYFTSFTRILRWIAFFI
FT                   AMFLPGIYVALVTHHFSVLPSLFVFRLAVARAGVPFPIVAEVIIMMLLFQIIKEAGLRL
FT                   PQPIGTSMSLVSGLILGEAAVGAGIASRITIVVVALSAVCYFLIPKLYGAVSIWSIGIV
FT                   ITAAFFGIPGVILISVVLLSHLAHLRSCEYQYLFPLGTLNRYKFKDIIMRGRLDEISKD
FT                   IVGKDGKNEPKESYS"
FT   gene            757763..758887
FT                   /locus_tag="CPF_0630"
FT   CDS_pept        757763..758887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0630"
FT                   /product="spore germination protein"
FT                   /note="identified by match to protein family HMM PF05504;
FT                   match to protein family HMM TIGR02887"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84937"
FT                   /db_xref="GOA:A0A0H2YV23"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YV23"
FT                   /protein_id="ABG84937.1"
FT                   /translation="MNLKKVIASLLSIIIMSTMLIGCYNYKDINRVTFVTSLIFDENEV
FT                   GNIDIYLDCVKPYRSSNESSDKGRRVLYKGTGKTVLEAIKDINMYSSSKLDFTQCKGYI
FT                   FTEKAAKNGIRKYIDIINKNQEFMIRPYMFVLFGSPEELLNDVTVDEEYLGVFIDDLVQ
FT                   RMNKSPRVIAIDANDYLELRTNYGNLLVLGALSIRDDMEEKRLELSGGALLKNEVLVRR
FT                   ITAEEGMSYNLLMGDLKRGTLEVMNPQDPNTFITLDISNAKTKTSISYDGENITLYKDI
FT                   KVKCLIGESQSRLIVDEKLLNLLELEEEAVIKQYLELFFESFKESDIDIVNVGNLFYRK
FT                   YPDEVLEKDPISITNLKINVDVEIDGTTITGNTL"
FT   gene            759081..760214
FT                   /locus_tag="CPF_0631"
FT   CDS_pept        759081..760214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0631"
FT                   /product="AAA domain family protein"
FT                   /note="identified by match to protein family HMM PF04326"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82726"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YQ75"
FT                   /protein_id="ABG82726.1"
FT                   /translation="MNENKLRKLIKKNEYEKLDFKLKIELFTESVKKELAKDICAIANS
FT                   RGGRGYIIIGVEDKTKKIVGVDADYITEERVQQIVASRIEPPVPISLEECFLDGKRLLV
FT                   IVIFNSYQKPYQIRENGAFYIRRGSTTDIMRKQELLSEFQKGISFNLETCPIVNSNIDF
FT                   LNEELVKRYFYLKGIKISKENREFLLSSSNIIHKNNISGKSMCTLGGLLVFSDVNSMYI
FT                   PHNMIKIRNLLGGEQTFIIRGNILDMMKNMEKKIREIVPNEYPVALIIDTIRNILIYRD
FT                   YSQYNKIVEVVLGKKELTVYCPGEIVKRYRDGRIGYIKRNMWIYEKIISLDSRDGEMNY
FT                   NLGGKEVKESFTNKVKVITVNEENITKFIFNKYRTIG"
FT   gene            760290..760703
FT                   /locus_tag="CPF_0632"
FT   CDS_pept        760290..760703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0632"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D70143"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG84995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YVN2"
FT                   /protein_id="ABG84995.1"
FT                   /translation="MIQLFFNQRGAGKSKNLVKLANEEIEKSKGSIIFIDNDNKRMLQL
FT                   NKKVRLIPMDNYCVKSYDQFYGFLQGIISRDYDVESIYIDSIANILDDIKLEDLENYLK
FT                   KIELMSRELNVNVFVTIHGDVKIMPENIKKYVA"
FT   gene            760987..762207
FT                   /gene="tyrS"
FT                   /locus_tag="CPF_0633"
FT   CDS_pept        760987..762207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="CPF_0633"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by similarity to SP:P00951; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83841"
FT                   /db_xref="GOA:Q0TTF4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TTF4"
FT                   /protein_id="ABG83841.1"
FT                   /translation="MANVLDTLMERGYIKQFTHEAETRELLEKEKVTFYIGFDPTADSL
FT                   HVGHFIAMMFMAHMQKAGHRPIALIGGGTATIGDPSGKTDMRKMMTNETIAHNVACIKK
FT                   QMEKFIDFSDDKAILVNNADWLLNQNYVEFLREVGVHFSVNRMLSAECFKQRLERGLSF
FT                   LEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGVELVRKKSQESAYAMTCTLLT
FT                   NSEGQKMGKTVNGALWLDPEKTSPYEFYQYWRNVNDADVEKCLKLLTFIPMDEVRRLSS
FT                   LEGSQINEAKKVLAFEVTKLVHGEEEATKAKQAAEALFGKGGDMSNVPTYEMGKDKLGS
FT                   ELLDILVEAEIVPSKAEGKRLVKQGGLSLNGEKVADFKKTLEEADFENGEVLIKRGKKN
FT                   YNKIVLA"
FT   gene            762463..763155
FT                   /locus_tag="CPF_0634"
FT   CDS_pept        762463..763155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0634"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG83368"
FT                   /db_xref="GOA:A0A0H2YR37"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2YR37"
FT                   /protein_id="ABG83368.1"
FT                   /translation="MALYAISDLHLALNTDKPMDIFGEKWRNHHEKIKENWNNKITEED
FT                   TVLIAGDISWSMKSDESKDDLDWIDALPGKKIIIKGNHDYWWGSISKLNKMYENTKFIQ
FT                   NNFFTYKDWAICGSRGWICEGSDKFTQKDKKIFDREQIRLRLSLEEAKKAGHEKIICMV
FT                   HYPPTNEKFEDSAFINIFKEFGVDKVIYGHLHGMALKGKVLNEERDGIDYKLTSCDFIN
FT                   FDPIKILD"
FT   gene            763274..764065
FT                   /locus_tag="CPF_0635"
FT   CDS_pept        763274..764065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPF_0635"
FT                   /product="relA/spoT family protein"
FT                   /note="identified by match to protein family HMM PF04607"
FT                   /db_xref="EnsemblGenomes-Gn:CPF_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG82889"
FT                   /db_xref="GOA:A0A0H2YQM8"
FT                   /db_xref="InterPro:IPR007685"
FT