(data stored in ACNUC7421 zone)

EMBL: CP000248

ID   CP000248; SV 1; circular; genomic DNA; STD; PRO; 3561584 BP.
XX
AC   CP000248; AAAV03000000-AAAV03000015;
XX
PR   Project:PRJNA204;
XX
DT   13-FEB-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Novosphingobium aromaticivorans DSM 12444, complete genome.
XX
KW   .
XX
OS   Novosphingobium aromaticivorans DSM 12444
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Novosphingobium.
XX
RN   [1]
RP   1-3561584
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Han C., Thomson S., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Ivanova N., Fredrickson J., Balkwill D., Romine M.F.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Novosphingobium aromaticivorans DSM
RT   12444";
RL   Unpublished.
XX
RN   [2]
RP   1-3561584
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Han C., Thomson S., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Ivanova N., Fredrickson J., Balkwill D., Romine M.F.,
RA   Richardson P.;
RT   ;
RL   Submitted (19-JAN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a91a6520c52ada415d6f494df8d14d04.
DR   BioSample; SAMN02598432.
DR   CABRI; DSM 12444.
DR   EnsemblGenomes-Gn; EBG00001121950.
DR   EnsemblGenomes-Gn; EBG00001121951.
DR   EnsemblGenomes-Gn; EBG00001121952.
DR   EnsemblGenomes-Gn; EBG00001121953.
DR   EnsemblGenomes-Gn; EBG00001121954.
DR   EnsemblGenomes-Gn; EBG00001121955.
DR   EnsemblGenomes-Gn; EBG00001121956.
DR   EnsemblGenomes-Gn; EBG00001121957.
DR   EnsemblGenomes-Gn; EBG00001121958.
DR   EnsemblGenomes-Gn; EBG00001121959.
DR   EnsemblGenomes-Gn; EBG00001121960.
DR   EnsemblGenomes-Gn; EBG00001121961.
DR   EnsemblGenomes-Gn; EBG00001121962.
DR   EnsemblGenomes-Gn; EBG00001121963.
DR   EnsemblGenomes-Gn; EBG00001121964.
DR   EnsemblGenomes-Gn; EBG00001121965.
DR   EnsemblGenomes-Gn; EBG00001121966.
DR   EnsemblGenomes-Gn; EBG00001121967.
DR   EnsemblGenomes-Gn; EBG00001121968.
DR   EnsemblGenomes-Gn; EBG00001121969.
DR   EnsemblGenomes-Gn; EBG00001121970.
DR   EnsemblGenomes-Gn; EBG00001121971.
DR   EnsemblGenomes-Gn; EBG00001121972.
DR   EnsemblGenomes-Gn; EBG00001121973.
DR   EnsemblGenomes-Gn; EBG00001121974.
DR   EnsemblGenomes-Gn; EBG00001121975.
DR   EnsemblGenomes-Gn; EBG00001121976.
DR   EnsemblGenomes-Gn; EBG00001121977.
DR   EnsemblGenomes-Gn; EBG00001121978.
DR   EnsemblGenomes-Gn; EBG00001121979.
DR   EnsemblGenomes-Gn; EBG00001121980.
DR   EnsemblGenomes-Gn; EBG00001121981.
DR   EnsemblGenomes-Gn; EBG00001121982.
DR   EnsemblGenomes-Gn; EBG00001121983.
DR   EnsemblGenomes-Gn; EBG00001121984.
DR   EnsemblGenomes-Gn; EBG00001121985.
DR   EnsemblGenomes-Gn; EBG00001121986.
DR   EnsemblGenomes-Gn; EBG00001121987.
DR   EnsemblGenomes-Gn; EBG00001121988.
DR   EnsemblGenomes-Gn; EBG00001121989.
DR   EnsemblGenomes-Gn; EBG00001121990.
DR   EnsemblGenomes-Gn; EBG00001121991.
DR   EnsemblGenomes-Gn; EBG00001121992.
DR   EnsemblGenomes-Gn; EBG00001121993.
DR   EnsemblGenomes-Gn; EBG00001121994.
DR   EnsemblGenomes-Gn; EBG00001121995.
DR   EnsemblGenomes-Gn; EBG00001121996.
DR   EnsemblGenomes-Gn; EBG00001121997.
DR   EnsemblGenomes-Gn; EBG00001121998.
DR   EnsemblGenomes-Gn; EBG00001121999.
DR   EnsemblGenomes-Gn; EBG00001122000.
DR   EnsemblGenomes-Gn; EBG00001122001.
DR   EnsemblGenomes-Gn; EBG00001122002.
DR   EnsemblGenomes-Gn; EBG00001122003.
DR   EnsemblGenomes-Gn; EBG00001122004.
DR   EnsemblGenomes-Gn; EBG00001122005.
DR   EnsemblGenomes-Gn; EBG00001122006.
DR   EnsemblGenomes-Gn; EBG00001122007.
DR   EnsemblGenomes-Gn; EBG00001122008.
DR   EnsemblGenomes-Gn; EBG00001122009.
DR   EnsemblGenomes-Gn; EBG00001122010.
DR   EnsemblGenomes-Gn; EBG00001122011.
DR   EnsemblGenomes-Gn; EBG00001122012.
DR   EnsemblGenomes-Gn; EBG00001122013.
DR   EnsemblGenomes-Gn; EBG00001122014.
DR   EnsemblGenomes-Gn; EBG00001122015.
DR   EnsemblGenomes-Gn; EBG00001122016.
DR   EnsemblGenomes-Gn; EBG00001122017.
DR   EnsemblGenomes-Gn; EBG00001122018.
DR   EnsemblGenomes-Gn; EBG00001122019.
DR   EnsemblGenomes-Gn; EBG00001122020.
DR   EnsemblGenomes-Gn; EBG00001122021.
DR   EnsemblGenomes-Gn; EBG00001122022.
DR   EnsemblGenomes-Gn; Saro_R0001.
DR   EnsemblGenomes-Gn; Saro_R0003.
DR   EnsemblGenomes-Gn; Saro_R0004.
DR   EnsemblGenomes-Gn; Saro_R0005.
DR   EnsemblGenomes-Gn; Saro_R0006.
DR   EnsemblGenomes-Gn; Saro_R0007.
DR   EnsemblGenomes-Gn; Saro_R0008.
DR   EnsemblGenomes-Gn; Saro_R0009.
DR   EnsemblGenomes-Gn; Saro_R0010.
DR   EnsemblGenomes-Gn; Saro_R0011.
DR   EnsemblGenomes-Gn; Saro_R0012.
DR   EnsemblGenomes-Gn; Saro_R0013.
DR   EnsemblGenomes-Gn; Saro_R0014.
DR   EnsemblGenomes-Gn; Saro_R0015.
DR   EnsemblGenomes-Gn; Saro_R0016.
DR   EnsemblGenomes-Gn; Saro_R0017.
DR   EnsemblGenomes-Gn; Saro_R0018.
DR   EnsemblGenomes-Gn; Saro_R0019.
DR   EnsemblGenomes-Gn; Saro_R0020.
DR   EnsemblGenomes-Gn; Saro_R0022.
DR   EnsemblGenomes-Gn; Saro_R0023.
DR   EnsemblGenomes-Gn; Saro_R0024.
DR   EnsemblGenomes-Gn; Saro_R0025.
DR   EnsemblGenomes-Gn; Saro_R0029.
DR   EnsemblGenomes-Gn; Saro_R0030.
DR   EnsemblGenomes-Gn; Saro_R0031.
DR   EnsemblGenomes-Gn; Saro_R0032.
DR   EnsemblGenomes-Gn; Saro_R0033.
DR   EnsemblGenomes-Gn; Saro_R0034.
DR   EnsemblGenomes-Gn; Saro_R0035.
DR   EnsemblGenomes-Gn; Saro_R0036.
DR   EnsemblGenomes-Gn; Saro_R0037.
DR   EnsemblGenomes-Gn; Saro_R0038.
DR   EnsemblGenomes-Gn; Saro_R0039.
DR   EnsemblGenomes-Gn; Saro_R0040.
DR   EnsemblGenomes-Gn; Saro_R0042.
DR   EnsemblGenomes-Gn; Saro_R0043.
DR   EnsemblGenomes-Gn; Saro_R0044.
DR   EnsemblGenomes-Gn; Saro_R0045.
DR   EnsemblGenomes-Gn; Saro_R0046.
DR   EnsemblGenomes-Gn; Saro_R0047.
DR   EnsemblGenomes-Gn; Saro_R0048.
DR   EnsemblGenomes-Gn; Saro_R0049.
DR   EnsemblGenomes-Gn; Saro_R0050.
DR   EnsemblGenomes-Gn; Saro_R0051.
DR   EnsemblGenomes-Gn; Saro_R0052.
DR   EnsemblGenomes-Gn; Saro_R0053.
DR   EnsemblGenomes-Gn; Saro_R0054.
DR   EnsemblGenomes-Gn; Saro_R0055.
DR   EnsemblGenomes-Gn; Saro_R0056.
DR   EnsemblGenomes-Gn; Saro_R0057.
DR   EnsemblGenomes-Gn; Saro_R0058.
DR   EnsemblGenomes-Gn; Saro_R0059.
DR   EnsemblGenomes-Gn; Saro_R0060.
DR   EnsemblGenomes-Gn; Saro_R0061.
DR   EnsemblGenomes-Gn; Saro_R0062.
DR   EnsemblGenomes-Gn; Saro_R0063.
DR   EnsemblGenomes-Gn; Saro_R0064.
DR   EnsemblGenomes-Gn; Saro_R0065.
DR   EnsemblGenomes-Gn; Saro_R0066.
DR   EnsemblGenomes-Gn; Saro_R0067.
DR   EnsemblGenomes-Gn; Saro_R0068.
DR   EnsemblGenomes-Gn; Saro_R0069.
DR   EnsemblGenomes-Gn; Saro_R0071.
DR   EnsemblGenomes-Gn; Saro_R0072.
DR   EnsemblGenomes-Gn; Saro_R0073.
DR   EnsemblGenomes-Gn; Saro_R0074.
DR   EnsemblGenomes-Tr; EBT00001713284.
DR   EnsemblGenomes-Tr; EBT00001713285.
DR   EnsemblGenomes-Tr; EBT00001713286.
DR   EnsemblGenomes-Tr; EBT00001713287.
DR   EnsemblGenomes-Tr; EBT00001713288.
DR   EnsemblGenomes-Tr; EBT00001713289.
DR   EnsemblGenomes-Tr; EBT00001713290.
DR   EnsemblGenomes-Tr; EBT00001713291.
DR   EnsemblGenomes-Tr; EBT00001713292.
DR   EnsemblGenomes-Tr; EBT00001713293.
DR   EnsemblGenomes-Tr; EBT00001713294.
DR   EnsemblGenomes-Tr; EBT00001713295.
DR   EnsemblGenomes-Tr; EBT00001713296.
DR   EnsemblGenomes-Tr; EBT00001713297.
DR   EnsemblGenomes-Tr; EBT00001713298.
DR   EnsemblGenomes-Tr; EBT00001713299.
DR   EnsemblGenomes-Tr; EBT00001713300.
DR   EnsemblGenomes-Tr; EBT00001713301.
DR   EnsemblGenomes-Tr; EBT00001713302.
DR   EnsemblGenomes-Tr; EBT00001713303.
DR   EnsemblGenomes-Tr; EBT00001713304.
DR   EnsemblGenomes-Tr; EBT00001713305.
DR   EnsemblGenomes-Tr; EBT00001713306.
DR   EnsemblGenomes-Tr; EBT00001713307.
DR   EnsemblGenomes-Tr; EBT00001713308.
DR   EnsemblGenomes-Tr; EBT00001713309.
DR   EnsemblGenomes-Tr; EBT00001713310.
DR   EnsemblGenomes-Tr; EBT00001713311.
DR   EnsemblGenomes-Tr; EBT00001713312.
DR   EnsemblGenomes-Tr; EBT00001713313.
DR   EnsemblGenomes-Tr; EBT00001713314.
DR   EnsemblGenomes-Tr; EBT00001713315.
DR   EnsemblGenomes-Tr; EBT00001713316.
DR   EnsemblGenomes-Tr; EBT00001713317.
DR   EnsemblGenomes-Tr; EBT00001713318.
DR   EnsemblGenomes-Tr; EBT00001713319.
DR   EnsemblGenomes-Tr; EBT00001713320.
DR   EnsemblGenomes-Tr; EBT00001713321.
DR   EnsemblGenomes-Tr; EBT00001713322.
DR   EnsemblGenomes-Tr; EBT00001713323.
DR   EnsemblGenomes-Tr; EBT00001713324.
DR   EnsemblGenomes-Tr; EBT00001713325.
DR   EnsemblGenomes-Tr; EBT00001713326.
DR   EnsemblGenomes-Tr; EBT00001713327.
DR   EnsemblGenomes-Tr; EBT00001713328.
DR   EnsemblGenomes-Tr; EBT00001713329.
DR   EnsemblGenomes-Tr; EBT00001713330.
DR   EnsemblGenomes-Tr; EBT00001713331.
DR   EnsemblGenomes-Tr; EBT00001713332.
DR   EnsemblGenomes-Tr; EBT00001713333.
DR   EnsemblGenomes-Tr; EBT00001713334.
DR   EnsemblGenomes-Tr; EBT00001713335.
DR   EnsemblGenomes-Tr; EBT00001713336.
DR   EnsemblGenomes-Tr; EBT00001713337.
DR   EnsemblGenomes-Tr; EBT00001713338.
DR   EnsemblGenomes-Tr; EBT00001713339.
DR   EnsemblGenomes-Tr; EBT00001713340.
DR   EnsemblGenomes-Tr; EBT00001713341.
DR   EnsemblGenomes-Tr; EBT00001713342.
DR   EnsemblGenomes-Tr; EBT00001713343.
DR   EnsemblGenomes-Tr; EBT00001713344.
DR   EnsemblGenomes-Tr; EBT00001713345.
DR   EnsemblGenomes-Tr; EBT00001713346.
DR   EnsemblGenomes-Tr; EBT00001713347.
DR   EnsemblGenomes-Tr; EBT00001713348.
DR   EnsemblGenomes-Tr; EBT00001713349.
DR   EnsemblGenomes-Tr; EBT00001713350.
DR   EnsemblGenomes-Tr; EBT00001713351.
DR   EnsemblGenomes-Tr; EBT00001713352.
DR   EnsemblGenomes-Tr; EBT00001713353.
DR   EnsemblGenomes-Tr; EBT00001713354.
DR   EnsemblGenomes-Tr; EBT00001713355.
DR   EnsemblGenomes-Tr; EBT00001713356.
DR   EnsemblGenomes-Tr; Saro_R0001-1.
DR   EnsemblGenomes-Tr; Saro_R0003-1.
DR   EnsemblGenomes-Tr; Saro_R0004-1.
DR   EnsemblGenomes-Tr; Saro_R0005-1.
DR   EnsemblGenomes-Tr; Saro_R0006-1.
DR   EnsemblGenomes-Tr; Saro_R0007-1.
DR   EnsemblGenomes-Tr; Saro_R0008-1.
DR   EnsemblGenomes-Tr; Saro_R0009-1.
DR   EnsemblGenomes-Tr; Saro_R0010-1.
DR   EnsemblGenomes-Tr; Saro_R0011-1.
DR   EnsemblGenomes-Tr; Saro_R0012-1.
DR   EnsemblGenomes-Tr; Saro_R0013-1.
DR   EnsemblGenomes-Tr; Saro_R0014-1.
DR   EnsemblGenomes-Tr; Saro_R0015-1.
DR   EnsemblGenomes-Tr; Saro_R0016-1.
DR   EnsemblGenomes-Tr; Saro_R0017-1.
DR   EnsemblGenomes-Tr; Saro_R0018-1.
DR   EnsemblGenomes-Tr; Saro_R0019-1.
DR   EnsemblGenomes-Tr; Saro_R0020-1.
DR   EnsemblGenomes-Tr; Saro_R0022-1.
DR   EnsemblGenomes-Tr; Saro_R0023-1.
DR   EnsemblGenomes-Tr; Saro_R0024-1.
DR   EnsemblGenomes-Tr; Saro_R0025-1.
DR   EnsemblGenomes-Tr; Saro_R0029-1.
DR   EnsemblGenomes-Tr; Saro_R0030-1.
DR   EnsemblGenomes-Tr; Saro_R0031-1.
DR   EnsemblGenomes-Tr; Saro_R0032-1.
DR   EnsemblGenomes-Tr; Saro_R0033-1.
DR   EnsemblGenomes-Tr; Saro_R0034-1.
DR   EnsemblGenomes-Tr; Saro_R0035-1.
DR   EnsemblGenomes-Tr; Saro_R0036-1.
DR   EnsemblGenomes-Tr; Saro_R0037-1.
DR   EnsemblGenomes-Tr; Saro_R0038-1.
DR   EnsemblGenomes-Tr; Saro_R0039-1.
DR   EnsemblGenomes-Tr; Saro_R0040-1.
DR   EnsemblGenomes-Tr; Saro_R0042-1.
DR   EnsemblGenomes-Tr; Saro_R0043-1.
DR   EnsemblGenomes-Tr; Saro_R0044-1.
DR   EnsemblGenomes-Tr; Saro_R0045-1.
DR   EnsemblGenomes-Tr; Saro_R0046-1.
DR   EnsemblGenomes-Tr; Saro_R0047-1.
DR   EnsemblGenomes-Tr; Saro_R0048-1.
DR   EnsemblGenomes-Tr; Saro_R0049-1.
DR   EnsemblGenomes-Tr; Saro_R0050-1.
DR   EnsemblGenomes-Tr; Saro_R0051-1.
DR   EnsemblGenomes-Tr; Saro_R0052-1.
DR   EnsemblGenomes-Tr; Saro_R0053-1.
DR   EnsemblGenomes-Tr; Saro_R0054-1.
DR   EnsemblGenomes-Tr; Saro_R0055-1.
DR   EnsemblGenomes-Tr; Saro_R0056-1.
DR   EnsemblGenomes-Tr; Saro_R0057-1.
DR   EnsemblGenomes-Tr; Saro_R0058-1.
DR   EnsemblGenomes-Tr; Saro_R0059-1.
DR   EnsemblGenomes-Tr; Saro_R0060-1.
DR   EnsemblGenomes-Tr; Saro_R0061-1.
DR   EnsemblGenomes-Tr; Saro_R0062-1.
DR   EnsemblGenomes-Tr; Saro_R0063-1.
DR   EnsemblGenomes-Tr; Saro_R0064-1.
DR   EnsemblGenomes-Tr; Saro_R0065-1.
DR   EnsemblGenomes-Tr; Saro_R0066-1.
DR   EnsemblGenomes-Tr; Saro_R0067-1.
DR   EnsemblGenomes-Tr; Saro_R0068-1.
DR   EnsemblGenomes-Tr; Saro_R0069-1.
DR   EnsemblGenomes-Tr; Saro_R0071-1.
DR   EnsemblGenomes-Tr; Saro_R0072-1.
DR   EnsemblGenomes-Tr; Saro_R0073-1.
DR   EnsemblGenomes-Tr; Saro_R0074-1.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2668395; 19201802.
DR   EuropePMC; PMC3272951; 22275104.
DR   EuropePMC; PMC3608174; 23555055.
DR   EuropePMC; PMC4249175; 25217011.
DR   EuropePMC; PMC5132249; 27907117.
DR   EuropePMC; PMC5989583; 29620507.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000248.
DR   SILVA-SSU; CP000248.
DR   StrainInfo; 44778; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351474
CC   Source DNA and bacteria available from Margie
CC   Romine(margie.romine@pnl.gov)
CC   Contact: Margie Romine (margie.romine@pnl.gov)
CC            Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3561584
FT                   /organism="Novosphingobium aromaticivorans DSM 12444"
FT                   /strain="DSM 12444"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:279238"
FT   gene            24..1520
FT                   /locus_tag="Saro_0001"
FT   CDS_pept        24..1520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24450"
FT                   /db_xref="GOA:Q2GCG0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCG0"
FT                   /protein_id="ABD24450.1"
FT                   /translation="MEEFAGGALARGVNSAANSGGERAQAGKKGRESNMIEDQEALDLA
FT                   ADWADISQGLKKDLGPQLHAQWIKPIQLGSFCKETGTLDLFLPTEFSANWVADRFADRL
FT                   SLAWKIARSEVRQVRITVHPRRRSMPELRVGAAPTAPSRAATLAATSPVMVDSALSGLD
FT                   PSLTFAEFVSGSANVLAVNAAQRMAAIEAPQFSPLYLKGSTGQGKTHLLHAIGHAFAAN
FT                   KPGARIFYCSAERFMIEFVQAMRSNEMIEFKSRLRGFDMLLVDDIQFIIGKASTQEEFL
FT                   HTIDALMSAGKRLVVAADRAPQALDGVEQRLLSRLSMGLVADIQPADIELRRKILEHRL
FT                   ARFGNTQVPSDVVEFLARTINRNVRELVGGLNKLIAYAQLTGQPVSLQLAEEQLTDILS
FT                   ANRRRITIDEIQRTVCQFYRVDRTEMASKRRARAVVRPRQVAMYLAKVLTPRSYPEIGR
FT                   KFGGRDHSTVIHAVRLIEELRARDADMDGDVRTLLRQLED"
FT   gene            1629..2423
FT                   /locus_tag="Saro_0002"
FT   CDS_pept        1629..2423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0002"
FT                   /product="UBA/THIF-type NAD/FAD binding fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24451"
FT                   /db_xref="GOA:Q2GCF9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF9"
FT                   /protein_id="ABD24451.1"
FT                   /translation="MTTPALSPALTPDRLDRFARHIVLPEVGAIGQARLAASHVVLVGM
FT                   GGIGSPALQYLAGAGVGRLTLIDDDVVEASNLQRQTIYTEEDLGKPKAQAAAAWVARFD
FT                   PALEVVHHVTRIGRENAADLIAGADVVLDGSDNFATRLSVSDACVSVGVALSSVALGRF
FT                   QGQVANFAGHRPGEACYRCFVGDAFDAEDCDTCADLGVLGAMVGMIGAFGAMAAMRVLL
FT                   EGVSTLGDPQWGQLHVFDGLKPSLRTMRIARDPECRGCTSGQ"
FT   gene            complement(2412..3131)
FT                   /locus_tag="Saro_0003"
FT   CDS_pept        complement(2412..3131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0003"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24452"
FT                   /db_xref="GOA:Q2GCF8"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF8"
FT                   /protein_id="ABD24452.1"
FT                   /translation="MVAMKRPRNIVVLTGAGISAESGIDTFRGAGGLWENHRVEDVATP
FT                   EAFARDPELVLRFYDMRREAIQTKEPNVAHHALARLDREWPRKTAGEVLIVTQNVDDLH
FT                   ERGGAINVLHMHGEHLSAWCTACDARHRWTGPLLHRPPCPACAMPALRPDIVWFGEIPY
FT                   RMDEIHDALAEADLFVSIGTSGAVYPAAGFVRTARELGLQTLELNLERSQGSAWFHETR
FT                   LGPATETVTAWVDELLA"
FT   gene            3158..3886
FT                   /locus_tag="Saro_0004"
FT   CDS_pept        3158..3886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0004"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24453"
FT                   /db_xref="GOA:Q2GCF7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF7"
FT                   /protein_id="ABD24453.1"
FT                   /translation="MARIGIIGSAGRMGNALQAAVAAAGHDFAGGIDKGGDPLELAKAS
FT                   DVLVDFSAPGALEFNLDAAIHAGVPIVVGTTGLEERHHWLIDAAAVSVPVLQTGNTSLG
FT                   VTLLAHLVREAAARLGEDWDIEIVETHHRMKVDAPSGTALLLGEAAAKGRGVSLAEEAV
FT                   RGRDGITGARKAGTIGFAALRGGSVAGDHSVHFLADNERLTFSHLAENRAIFAKGAIRA
FT                   AQWLLDQEPGRYTMPEVLGL"
FT   gene            3946..5124
FT                   /locus_tag="Saro_0005"
FT   CDS_pept        3946..5124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0005"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24454"
FT                   /db_xref="GOA:Q2GCF6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF6"
FT                   /protein_id="ABD24454.1"
FT                   /translation="MALDPATEAARLVDSLGAEQLALAASYTRGNEWLTVAGVAISLVL
FT                   AWIIVRLRVLDWLAARVARWPRVAATFTVSFGFFLIADVLRLPVTVWTDWWREKSYDMT
FT                   DQPLGDFLFQYALAGVIEFAISAIFVVGVFWLVRRSPRRWWLWTGGLAGGGAAALLLLG
FT                   PALIQPMFNTFQPVPPGQVRTALEAIADDVGIPHDRIFMYDGSRQSANFTANVSGIGPA
FT                   ARIAIADVALKSASLDEVRAVTAHEAGHYKLGHVWRHLVVMPLIAVLVAFLIGRLYPWT
FT                   AQRLGATAPLGDPVGLPVFMALVSVLTLFTLPAVNSLTRMGEAEADAFAMQTVGLPDAM
FT                   AGALLKTAEYRYPRPHPLEEAIFYTHPSVERRIEAAMAWKAGRGGANMTGVQ"
FT   gene            5121..5816
FT                   /locus_tag="Saro_0006"
FT   CDS_pept        5121..5816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0006"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24455"
FT                   /db_xref="GOA:Q2GCF5"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF5"
FT                   /protein_id="ABD24455.1"
FT                   /translation="MTRDQIFEFFRRLAEANPSPETELEFGNVYQLLVAVTLSAQATDV
FT                   GVNKATRKLFQIVKTPQDMLDLGEEGLKEHIKTIGLFNSKARNVMAMAEILVREHGGEV
FT                   PADRDLLTALPGVGRKTANVVLNCAFGAETFAVDTHIFRVGNRTGLAKGKTPLAVEKQL
FT                   ERKVPGPFRVGAHHWLILHGRYVCKARTPECWHCGVVDLCGYKAKVLEKGAMPAGAKKA
FT                   VAVKKESKA"
FT   gene            5813..6211
FT                   /locus_tag="Saro_0007"
FT   CDS_pept        5813..6211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24456"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF4"
FT                   /protein_id="ABD24456.1"
FT                   /translation="MKRMTPVLFAAALALSGCAAQGGSGNDGHGKDVPAARVVGKAVSC
FT                   IPITSIRESRVRDDWTIDFRTDGNRWYRNTLPNRCNGLGFERAFSYSTSLSQLCGVDII
FT                   TVISNTGSGPLTRGSCGLGDFTPVELAK"
FT   sig_peptide     5813..5881
FT                   /locus_tag="Saro_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.741 at
FT                   residue 23"
FT   gene            complement(6244..7563)
FT                   /locus_tag="Saro_0008"
FT   CDS_pept        complement(6244..7563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0008"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24457"
FT                   /db_xref="GOA:Q2GCF3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF3"
FT                   /protein_id="ABD24457.1"
FT                   /translation="MARRLTLYILIGMLLGIVVGYALNTAYPKGDETLAYTADTLKLLP
FT                   DVFLRLIKMIVAPLVLATIVTGIASMGDSAALGRIGGRSLAWFITFSFVSISLGLLLVN
FT                   LLRPGVGLELTPTGELGELATGDFTFRHFVLSVFPASPIEAMAKNDILQVLVFSLFAGI
FT                   ALSAVGEKGAPLVRGAEALAQVMLTVTGYVMRFAPFAVFGAISSVIAVRGLGIIVTYGK
FT                   LVGSFYLAMLILWVVLLSAGAIFLRGRIFTLIRYIREPLLLAYSTASSEAALPKLFEQL
FT                   DRFGIPRRISGFVLPLGYSFNLDGSMIYTSFAAIFIAQAYGIELPVTSQIVMLLTLMVT
FT                   SKGIAGVPRASLVVIAATLNQFGLPVEGIALVLGVDHFLDMGRSATNVVGNAVATSVVT
FT                   KWEGMLQPPLDPDAEPLHAPSHTAADGRAGLNLDPANYED"
FT   sig_peptide     complement(7489..7563)
FT                   /locus_tag="Saro_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.842) with cleavage site probability 0.428 at
FT                   residue 25"
FT   gene            complement(7692..8762)
FT                   /locus_tag="Saro_0009"
FT   CDS_pept        complement(7692..8762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0009"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24458"
FT                   /db_xref="GOA:Q2GCF2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCF2"
FT                   /protein_id="ABD24458.1"
FT                   /translation="MSLNSFGHIFRFTTWGESHGPALGAVVDGCPPGLALTEAQIQPFL
FT                   DARRPGQSRFTTQRQEPDQVRILSGVFEGRTTGTPISLMIENVDQRSKDYGDVAKAYRP
FT                   GHADYAYDAKYGFRDYRGGGRSSARETAARVAAGAVARLVIPEVSILAWVSEIGGDRID
FT                   MDHFDAAEIARNPFFCPDSWAAARWEKLVDDARKSGSSLGAVVECVATGVPAGWGAPLY
FT                   AKLDAELAHAMMGINAVKGVEIGDGFAAARNTGEGNADPMRPGAGVPEFLANHAGGIAG
FT                   GISTGQPVTVRVAFKPTSSILTPMPTITREGEATELLTKGRHDPCVGIRGVPVVEAMMA
FT                   LVLADQKLLHRGQCGG"
FT   gene            8836..9147
FT                   /locus_tag="Saro_0010"
FT   CDS_pept        8836..9147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24459"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF1"
FT                   /protein_id="ABD24459.1"
FT                   /translation="MYLVVFRNRKRANIDAPAYSRDAADMERLAREQPGFLGFKSYAAD
FT                   DGEVIALSEWVDEDAALAWRRIAAHAEMQARGRSDYYESYTLFAGTPSRIHHFDRQDK"
FT   gene            9144..9491
FT                   /locus_tag="Saro_0011"
FT   CDS_pept        9144..9491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24460"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCF0"
FT                   /protein_id="ABD24460.1"
FT                   /translation="MNVTVYGIPNCDTVKKARAWLDARGIAYTFHDYKKQGADPARIAA
FT                   WIAKAGLDKVVNKAGTTYRKLDDAQKAALGAETAPMVLAEHASVIKRPVVEHPGGLLVG
FT                   FKEAEWAAALA"
FT   gene            9493..10056
FT                   /locus_tag="Saro_0012"
FT   CDS_pept        9493..10056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0012"
FT                   /product="Nicotinamide mononucleotide transporter PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24461"
FT                   /db_xref="GOA:Q2GCE9"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE9"
FT                   /protein_id="ABD24461.1"
FT                   /translation="MNPVELAASLLGLANIALLVRRSVWNFPFALGSVSCTGVVLWEAR
FT                   LYAETGLQAFFFATNLWGWWLWAQARGAEESAVPVRWMSMPERMTWSGATTVLSLSLGW
FT                   LLHRFTNAALPFADSAVTGASIAAQILLSLRRVENWVLWVAIDVVGIGLYLARGLPLLA
FT                   TLYAVFLVLSVLGLRQWTKAARSC"
FT   gene            10050..10571
FT                   /locus_tag="Saro_0013"
FT   CDS_pept        10050..10571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0013"
FT                   /product="ATPase/kinase involved in NAD metabolism-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24462"
FT                   /db_xref="GOA:Q2GCE8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE8"
FT                   /protein_id="ABD24462.1"
FT                   /translation="MLRVCFHGAESTGKSVLAARLHHRFGWPWVPEYGRDYCERNGTDL
FT                   SMADLLAIAEGHQLATEALATGMPDVLISDTDQLMTAAWAAMLFDEIPGALLAYPKADL
FT                   YLLFETDVPWLEDGTRLFGSTEERRRFGQLAETMLRCAGVSWIRVGGSWEEREAKAITA
FT                   IAEALAARRR"
FT   gene            complement(10639..11079)
FT                   /locus_tag="Saro_0014"
FT   CDS_pept        complement(10639..11079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0014"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24463"
FT                   /db_xref="GOA:Q2GCE7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE7"
FT                   /protein_id="ABD24463.1"
FT                   /translation="MAMSGGKDDGSPMMEMNTTPLIDVMLVLLIMFIITIPVATHAVNI
FT                   DLPQPSQVPNNVTIDPIKNKLVLTATNQILWNGAPVNSGQLVSIIQATKGIDPEPELQF
FT                   QPEEYASYEIANQLMKIITDAKVTKFGFVGNENFATFQKAGQ"
FT   gene            complement(11122..11610)
FT                   /locus_tag="Saro_0015"
FT   CDS_pept        complement(11122..11610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0015"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24464"
FT                   /db_xref="GOA:Q2GCE6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE6"
FT                   /protein_id="ABD24464.1"
FT                   /translation="MSDINTTPLVDVMLVLLIIFLIAVPVAIQTIEKLKVPVLPSEESQ
FT                   DKVENLMLSVVSTDAAGRSPKEPGYEGSSRTGQCRVYFNNTTPVDNQELYQQAFNRLDA
FT                   IVKREGGAANMDPEKIPEVHIRGDVNVPWKCIAGAIYNVQSAGYPKVGFISTPVDPNG"
FT   gene            complement(11772..12521)
FT                   /locus_tag="Saro_0016"
FT   CDS_pept        complement(11772..12521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0016"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24465"
FT                   /db_xref="GOA:Q2GCE5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE5"
FT                   /protein_id="ABD24465.1"
FT                   /translation="MSIYTLAAAAGGAAPQNKFGFAEALQQGGFIAYATVVILGIMSFG
FT                   SFFILFTKFFEQNKILGQYKTIRTTFWKAPTLREGAAKLDKNSAWRQLVDDGISAEDQH
FT                   SKMTDALEAHDWLHGSLARSEASINSRLASGLPFLATVGATSPFIGLFGTVVGIYRALI
FT                   NIGLAGSASIDKVAGPVGEALIMTALGLLVAVPAVLAYNWLQARNKRIAELLSGFSTDV
FT                   LANINSKGTVKPAIAAAPATPAAPVKK"
FT   gene            complement(12595..13257)
FT                   /locus_tag="Saro_0017"
FT   CDS_pept        complement(12595..13257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0017"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24466"
FT                   /db_xref="GOA:Q2GCE4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE4"
FT                   /protein_id="ABD24466.1"
FT                   /translation="MAYADQQMSGNKITALIIVAILHVVVGYALVTGLAYEAIKKVKEV
FT                   TSAVNIEEEKPPEEPPPPPPPKEDTPPPPIVAPPPPISFNAPAPQVQTVNEAPAIPAPP
FT                   APVALPAPPAAPPPPRFTPKAATPKGNPGNWATSNDYPSRALREEREGTTGFRVTVGPD
FT                   GKVTDCQITRSSGSPDLDEATCSNVRRRARFAPAMDGEGNPTTGSYSNSIRWVIPKD"
FT   gene            13602..14504
FT                   /locus_tag="Saro_0018"
FT   CDS_pept        13602..14504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE3"
FT                   /protein_id="ABD24467.1"
FT                   /translation="MPKFAALHTIVAAAALNLWSGFVPGTALAQQPMIRATGTAVSSVS
FT                   PSAPDSMTYADLADLSDASEVVLRVQVRKASRLKPEQAPGLAPGMARMLVEARTQAVLA
FT                   GTAMGEAVSYLADVPLDARGKTPKLAKAQMIVFARTVPGRPGELRLVDGGAQIAWTAER
FT                   EARTRGILTELLAHGAAPRIKALREVLFVPGNLAGEGETQIFLQTATGAPISLSVVRRP
FT                   GSGRTWGVSLSEIVDQAARPPARDTLTWYRLACFLPQTVPAEAGLSGSAEDHRAAEEDY
FT                   AFVLAELGTCSRSRPAISN"
FT   sig_peptide     13602..13691
FT                   /locus_tag="Saro_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            14577..15884
FT                   /locus_tag="Saro_0019"
FT   CDS_pept        14577..15884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0019"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24468"
FT                   /db_xref="GOA:Q2GCE2"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE2"
FT                   /protein_id="ABD24468.1"
FT                   /translation="MSEPLRIALAGLGTVGGGVIRLIEANADLIARRAGRPIVITTVSA
FT                   RNRDKDRGFDVSRYAWEDDMVILGERPDVDVVVELVGGADGPALALARTTFEAGKALVT
FT                   ANKAMIAHHGVELATKAEAAKVALKFEAAVAGGIPVIKGLKEGVAANEIARVYGILNGT
FT                   CNYILSTMEDTGRDFADVLAEAQAKGYAEADPTFDIDGIDAAHKLSILSSIAFGTAVDF
FT                   KPVAATGIRRVLAADIAQADVLGYYIRLIGMAETEMDAAGNRRLFQRVHPHLVHRDHPL
FT                   AHVDGATNAVVAEGNFVGRLLFQGAGAGDGPTASAVVADLIDIARGDIGAPFSIPVAEL
FT                   ERAAPAETGHRRGKAYIRFNVADRPGVLAEITAAMRDAGVSIESFIQKGGQDDAPVMVS
FT                   MVTHEGPESAIAEALRLLDGSPVLAEPPLVMHILGE"
FT   gene            complement(15903..16376)
FT                   /locus_tag="Saro_0020"
FT   CDS_pept        complement(15903..16376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24469"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE1"
FT                   /protein_id="ABD24469.1"
FT                   /translation="MSRRTVAVLAGLALLFGAIPAAARQQAASGGAVQGPVVPGAAMQE
FT                   ADATTSQRLLAGTQAERCRPMQRSDGTIVVCGGKEASERERIPLRDETDSAKSTNDGLP
FT                   RAPNVSGLRDCSRGCLGIGGVPPPMYYFDIKALPPPPPGSDADRIAKGEIPAP"
FT   sig_peptide     complement(16305..16376)
FT                   /locus_tag="Saro_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.841 at
FT                   residue 24"
FT   gene            16582..17574
FT                   /locus_tag="Saro_0021"
FT   CDS_pept        16582..17574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0021"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24470"
FT                   /db_xref="GOA:Q2GCE0"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCE0"
FT                   /protein_id="ABD24470.1"
FT                   /translation="MTDKPTNPAASHVLDRVLVLEMVRVTEAAAIGASRLIGRGDEKAA
FT                   DAAAVEAMRAAFNELWMDGTVVIGEGERDEAPMLYIGEKVGAAPGTGPKIDIALDPLEG
FT                   TTITAKAGPNALAVLAVAEEGGLLNAPDVYMDKLAVGPGYPEGIIDLDKTPSENVRAVA
FT                   AAKGVQPGDIIVCVLDRPRHSDLIAELRSLGCGISLIPDGDVAGVIAVTNEETGVDMYM
FT                   GTGGAPEGVLAAAALRCVGGQFKGRLLFRNEDEKSRARKWGIEDLNKQYDLIELAKGDC
FT                   IFAATGVTDGSLLAGVKVHKNGTMTTESVVMRASSGTVRWVKGEHRKVR"
FT   gene            17734..19323
FT                   /locus_tag="Saro_0022"
FT   CDS_pept        17734..19323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24471"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD9"
FT                   /protein_id="ABD24471.1"
FT                   /translation="MRRILLRTASALAALCLAMPVQAKWYEASSKHFVVYSDRGTEQVR
FT                   IMASKLERFDAALRQLTGRTDEPIAPSNRVTIFMVQSPIDVARLFGKGGNYVGGFYSSI
FT                   AGASYAIVPPFIVQETGENGFAEGVLLHEYAHHFVSENQSILYPIWLNEGFAEFVSTAR
FT                   FEKNGSIGLGLPGQWRGWQLTHQVSVPAEMLVDSQAYFARRELAFDQFYPRAWLLYHML
FT                   TFEASREGQLAAYAGALSRGLNDRDAAIAAFGDLRQLELDLQSYGRKVTMPYYLIKGET
FT                   LRPAQVNVRELSKEDAEAMPFWMRIRRGLEEGNAEPLAVEVRAMAARNPTSAFVQTILG
FT                   MAEFEADHVDAALAAADTAIAIDPMAIEAHVLKGRAMLAKASRNGATPVEWNAVRAAFL
FT                   KANAIDPDHPQPLFLYYASFLSQGFKPTGNALQALSRALELAPYDRVIRAELAESQVSR
FT                   AQFEEAKSTIRMLMRDPHSPLGGARIRAVMEKLDERNAEGARKLLEMSNEEFKAKQEKG
FT                   DPDSGAGREAAA"
FT   sig_peptide     17734..17805
FT                   /locus_tag="Saro_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(19422..23705)
FT                   /locus_tag="Saro_0023"
FT   CDS_pept        complement(19422..23705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0023"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24472"
FT                   /db_xref="GOA:Q2GCD8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCD8"
FT                   /protein_id="ABD24472.1"
FT                   /translation="MNDLTKFTNQIAKPETFDQIQIGLASPERIRSWSFGEIKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRMKYKGVVCEKCGVEVTVTKVRRERMGH
FT                   IELAAPVAHIWFLKSLPSRIGLLLDMQLKQLERILYFESYVVIEPGLTPLEKYQLLTED
FT                   ELLDAQDEYGEDAFSAGIGAEAVKHMLMNLDLVQEKEDLLQELATTKSELKPKKIIKRL
FT                   KVVESFIDSGNRPEWMILDVVPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLIELRAPDIIVRNEKRMLQEAVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRFR
FT                   QNLLGKRVDYSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYARLDAKGLSMTLKQAK
FT                   KWVEKERKEVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCSAF
FT                   NADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILSPANGKPIIVPSQDMVLGIYYLSMD
FT                   RAGEPGEGMMLADMAEVHQALEAKAVTLHSKIVARVPQTDEDGNQYLKRFETTPGRMLI
FT                   GECLPKSHKVPFEIVNRLLTKKEIGDVIDQVYRHTGQKDTVLFADAIMALGFRHAFKAG
FT                   ISFGKDDMIIPDSKDALVAETKELVADYEQQYQDGLITQQEKYNKVIDAWSRCGDQVAN
FT                   AMMEELKSSPIDPETGRQKPINAIYMMSHSGARGSPAQMKQLAGMRGLMAKPSGEIIET
FT                   PIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQDCVVIEEDCGT
FT                   ERALEMRAIVQGGSTIASLGERILGRTLAEDLIEAKSGEVIAQKGELLDEAAIAKIEAA
FT                   GVQSARIRSPLVCEATQGVCGKCYGRDLARGTPVNIGEAVGVIAAQSIGEPGTQLTMRT
FT                   FHIGGAAQVNEQSHLEAISDGTVQYRDIPTITDKRGRRLSLARNGEIVVIDTEGRERAI
FT                   HRVPYGTHLLHENGAIISQGDRLAEWDPFTTPVITEKPGIVRYQDLVDGKTLTEQTDEA
FT                   TGMSSRVVTENRAAGRGKKEDLRPRLTLLDENSGEAARYMMAPGTTLSVEDGQQVEAGD
FT                   ILARASREAAKTRDITGGLPRVAELFEARKPKDNSIIAKIAGRIEFVRDYKAKRKIAII
FT                   PEEGEPVEYLVPKSRVIDVQEGDYVKKGDNLISGSPDPHDILEVMGVEALAEYLVAEIQ
FT                   EVYRLQGVKINDKHIEVIVRQMLQKVEITNGGDTTLLPGEQVDLEEMLETNGKLEEGQQ
FT                   PAEGKPVLLGITKASLQTRSFISAASFQETTRVLTQAAVEGKKDSLIGLKENVIVGRLI
FT                   PAGTGAGMNRMRVAASSRDAALRASYRKLQESLIAPATAAEEHAAELAQGPEAAIGDDP
FT                   LATVEGETHGTDADAGDYLIEGDEA"
FT   gene            complement(23796..27974)
FT                   /locus_tag="Saro_0024"
FT   CDS_pept        complement(23796..27974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0024"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24473"
FT                   /db_xref="GOA:Q2GCD7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCD7"
FT                   /protein_id="ABD24473.1"
FT                   /translation="MATKATSSRTTGRPGVKKRIRKIFGDIHEVVQMPNLIEVQRESYE
FT                   QFLRSDPATGYVSGLEKTLRSVFPIQDFAGTASLDIKEKDGYVLESPKYDVNECRQRGI
FT                   TYAAPMKVTLKLATFEVDAETETKSLIDIKEQDVYMGDIPLMTENGTFFINGTERVIVS
FT                   QMHRSPGVLFDHDRGKTHSSGKYLFAARVIPYRGSWLDFEFDAKDIVNVRIDRKRKLPV
FT                   TALLHALGLGDEDILHHFYDTVTWARAEGGWKVPFVLEQWRGSKPAFDIVDAKSGEVIF
FT                   PAGQKISPRAANKAAKDGLEALLIPTEEIFGRYAARDLIDESTGRIWIEAGDEVSPENL
FT                   DLLDKAGIDNLDLLDIDHISTGPWIRNTLKADKAPDRDHALADIYRVMRPGEPPTRETA
FT                   EALFDGLFFDGDRYDLSAVGRVKLNMRLGLDCPDTVTTLRTDDILAVVKELVNLKDGKG
FT                   EVDDIDNLGNRRVRSVGELLENQYRVGLLRMERAVKERMSSVDVSTVMPNDLINAKPAV
FT                   AAVREFFGSSQLSQFMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRI
FT                   CPIETPEGPNIGLINSLSTFARVNKYGFIETPYRKVVDGKVTKDVIYLSAMEEQKHTVA
FT                   QASAELTADGSFVEELVSARQNGEFVMAPRDTVTLMDVSPKQLVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKADAPFVGTGMEETVARDSGAAISALRSGVVDQVDATRIVIR
FT                   ASGDIEPGQSGVDIYRLQKFERSNQSTCINQRPLVKVGDLIEKGDIIADGPSTEFGELA
FT                   LGRNVLVAFMPWNGYNYEDSILISERIVKEDVFTSIHIEEFEVMARDTKLGPEDITRDI
FT                   PNVGEEALRNLDEAGIVYIGAEVHPGDILVGKITPKGESPMTPEEKLLRAIFGEKASDV
FT                   RDTSLRLPPGVAGTIVDVRVFNRHGIEIDDRTRAIQNEEIERLAKDREDERAILNRATF
FT                   NRLKDMLLGQVAAAAPKGIKKGVEIDEQVLADVERHEWWKFAVADDARQQQLEAVKAQY
FT                   DTAVKAIQEKFEDRKEKLERGDELAPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGIIS
FT                   RILPQEDMPFLEDGTPVDFVLNPLGVPSRMNVGQIFETHLGWAARGLGKRIGEALDAWR
FT                   EANPNPEAGQPPEAVRELLKEIYGDNYAAEIDARNDEQIIDFAQSVRLGVPMGSPVFDG
FT                   AVEKDVTDMLRLAGLDESGQVTLFDGRTGDAFDRKVTVGMKYVLKLHHLVDDKIHARSI
FT                   GPYSLVTQQPLGGKAQFGGQRFGEMEVWALQAYGAAYTLQEMLTVKSDDVVGRTKVYEA
FT                   IVKGDDTFEAGIPESFNVLVKEMRSLGLNVELSSLDDTDDDDGLAEAAE"
FT   gene            28418..29299
FT                   /locus_tag="Saro_0025"
FT   CDS_pept        28418..29299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24474"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD6"
FT                   /protein_id="ABD24474.1"
FT                   /translation="MTKLNAISPRNTMAISAMLMLSPGLAHAQDATAPMTDAPVLSAPA
FT                   TTTTAPTTTAPTIVIPTPAQEPTIAPEAGTTAATTPATAEPPVRAAPQPRIRASTRPSP
FT                   SASTATTASAVPLVAPVAAVAPPAPAPAADAPPVATVDDLAVANSDATPEWALPVGAAA
FT                   TLLVLGGIGLAMTRRRRAYEADVDFVPPATSRPPARPLAETRAALPAPRMVPTAPAHAM
FT                   TPIAPMASTSEREALVERIVASPPDAANPFTSRKARRRRARIMVQSMTVRSDAPARSAE
FT                   RPVIRQPEYARV"
FT   sig_peptide     28418..28504
FT                   /locus_tag="Saro_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            29522..29674
FT                   /locus_tag="Saro_0026"
FT   CDS_pept        29522..29674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD5"
FT                   /protein_id="ABD24475.1"
FT                   /translation="MPRPAPHAAAAILSLLLAATLWLPSVGTRQATLGLADGPVTATYQ
FT                   LPLAA"
FT   sig_peptide     29522..29617
FT                   /locus_tag="Saro_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.420 at
FT                   residue 32"
FT   gene            29703..30233
FT                   /locus_tag="Saro_0027"
FT   CDS_pept        29703..30233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24476"
FT                   /db_xref="GOA:Q2GCD4"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD4"
FT                   /protein_id="ABD24476.1"
FT                   /translation="MSTLRTDPLLGLAKALLTFTMVMLVIGMVGIGIGFAAIVAMHDLV
FT                   VAKLVANGGAGSSYWLILVLLPLLAGLLMASYRFAEKLRAIVRTVEEGDPFTPVNAERL
FT                   RAMAWLSVAIQIVSLPVGILGSMIEEATDKAANVNVEAGISTNGLLLALVLFILARVFR
FT                   TGAQMREDLEGTV"
FT   sig_peptide     29703..29813
FT                   /locus_tag="Saro_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.842) with cleavage site probability 0.827 at
FT                   residue 37"
FT   gene            30233..30454
FT                   /locus_tag="Saro_0028"
FT   CDS_pept        30233..30454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0028"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24477"
FT                   /db_xref="GOA:Q2GCD3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD3"
FT                   /protein_id="ABD24477.1"
FT                   /translation="MPINVKLDDLLHARRMTLTELAERIDLTLANVSILKTGKAKAIRF
FT                   STLEAICRELDCQPGDILGYEAESGETA"
FT   gene            30749..31261
FT                   /locus_tag="Saro_0029"
FT   CDS_pept        30749..31261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0029"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24478"
FT                   /db_xref="GOA:Q2GCD2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCD2"
FT                   /protein_id="ABD24478.1"
FT                   /translation="MDRSQKAESVAFLNGVFAEAGAVVITRNLGMTVAQSTALRTKIRE
FT                   AGATYKVAKNSLAKLAVAGTDYEGLVDLFTGPTAIAASADPVAAAKAVVEFAKTTDKIE
FT                   IVGGAMGSQVLNEAGVRALASMPSLDELRGTLIGLIQAPATKIAQLTTAPAAKLARVFG
FT                   AYAKEAA"
FT   gene            31331..31702
FT                   /locus_tag="Saro_0030"
FT   CDS_pept        31331..31702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0030"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24479"
FT                   /db_xref="GOA:Q2GCD1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCD1"
FT                   /protein_id="ABD24479.1"
FT                   /translation="MADIAKLVEELSKLTVLEAADLAKALEEAWGVSAAAAVAVAAAPA
FT                   AAAEAAEEKTEFDVILTGDGGKKIQVIKEVRAITNLGLTEAKALVEGAPKAIKEGVSKA
FT                   EAEDIKKKIEEAGGTVEVK"
FT   gene            complement(31788..33140)
FT                   /locus_tag="Saro_0031"
FT   CDS_pept        complement(31788..33140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0031"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24480"
FT                   /db_xref="GOA:Q2GCD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCD0"
FT                   /protein_id="ABD24480.1"
FT                   /translation="MERTHELAGRAKARHGPNLSRLAVRAATLLLLLAAVQALASLLFY
FT                   NAIDRETLREDHARRVAELLVVSDRVHDLAPEMLGAIMSTGHLEAVVADTPLVPHRDVE
FT                   KAVGEIRRHILRWEPGLAKRVLHLGMETSPQGSRDLVGAMKLEDGRWLNFRSRDIGTGW
FT                   PIALRATVLTLVTAVLGLGLALWSLRIMTRPLRDLTDAADEIGRGQFVPVEERGPDDLR
FT                   SLARSMNAMQGRIAAMLEDQARSFEAISHDLRTPLSRVMIAADLVDDAEIAGLIHDSTA
FT                   EMEAMLMSLQQYLRAQHLAADPEAMDLGVAIADLLQGAFPGRTELIVAPHAVVRTWREP
FT                   LLLALRPLVENAVQHGGKARVTVAPDAEGHWTVTIADNGPGIPEDQFERILAPFYRIDE
FT                   ARARDTAGFGLGIPTAHRLLQRFGGEIGFGSADGGGLLVRVKVPVAPSDGD"
FT   sig_peptide     complement(33018..33140)
FT                   /locus_tag="Saro_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.934) with cleavage site probability 0.922 at
FT                   residue 41"
FT   gene            complement(33228..33710)
FT                   /locus_tag="Saro_0032"
FT   CDS_pept        complement(33228..33710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0032"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24481"
FT                   /db_xref="GOA:Q2GCC9"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC9"
FT                   /protein_id="ABD24481.1"
FT                   /translation="MHPIFNTSIAAALALSLAACGGSKSGNEGDASGETATATGTATGT
FT                   TSQAPAATEATPVSAAAADAAPSSFAICKSCHSVEKGKHVIGPSLFGIYGTKAGDVAGY
FT                   SFSPAMKASGLTWDDATLDRFLASPMKTVPGTRMTYAGQPDAAKRQELIAYIKSLK"
FT   sig_peptide     complement(33633..33710)
FT                   /locus_tag="Saro_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.451 at
FT                   residue 26"
FT   gene            33831..35222
FT                   /locus_tag="Saro_0033"
FT   CDS_pept        33831..35222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0033"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24482"
FT                   /db_xref="GOA:Q2GCC8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC8"
FT                   /protein_id="ABD24482.1"
FT                   /translation="MAPLPMFEKPPVHWTEELRAMLRLAAPMVGANLLQMAVFAVDVVF
FT                   VARLGPVALAASSLSVSLFGLLVWSLSGLVGAASPLIAAELGRRRHAVREVRRTVRMAA
FT                   WAGTLAGLFAMGVCLLGGPLMRVTGQQPEVIALAVPFLNVLMWAAIPSTISALLRTFVA
FT                   TLGRPTIGTVITGMAVAINAFGNWVFVFGNLGAPEMGLTGSALSSIVTTCAMVLAYIVV
FT                   IRSDRRLRRYRLAGRWWKPEWKRFADVLRVGLPITGTILAEAGMFNGAAFLMGRIGEVE
FT                   LAAHTIALQFAAIAFQVPFGVAQAATIRVGLAFGAGERAAIARAGRVAVVLGMGFMVVT
FT                   ASIMLFAPRAILHLYVDPDAPENRAMAVLAVQYMAVAAAFQLFDGAQAVGAALLRGLQD
FT                   TRIPMAFALFGYWLPGLGTAVGLGLFSPLGGLGVWIGLMVGLVVVASLMLWRWRNRARL
FT                   GLLPA"
FT   gene            35373..35660
FT                   /locus_tag="Saro_0034"
FT   CDS_pept        35373..35660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0034"
FT                   /product="chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24483"
FT                   /db_xref="GOA:Q2GCC7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCC7"
FT                   /protein_id="ABD24483.1"
FT                   /translation="MTFRPLHDRVLVRRVEAEEKTAGGIIIPDSAKEKPAEGIVVAVGS
FT                   GARAENGTITPLDVKANDRVLFGKWSGTEVKVDGEDLLIMKESDILGVIG"
FT   gene            35710..37353
FT                   /locus_tag="Saro_0035"
FT   CDS_pept        35710..37353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0035"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24484"
FT                   /db_xref="GOA:Q2G2Z4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2G2Z4"
FT                   /protein_id="ABD24484.1"
FT                   /translation="MAAKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGM
FT                   TAVAAGMNPMDLKRGIDIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIA
FT                   EAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENPYILI
FT                   HEKKLSSLQAMLPILEAVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLGDIATLTAGEMISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAE
FT                   EIKARVEQIRAQIEVTTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDA
FT                   LHATRAAVEEGIVPGGGTALLYATKALEGLKGANDDQTKGIDIVRRAIQAPIRQIAANA
FT                   GHDGAVVSGNLLRENDENQGFNAATDTYENLKAAGVIDPTKVVRTALQDAASVSGLLIT
FT                   TEAAISEKPDDKPAMPPMGGGMGGMGGMDF"
FT   gene            37528..39198
FT                   /locus_tag="Saro_0036"
FT   CDS_pept        37528..39198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0036"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24485"
FT                   /db_xref="GOA:Q2G2Z9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z9"
FT                   /protein_id="ABD24485.1"
FT                   /translation="MAKARPSPQAAALDREIYRILFENMDDGFCVIEFLDGPHGPLSDY
FT                   VHVLANSAYERNTGIPNVVGQYLREMVPDEADDWIAFYGKVLRTGEPIRFRNELVVTGR
FT                   HLEVSAFRLGTFEDRLVAVLFKDVTERVDAESALHQLNETLEQRVADALAQRELAESAL
FT                   RQAQKMEAVGQLTGGLAHDFNNLLAGITGAFEMIARRLEQGRTADVERYLAAGLGAAHR
FT                   AAALTHRLLAFSRRQTLSPRTTEANRLLVDFAELVRRTVGPQIAVEVRTNPALWAALVD
FT                   ANQLENALLNLCINARDAMPDGGRLAIETDNVTLDEASATERGLPPGDYVTITVSDTGV
FT                   GIPEEDLDRVFEPFFTTKPTGRGTGLGLSMVYGFARQSDGIVRIRSRPGEGTQVRIYLP
FT                   RHEGPAEVPRETGVHEPQPELPGATVLVVDDEPTVRMMMVDALDLIGVECLEAHDGPAA
FT                   LAMLERHPGIDLLVTDVGLPGGLNGRQVADEARRRRSDLGVLFVTGYADSVILQRDTME
FT                   PGIDILTKPFTIEDLQSRVAVLLCARGGPGRPETGPNAA"
FT   gene            complement(39195..39740)
FT                   /locus_tag="Saro_0037"
FT   CDS_pept        complement(39195..39740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0037"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24486"
FT                   /db_xref="GOA:Q2G2Z8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z8"
FT                   /protein_id="ABD24486.1"
FT                   /translation="MTLPGIDVSPPRIETDRLTLTVPGREDYILMRDLVADPEVHRYLG
FT                   PRPDDPTTDMFSRALRAAGSWHLYGYGLFLAHEKASGAFVGQLGVFHSLRGFGKGMDDV
FT                   PEAGWILAREHWGKGLAREAMQAVLDWFDAAQGPQRIACMIERGNAASVALAERLGFVR
FT                   YGEHELADGVIVDLLERT"
FT   gene            complement(39737..40942)
FT                   /locus_tag="Saro_0038"
FT   CDS_pept        complement(39737..40942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0038"
FT                   /product="protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24487"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z7"
FT                   /protein_id="ABD24487.1"
FT                   /translation="MRIVATFLLVLMAVLYAFSRRYEGLHPAVGFLRAFAEAAMVGGLA
FT                   DWFAVTALFRHPLGLPIPHTAIIPENKDRIADTMAAFLQTNFLTPQVVARRMGAVNSAA
FT                   AMGAFLADPRAGESRLRDGAAGLVADVLESLDPEELGGLAKGALKAQLERLELSPLLGQ
FT                   LLGAAIADGRHMPVIESLIRKAAETIEANEPLIQATIHERANTILRWTGLDEKLANAIL
FT                   DGLYKLLAETLVVPDHPVRRKIEDGLAALAHDLVHDAEMRARVERMKTEVLANPAFARW
FT                   LDALWERGRTRLLQIVRNPEGALGGQLGASLAELGLALQRDERLQRVVNRFARRTLVGV
FT                   STRYGAQIVRLVSETVKRWDARTVTDRIEGAVGRDLQFIRINGTLVGGLVGLLLHAVDL
FT                   AL"
FT   sig_peptide     complement(40883..40942)
FT                   /locus_tag="Saro_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.603 at
FT                   residue 20"
FT   gene            complement(41050..44232)
FT                   /locus_tag="Saro_0039"
FT   CDS_pept        complement(41050..44232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0039"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24488"
FT                   /db_xref="GOA:Q2G2Z6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z6"
FT                   /protein_id="ABD24488.1"
FT                   /translation="MNFQNISAWCIRNPVVPIVLFLGLTLAGLVSFMQMKVQDNPDIEF
FT                   PMVIVSIAQPGAAPTEIENQITQRVESAVRSIAGVDTLTSTASEGNSQTMVQFKIGQDI
FT                   NAAVNEVKNQVDQIRSDLPEGILEPQVFKVETSSNPIAYFAVAADDMTIEQLSWFIDDT
FT                   IAKRLLTVPGMAEVSRSGGVNREIAVTIDPMRMNALGVTASQVNAALRQVNINAAGGKT
FT                   EVAGSRQSVRVLGNARDAYALSQTEIALSGNRTVRLKDVADVRDSYSELTSIAKFNGKA
FT                   VVTFSMSRARGESDVSVYDGALEEMRKIEKEQGGKVHFELLFTSVSYTKDQYRSSMNAM
FT                   VEGAVLAVIVVFFFLRDWRATIVSAIAIPLSSIPTFWVLDLMGFTLNQMSLLALGLVAG
FT                   VLVDDAIVEIENIVRHMRMGKSAYQAAIDAADEIGLAVVATTFSIVAVFFPVALMPGVS
FT                   GQFFKNFGLTVVISVLFSLLVARMITPMIAAYFLKAHGEAEHGGGPWMDRYMKVLGWSL
FT                   DTAKAAAYRAAHPGRRFRARLRDHRLWMMGIGFGALLLTLVMFAVIPTQFFPDTDSDSS
FT                   TVSIEMVPGTTLQQTEKKVQEIVTLLSKEQEVKSTLASVREAKANIYVNLKADRERSSL
FT                   EFERQMTPRLQQIADVRANFQAQGPSGPGGGSGRPISIMLAGSDPELLQRTAQTLVEQM
FT                   SALPLLVAPRISADLRRPEVIIKPRLDLAANLGVTTQALSQVIRIATQGEIDQNSAKFS
FT                   LSDRQVPIRVKLPEDSRRDLSIIENLPVPTASGGSVPLSRVAEIGFGSGPTQIQRYNQS
FT                   RRVFVGADLPPGVVKGEAMAAIMKLPIMKNLPQGVSNTAAGEDKFQAEMMKNFGIAVAS
FT                   GVLLVFSVLVLLYHRFISPLVNMGSLFLAPLGGLIAIWLLGQSLSLPVFIGILMLFGIV
FT                   AKNSILLIDFALEEMAAGKGKLEAVMEAGHKRAQPIVMTTVAMVAGMVPTAVAIGGDSG
FT                   WRAPMGIVVIGGLTLSTLLTLLIVPAGFSLADGVEKRIGPWLARKVLGYEPEHRHAATA
FT                   RNDTAHGAFPAE"
FT   gene            complement(44243..45412)
FT                   /locus_tag="Saro_0040"
FT   CDS_pept        complement(44243..45412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0040"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24489"
FT                   /db_xref="GOA:Q2G2Z5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z5"
FT                   /protein_id="ABD24489.1"
FT                   /translation="MNYETTIDAEGAQALGSLADGEDSASQSRRKWIIGVAVVLLVVLA
FT                   WWFLHGPSEPAGPAKTQAQVVTVVVPGKTVIAGTITASGTIAARREMPVGVAGEGGQIV
FT                   QVLVDAGDWVRAGQVLAVIDRSVQGQQIASQAANVEVAAADARLAQANLDRALKLVERG
FT                   FISKADVDRLTATRDAAVARVRVARASLGELGARAARLNIVAPAAGLVLTRAAEPGQIV
FT                   SSGSGVLFSLARDGQMEMQARLAEADLARLTVGATAEVTPVGTTRVFNGQVWQLSPTID
FT                   QQSREGIARIALSYDPALRPGGFASATLRSGTVTAPLLPESAILSDDKGTFVYVVGSDN
FT                   KAQRRDVKTGEVGARGISVVQGLAGNERVVLRAGGFLNPGDAVQPVLAK"
FT   gene            complement(45711..46010)
FT                   /locus_tag="Saro_0041"
FT   CDS_pept        complement(45711..46010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0041"
FT                   /product="protein of unknown function DUF1153"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24490"
FT                   /db_xref="GOA:Q2G2Z3"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z3"
FT                   /protein_id="ABD24490.1"
FT                   /translation="MIENQKIRPAQVIGPLGEPLTLESLPPPTTTRWVVRRKAEVVAAV
FT                   NGGLLTIDEVCERYSLTLEEFASWQRAVDRSGMQGLRVTRIQHYRDLYERQLKY"
FT   gene            complement(46025..46357)
FT                   /locus_tag="Saro_0042"
FT   CDS_pept        complement(46025..46357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24491"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z2"
FT                   /protein_id="ABD24491.1"
FT                   /translation="MDMSFNDPGAFVPANAAGELRPLTWQGLCARIVAAQDLRRALAGF
FT                   VEADGAAATGSFHGQAARFIASGFSGIPAHGEGSEQLVNQPSSANGKATLATQRGSNDR
FT                   GAVGLR"
FT   gene            46499..47653
FT                   /locus_tag="Saro_0043"
FT   CDS_pept        46499..47653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0043"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24492"
FT                   /db_xref="GOA:Q2G2Z1"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2G2Z1"
FT                   /protein_id="ABD24492.1"
FT                   /translation="MPRTSALSGASSLFDLDGPMSARRIVVAMSGGVDSSVVAGLAAAT
FT                   GAEVIGVTLQLYDYGAATGRKGACCAGDDIRDARAVADRLGIAHYVFDHESSFREEVVE
FT                   RFADDYLSGRTPIPCVRCNMGPKFTDLLAMARELGADCLATGHYVRRVMGPAGPELHRA
FT                   VDPARDQSYFLYGTTEEQLAFLRFPLGGLPKTETRLIAEELGLAVAAKPDSQDICFVPD
FT                   GDYARVVRSVRPEGDAPGEIVHAATGEVLGTHRGIIHYTVGQRRGLEIGGQPEPLYVIG
FT                   LDAPSRRVLVGPRPMLAVASATIVETNRIGPLPDAPLTAKVRSLARPVPVVLEGSFGEG
FT                   ASARIRFSQPEYGVAPGQAAVLYAGDRVVGGGWIDSTERWEIEG"
FT   gene            complement(47669..48058)
FT                   /locus_tag="Saro_0044"
FT   CDS_pept        complement(47669..48058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24493"
FT                   /db_xref="GOA:Q2G2Z0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Z0"
FT                   /protein_id="ABD24493.1"
FT                   /translation="MSMATGNHSSPTDRLRDAPSLTVAPRPNRKLRWALVGVGLLALLV
FT                   AVFWPSIRGYGVTGASYGARVACSCRFAGGRTLSDCRKDFEPGMGLVTLGEDADARSVT
FT                   ARAGLLFSQTATYREGWGCVLEPWK"
FT   gene            48084..49208
FT                   /locus_tag="Saro_0045"
FT   CDS_pept        48084..49208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0045"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24494"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Y9"
FT                   /protein_id="ABD24494.1"
FT                   /translation="MARRSLSLILMIALLPAVAGCSRGTNAPDAPPPLSDGALAAVAQS
FT                   PGVNREKLARAVDRLFDKEADETRAVIVMKNGRIVAERYGEGYHENTRFVSWSMAKSIT
FT                   GVMIGMLVSDGRLRLDETAPVPAWQRPGDPRGEITLRQLLQMRSGLRHSEAIEPVYESD
FT                   EVRMLFLDGRDDMARYAEDQPLEAEPGRRFEYSTATSVILADLAARVLSPANDPESRRH
FT                   AVAEYLRTRLFEPARMKSMLPEFDAAGTLVGGSLIHGTARDWAKFGEFLRNKGSVRGAQ
FT                   IIPRQWIEFMVTPSARESQYGAQIWLNRSPTSGDPALFPERGPKGLFACIGHLGQYVLV
FT                   SPSRGLVIVRLGKTQDDRLEPVRERLADIVALYR"
FT   sig_peptide     48084..48158
FT                   /locus_tag="Saro_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.629 at
FT                   residue 25"
FT   gene            complement(49205..50020)
FT                   /locus_tag="Saro_0046"
FT   CDS_pept        complement(49205..50020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0046"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24495"
FT                   /db_xref="GOA:Q2G2Y8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Y8"
FT                   /protein_id="ABD24495.1"
FT                   /translation="MTDSKVPYFHVDAFAARPLGGNQAAVMILEAWPDDATLQAIGAEN
FT                   MFAETAFLVADYTGEADFELRWFTPAVEVPMCGHATLASGHVVLGQDPMRGRVTFRTRK
FT                   AGILEVSRDGDRYVLSLPAVATEPGSFDEAVPLLGAPVPVEVWQGPGYNIFLYASADDV
FT                   LALSPDFKALLRFGDVQFIATAPGAGHASGAEIVSRVFVPGGGIDEDAATGSAHAALTP
FT                   FWAARLGKTAFAAHQASARGADFACRLEGGRVLLGGDCVTVVEGLFRLP"
FT   gene            complement(50017..50994)
FT                   /locus_tag="Saro_0047"
FT   CDS_pept        complement(50017..50994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0047"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24496"
FT                   /db_xref="GOA:Q2G2Y7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G2Y7"
FT                   /protein_id="ABD24496.1"
FT                   /translation="MDMTRADTHADLNRKAALASTLVALLLVGMKVWAVVSTGSAAMLG
FT                   SLADTALDLVASLATLLGVWVASQPDDHNHRFGHGKAEALAAMFQVVLISISAIGLAFR
FT                   AVGQFLGQAQVAEAEAGVIVSAIAMVATFALLAYQRRVIRQTGSLAISTDNVHYKSDLF
FT                   LNLAVIAALVLDTSLGIRGADAVFAFGIALWLGWGAWGASQEAIEQLMDHEWPLEKRER
FT                   FLTVVAQHPELKGLHDLRTRTSGNRDFVQFHVWVDGRMTVTEAHRVMDEIEDKLMAEFP
FT                   GVEILIHPDPEGLVDEGAMGAENLLAPGPDGTSPAILAQGAPGA"
FT   sig_peptide     complement(50890..50994)
FT                   /locus_tag="Saro_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.979 at
FT                   residue 35"
FT   gene            complement(51006..51617)
FT                   /locus_tag="Saro_0048"
FT   CDS_pept        complement(51006..51617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0048"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24497"
FT                   /db_xref="GOA:Q2GCC6"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCC6"
FT                   /protein_id="ABD24497.1"
FT                   /translation="MNSERTAEAIPHADPLSIFESWFAEARASEPNDPNAMALATATAE
FT                   GVPSVRMVLLKGHGPDGFVFYTNLQSRKGGELAANHHVALLFHWKSLRRQIRIEGTIAK
FT                   VTPAEADAYFASRHPESRLGSAASDQSRPLPDRQTYLDRVDALRAQYPDGNVPRPAHWS
FT                   GYRVTPSAIEFWQDRDFRLHERRRFLADGQGGWTSTLLYP"
FT   gene            51839..52816
FT                   /locus_tag="Saro_0049"
FT   CDS_pept        51839..52816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0049"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24498"
FT                   /db_xref="GOA:Q2GCC5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC5"
FT                   /protein_id="ABD24498.1"
FT                   /translation="MADPYSILGVPRSASEKDIKSAYRKLAKELHPDTNKDNPKAAERF
FT                   SEVTRAYDLLSDKDKRARFDRGEIDAEGNPTGPFGGGFGGGFGGGQRGTQGGFRHDGGF
FT                   EGGFGGGPEGIDIGDIFEGLFGGRGGMGAGGGGAGMGGGFGGARRGPPPRGANVNYRLQ
FT                   VSFVDAATRANQRITLSDGKTIDLKLPAGLESGQQMRLAGKGEPGPGGNGDAIVTIEIG
FT                   NHPFYERDGDNIRLDLPISLSEAVHGAKVKVPTVDGAVMLTVAPGSSSGRTLRLKGKGF
FT                   TRKDGARGDQLVTLQIDIPADDADLKARLEGWQDMRNLRDKLGA"
FT   gene            52820..53854
FT                   /locus_tag="Saro_0050"
FT   CDS_pept        52820..53854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0050"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24499"
FT                   /db_xref="GOA:Q2GCC4"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC4"
FT                   /protein_id="ABD24499.1"
FT                   /translation="MEPGHLPPGAHPLVEVPDLSPEARRREALRWRAGLADAREKLGPG
FT                   SKAWEVVKRVWTGVFNDGSIHAGNLAYMIIIALFPFFITGAALFSFFGEASQRAAAIDT
FT                   VLIAMPPVVAATIEPAARSVIEARTGWLLWVGGIFGLWTVGSLVETIRDILRRAYGTRW
FT                   EHALWRYRLMSTGITLASVVLILLAIFAQVLIGAAQEVIEAFLPQFGDLVASLSLSRFV
FT                   PAFVLYAALWLLFISLTPGAYRGRDYPKWPGALFVTIWWIAVTTVLPGMLRTFFSYDLT
FT                   YGSLAGIMIALFFFWLVGLGMVVGAELNAALTETPEERDMLGQADDRARAIRNNETRSE
FT                   NENA"
FT   gene            53851..54654
FT                   /locus_tag="Saro_0051"
FT   CDS_pept        53851..54654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0051"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24500"
FT                   /db_xref="GOA:Q2GCC3"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC3"
FT                   /protein_id="ABD24500.1"
FT                   /translation="MTGLMQGKRGLIMGLANDKSLAWGIAKKLHEQGAELAFSYQGEAL
FT                   EKRVRPLAESLGSDFLIECDVSDMAALDQTFETLKARWPTIDFIVHAIGYSDKNQLRGK
FT                   FYDTTLDNFLMTMNISAYSLVAVTKRAAEMMPAGGSILTLTYYGAEKVVPHYNVMGVAK
FT                   AALEASVKYLANDCGPAGIRVNAISAGPIKTLAASGIGDFRYILKWNELNSPLRRNVTI
FT                   EDVGGAGLYFLSDLSSGVTGETHHVDAGYHTVGMKQEDAPDIALG"
FT   gene            complement(54739..55320)
FT                   /locus_tag="Saro_0052"
FT   CDS_pept        complement(54739..55320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24501"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC2"
FT                   /protein_id="ABD24501.1"
FT                   /translation="MMKRLIPAALIAASTFAGAAHAQDQGLVDPGGERVNQLIVYGNDP
FT                   CPVSEGNTITVCARKDEEERFRIPKALRDDPNAVVNQAWSQRVKAYETVGAFGTNSCSA
FT                   VGAGGATGCLGKLIDKAYAEKKNSPDVQFGKLIEEERAKRLQTIDADAAAEQGRVEQIE
FT                   KEYEARLKREREEAAAQADAQPSTTPPLRP"
FT   sig_peptide     complement(55252..55320)
FT                   /locus_tag="Saro_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(55425..55937)
FT                   /locus_tag="Saro_0053"
FT   CDS_pept        complement(55425..55937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0053"
FT                   /product="Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24502"
FT                   /db_xref="GOA:Q2GCC1"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC1"
FT                   /protein_id="ABD24502.1"
FT                   /translation="MTAKTAAMLRVDQAGEYGATRIYAGQLAVMGDRAPHAAEIAAMAA
FT                   QEADHRKRFDELIARRGVRPTALQPVWSAAGFALGAATALIGPKAAMACTAAIETEIDR
FT                   HYTEQLDELGDEDPELAAMIREFRDDEREHRDAALAAGAEQAPAYPVLFHAIRLGCRAA
FT                   IALSKRI"
FT   gene            complement(55939..56421)
FT                   /locus_tag="Saro_0054"
FT   CDS_pept        complement(55939..56421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0054"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24503"
FT                   /db_xref="GOA:Q2GCC0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCC0"
FT                   /protein_id="ABD24503.1"
FT                   /translation="MTPQKARNAAYLLALAIPAALMGGALVSQYVFGLFPCEMCWWQRY
FT                   PHIAAIVLALLALSMKGRGSGDLAVTLAALCIGASGLIGGFHAGVEYGWWEGVTACATV
FT                   AGGGDPLDAIMNAPVIRCDVAPWTLLGISLAGFNFLISTAGAVLVLALLGKSRRSA"
FT   sig_peptide     complement(56338..56421)
FT                   /locus_tag="Saro_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.651 at
FT                   residue 28"
FT   gene            complement(56435..57826)
FT                   /locus_tag="Saro_0055"
FT   CDS_pept        complement(56435..57826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0055"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24504"
FT                   /db_xref="GOA:Q2GCB9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB9"
FT                   /protein_id="ABD24504.1"
FT                   /translation="MHAHSRKAPRAMKSASFKFAGLLRVTALVSAVALIPATTAGLAAV
FT                   DARTGPEFGKLIAVYERVKANYVEPVDDEKLLKGAIDGMLATLDPHSSYLDARDFENLR
FT                   TQTEGSYGGLGLSVTMDDGAVKVIAPTKGSPADLAGVKAGDFITHLDGKLIYGGSLDEA
FT                   VDQMRGVPGTKIRLSVFRPGRDEPFDVTITRQIIELKPVEWEMRGNVGVISVSSFSADV
FT                   GTSVQKAWNEIRARSGGKVAGLVLDLRGNPGGLLDEAVALSDLFLDKGTIVSQRGRYAR
FT                   DNEVYPAEIDTKGDIAKGTPMIVLIDEGSASASEIVAGALQDQHRAVVMGQRSFGKGSV
FT                   QTLIPLTRDTAIKLTTARYYTPSGRSVQEGGIEPDIAVPQISDPDLRKRQLRSYRESDL
FT                   RGHLINEIKLEDKDLEKDKTEDPRFKMTAEELKAKDIKDFQLYYAVQTLSRTAPRGALA
FT                   AKVKG"
FT   sig_peptide     complement(57695..57826)
FT                   /locus_tag="Saro_0055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.710 at
FT                   residue 44"
FT   gene            complement(57928..59172)
FT                   /locus_tag="Saro_0056"
FT   CDS_pept        complement(57928..59172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0056"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24505"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB8"
FT                   /protein_id="ABD24505.1"
FT                   /translation="MTSRPALVSSLVCLALALAGIVGWRASAQQASAQQGSAYVDAGEA
FT                   GEVLRRAGQELARSRSRADQLELAARKATAEADRTAREAAAVAARIQQSEAEIQLAQAR
FT                   IALVERQRAALRARMAVRQEPVVRLTAALQMMARRPLAFGLVRSDSLRDTIYLRAVMET
FT                   MLPEVRRRTAGLRAEIQRGRKLQADARLAATQLRAGEQALATRRVQLATLESRQRLASR
FT                   EATGVASREADRAMALAEQTRDLSALMSRLEEDGALRTTLAALPGPVLPPNRPGEVLRV
FT                   TDSPAAVPSPAGPRLAWILPVSGRLVSGYGEKSPTGLTTGIALAPAGGAQVIAPAAGRV
FT                   AFAGPYRGYGRIVIVEHDGGWTTLVTNLGRIAATVGERVVQGSPIGTAGPGRPVLTVEL
FT                   RHDGAPINPLAQVRG"
FT   sig_peptide     complement(59086..59172)
FT                   /locus_tag="Saro_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.405 at
FT                   residue 29"
FT   gene            complement(59181..59606)
FT                   /locus_tag="Saro_0057"
FT   CDS_pept        complement(59181..59606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0057"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24506"
FT                   /db_xref="GOA:Q2GCB7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCB7"
FT                   /protein_id="ABD24506.1"
FT                   /translation="MLLHVIARGKIGRSPEAELVDRYARRISWGWKVTELPDRGGTVPP
FT                   PSHTPSRTVAMDERGRQLTSSEFAAILGRWRDDGVRETRFLIGAADGHDEALRESADLL
FT                   IAFGNATWPHMLARAMLAEQLWRATSILAGHPYHREG"
FT   gene            complement(59701..60162)
FT                   /locus_tag="Saro_0058"
FT   CDS_pept        complement(59701..60162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0058"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24507"
FT                   /db_xref="GOA:Q2GCB6"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB6"
FT                   /protein_id="ABD24507.1"
FT                   /translation="MRNTCAVEPLSLDSSATEAISRDMTSVQPLSAKADATAPQTYSPA
FT                   ALHDLVLKSLDDDQAQEVVSIPLEGKSSVADYMVIASGRSTRQVASMAQKLAERIKQNG
FT                   FGHVRIEGLPAADWVLIDAGDVVVHLFRPEVRTFYNLERMWAFGDQGAA"
FT   gene            complement(60203..60889)
FT                   /locus_tag="Saro_0059"
FT   CDS_pept        complement(60203..60889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0059"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24508"
FT                   /db_xref="GOA:Q2GCB5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB5"
FT                   /protein_id="ABD24508.1"
FT                   /translation="MAGARQRADSPLSAAAPLTGLFGGSFNPAHGGHRRVSLFAIGALG
FT                   LDEMWWLVSPGNVLKPVAGMAPLEARLASAMRQARGTRIRATAIERELGTRFTVDTLRA
FT                   IRRRYPRRRFVWIMGADNLAQFHRWKDWRAIAREMPIAVIARPGYDAVALASPAMAWLR
FT                   RWRQRPGQFVSGAMRSAPALTILRFDPDTRSASAIRAADPEWARRYRSAPVRDAVTHRP
FT                   VRRGKP"
FT   gene            complement(60853..62130)
FT                   /locus_tag="Saro_0060"
FT   CDS_pept        complement(60853..62130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0060"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24509"
FT                   /db_xref="GOA:Q2GCB4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GCB4"
FT                   /protein_id="ABD24509.1"
FT                   /translation="MSTQPATIADSATDLVEGLARAARSAQRQLARMDSPVKERALTLA
FT                   AAALRAAEAEILAANAQDMANGAANGLSSAMLDRLKLTPERLAGIADAVAQVAGLADPV
FT                   GEVISEAARPNGMVLQRVRIPVGVIGIIYESRPNVTADAAALCVRSGNAAILRGGSEAV
FT                   HSNRAIHKALVAGLAEGGVPAEAVQLVPTQDRAAVGAMLGAAGLIDMIVPRGGKSLVAR
FT                   VQADARVPVLAHLDGINHTFVHASADPAMAQAIVLNAKMRRTGVCGAMETLLIDATYPD
FT                   PHGLVEPLLDAGCELRGDARARAIDPRIAPAADNDWDTEYLEAILSVAVVDGLDEALAH
FT                   IARHASGHTDAIVAADQDVADRFLAEVDSAIVMHNASSQFADGGEFGLGAEIGIATGRL
FT                   HARGPVALEGLTTYKWLVRGSGQTRP"
FT   gene            62365..63528
FT                   /locus_tag="Saro_0061"
FT   CDS_pept        62365..63528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0061"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24510"
FT                   /db_xref="GOA:Q2GCB3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB3"
FT                   /protein_id="ABD24510.1"
FT                   /translation="MKLAPLRLREAVARVRGWFPDREFFMRAEGQVRFIRISSRLQMTI
FT                   AGAIAAALLLWVLVMAATLVSQFTAARDHAALLEREAAVASAENRVAKYRGGLEGVADD
FT                   LNRRQDFIEKAIEGTIGELPKDLPRGTVSDSTGEAAKTVRKVSAVLPEARRLAEVEARQ
FT                   LAFIERLTRFADARSVAAETAIRRVGLNPAMIRSASREGTGGPLIHLFTGRDETLDPRF
FT                   ARLGASLERMASLEKGLARIPNTLPASLEYISSGFGYRSDPFTGGPAFHAGLDFRGPVG
FT                   APIYAAAAGTVSFVGVRQGYGNVVEVSHGNGLLTRYAHMSRTQARVGQKVDAGAEIGKI
FT                   GNTGRSTGPHLHFEVRINDRPVNPRPFLEANRHVQEIRAGAGAQHRE"
FT   gene            63536..63886
FT                   /locus_tag="Saro_0062"
FT   CDS_pept        63536..63886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0062"
FT                   /product="protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24511"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB2"
FT                   /protein_id="ABD24511.1"
FT                   /translation="MAATFSVLGADLAVKGDLSATADLHIDGSVEGDITCAALVQGEKS
FT                   TVTGAIRAKSARLSGTVHGSIEAGELVILKSARIHGDVTYDALTIEQGAQVDGRFAHRV
FT                   HATDEPSLTLVS"
FT   gene            64024..64728
FT                   /locus_tag="Saro_0063"
FT   CDS_pept        64024..64728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0063"
FT                   /product="protein of unknown function DUF1013"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24512"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB1"
FT                   /protein_id="ABD24512.1"
FT                   /translation="MSNQPTYPLMPHATASWLVDNTALTFEQIAEFCGLHILEVQAMAD
FT                   DLAGQKYTGRDPIHSGELNQAEIDKGQANPDYKLKMQRAPISVSRTKGPRYTPVSKRQD
FT                   KPDGIAWILRNHPEVSDAQIGKLIGTTRTTIAAIRDRSHWNIGNINPKDPVTLGLCSQR
FT                   ELDAMVAKAAKRAGIEDDGLADSRLGSDRDALIEELRAEREAQAKAASEAAQEAEAAAW
FT                   LAARRAEGISDS"
FT   gene            complement(64795..65796)
FT                   /locus_tag="Saro_0064"
FT   CDS_pept        complement(64795..65796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0064"
FT                   /product="alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24513"
FT                   /db_xref="GOA:Q2GCB0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCB0"
FT                   /protein_id="ABD24513.1"
FT                   /translation="MNGIPATMTAMGWDAPGGPEVLRPENVRVPQPGPGQVLVKVAFAG
FT                   VNRPDVIQRQGFYPPPPDASPLPGLEIAGQVVAMGQGVTWPFIGTAVCALVAGGGYAEY
FT                   CIAEADQCLQVPTGLPMAQAAAMPETLFTVWHNVFERGMVAEGETILVHGGTSGIGSMA
FT                   ILLGKLFGVKVIATCGGPEKCEQALAIGAAHAIDYKAADFVEETLRLTEGRGVHMVLDM
FT                   VAGDYVARNLKCLADDGRHVTIAVQGGVRAEINMAEVMRRRLTLTGSTLRPRSRAFKGA
FT                   LASEIRDTVWPLVVEGALRPIMDQTFPLAEAAAAHVRMEQGAHIGKIVLAVG"
FT   gene            complement(65835..66218)
FT                   /locus_tag="Saro_0065"
FT   CDS_pept        complement(65835..66218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA9"
FT                   /protein_id="ABD24514.1"
FT                   /translation="MHAGPVHRIQEWSRPYGQDRYGNAARRKEGRRASSRVAPVGTRRR
FT                   RASEKGLGGRAMGSRPVAVIDGPHDLEFEQADAFVQFVVRIGVEHLGCQLAGQVTFGAR
FT                   ALILIHCGQQCAHGRLAVNALHG"
FT   gene            66339..68717
FT                   /locus_tag="Saro_0066"
FT   CDS_pept        66339..68717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0066"
FT                   /product="ATP dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24515"
FT                   /db_xref="GOA:Q2GCA8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA8"
FT                   /protein_id="ABD24515.1"
FT                   /translation="MPSFAQSLEKTLHTALANASERSHEYATLEHLLLALIDDPDAAQV
FT                   MQACGVDLGDLGDVVRQYLDQEYQSLKTQEKADPQPTAGFQRVIQRAILHVQSSGKDTV
FT                   TGANVLVALFSERDSYAVYFLQQQDMSRLDAVSFISHGIGKGGRQVDGRTPKGAEEDVP
FT                   KQQEEKADAKGQKKETALDQFCVNLNEKALAGKVDPLIGRGPEVDRTIQILCRRSKNNP
FT                   LYVGDPGVGKTAIAEGLARKIVEGEVPEVLSEAVIYSLDMGSLLAGTRYRGDFEERLKQ
FT                   VVSELEKMPHAILFIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFR
FT                   NHFEKDRALLRRFQKIDVNEPTVEDTIKILKGLRTAFEEHHKVKYTPDAIKTAVELSAR
FT                   YINDRKLPDKAIDVIDEVGAMQMLVPPSKRKKTITAREIEQVIATMARIPPKSVSSDDK
FT                   KVLEHLERDLKRLVFGQDKAIEVLSSAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVA
FT                   RSLAQIMGIPLQRFDMSEYMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQQPHCVLLLD
FT                   EIEKAHPDLFNILLQVMDNGRLTDHHGKTVDFRNVVLIMTTNAGASDMARQGIGFGDVS
FT                   KADAGDEAVKKMFTPEFRNRLDAIVPFAYLPPEVVSRVVDKFVLQLELQLADQNVHIQF
FT                   DADARAWLAKKGYDRLYGARPMARVIQEKVKKPLAEELLFGKLANGGEVHVSLKQEEGQ
FT                   EGALSFELTPAAPKLVNKKKGKKSKAGDTTAEEPNADEA"
FT   gene            68777..69850
FT                   /locus_tag="Saro_0067"
FT   CDS_pept        68777..69850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0067"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24516"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA7"
FT                   /protein_id="ABD24516.1"
FT                   /translation="MRQGHPAPRALEPEAATGHFMTMAPPFSWLRPEPHGLHVVPADAW
FT                   VDPARAVDTALVTHGHADHARGGHGRTVATPETLAIMALRYGVMEAGSQPVGYGETVTL
FT                   RGDVRATYYPAGHVLGSAQILLEHAGERVIITGDYKRRPDPTCPPFEVVPCDVFVTEAT
FT                   FGLPVFRHPPIAQEMGKLLAARENDAGRCVLVGAYALGKAQRVIAELRAAGFADTIWLH
FT                   GAMERMCRLYEDHGVDLGDLRPVAGVPKAALANAVIVCPPSALNDRWSRRLPDPVTAMA
FT                   SGWMRVRQRVRQRNVELPLVISDHADWDELTATIADVNPSETWITHGREEALLRWCELT
FT                   QRRARALALAGYEDEDD"
FT   gene            69911..71506
FT                   /locus_tag="Saro_0068"
FT   CDS_pept        69911..71506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0068"
FT                   /product="DNA ligase (ATP)"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24517"
FT                   /db_xref="GOA:Q2GCA6"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA6"
FT                   /protein_id="ABD24517.1"
FT                   /translation="MNRFAALLDALVLTPSRNAKLLLLADYLRETPDPDRGWALAALTD
FT                   GLDFPAVKASTIRALMAERIDPVLWTLSRDYVGDTAETASLLWPEPIGDRLPAPSVAEV
FT                   VDTLHAATRGTAPGILAELLDRLDVNGRYALLKLATGAMRIGISARLAKVAFAQAFDVR
FT                   VDDVEEYWHGQAPPYLPLFDWAANGAPPPRTDLLPLFRPFMLAHPLEAERLDLAEFAAE
FT                   WKWDGIRVQIVHVAGETRVYSRSGDDISATFPEIADALDRPCVLDGELLVRGAHQGGET
FT                   GGAASFNALQQRLGRKTVSKAMLRDYPAFVRLYDVLIEGAEDLREWAWEQRRARLETLA
FT                   PQLHPERFDLSQVIPAGSFDELAEIRGRSRDEAIEGVMLKRRDSPYVAGRRTGLWYKWK
FT                   RDPLLIDCVLMYAQRGSGKRSSFYSDYTFGCWNGDPDAGAELLPVGKAYFGFTDEELKW
FT                   LDRHVRQHTVAKFGPVRETDKSLVFEVAFDSVHASKRHKSGVAMRFPRISRIRTDKPAH
FT                   EADRLETLKALIAD"
FT   sig_peptide     69911..69970
FT                   /locus_tag="Saro_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.607) with cleavage site probability 0.603 at
FT                   residue 20"
FT   gene            71824..72219
FT                   /locus_tag="Saro_0069"
FT   CDS_pept        71824..72219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0069"
FT                   /product="globin"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24518"
FT                   /db_xref="GOA:Q2GCA5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA5"
FT                   /protein_id="ABD24518.1"
FT                   /translation="MATEAPALSPYDRIGGREVLRRITDRFYDLMDTDPAYAELRAMHA
FT                   PDLSPMREALAGFLSGWCGGPRGWFEANPGKCMMSMHKPFPITRQTATQWADCMSRAIA
FT                   DAAPEDTEVADAMAQVLGQMAKGMARD"
FT   gene            72269..72907
FT                   /locus_tag="Saro_0070"
FT   CDS_pept        72269..72907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0070"
FT                   /product="protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24519"
FT                   /db_xref="GOA:Q2GCA4"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA4"
FT                   /protein_id="ABD24519.1"
FT                   /translation="MIHYDRNRRRFAIALAAMAGFVDAVGFLSADGYFVSFMSGNTTRL
FT                   GVALGTGPSTALMPLVLIAGFVGGVALGALVSRRAGTFRKPAVVALVTTLLLAAATGRA
FT                   LGLPAVMLCGLVMAMGALNNTFQRGGEVAVGLTYMTGALVKLGQGLAAHLAGERATGWT
FT                   SWAQLWSGLLAGAVLGAFLQDRLPQGCLWIAAAWSALMAGIAFRLPAES"
FT   sig_peptide     72269..72343
FT                   /locus_tag="Saro_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.832 at
FT                   residue 25"
FT   gene            complement(72885..73172)
FT                   /locus_tag="Saro_0071"
FT   CDS_pept        complement(72885..73172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0071"
FT                   /product="protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24520"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA3"
FT                   /protein_id="ABD24520.1"
FT                   /translation="MARPRADLPPAAALLALADPEGRLAVRVTPGAKSEGIEIDGGRVL
FT                   VKVRAKPEDGKATAAVQELLARALGLAPSKVEMLRGATSREKLFRIPREA"
FT   gene            complement(73153..73716)
FT                   /locus_tag="Saro_0072"
FT   CDS_pept        complement(73153..73716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0072"
FT                   /product="transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24521"
FT                   /db_xref="GOA:Q2GCA2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA2"
FT                   /protein_id="ABD24521.1"
FT                   /translation="MHPDVSIIPLNGKTPRIHESAFIAPGCRIIGDVEIGPDVSIWYNC
FT                   VLRGDVNFIRIGARTNIQDGSVIHVDSPAPGKPEGFPTIIGEDVLVGHLAMVHGCVIED
FT                   RGFVGLGAIVMSGAHIESDGMLAAGAMLTGGKRIGARQLWGGRPATYMRDLTEPALVEM
FT                   QRGVQHYVRNGQAHKAAVLGASEG"
FT   gene            complement(73731..74723)
FT                   /locus_tag="Saro_0073"
FT   CDS_pept        complement(73731..74723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0073"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24522"
FT                   /db_xref="GOA:Q2GCA1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA1"
FT                   /protein_id="ABD24522.1"
FT                   /translation="MTSYPMTRLRRTRATAWSRAMHREVLVTPADLIWPLFVTEGEGVE
FT                   DPISSLPGVSRWSVDGIVARAREAVALGIPCLALFPNTQPDRRSEDGREALNPDNLMCR
FT                   AIRAIKDACGNDIGVLTDVALDPYTSHGQDGLIDGEGYVLNDRTVEVLVGQSLNQAAAG
FT                   ADIIAPSDMMDGRIGAIREALEDAGHVNVQIMSYAAKYASAFYGPFRDAVGSRGLLKGD
FT                   KKTYQMDPGNAEEALREVEMDLAEGADSVMVKPGLPYLDIACRVKQAFGVPVFAYQVSG
FT                   EYAMIEAAVAAGAADRDAMVLETLVAFKRAGCSGVLTYHAAHAARLMGA"
FT   gene            complement(74760..76301)
FT                   /locus_tag="Saro_0074"
FT   CDS_pept        complement(74760..76301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0074"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24523"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GCA0"
FT                   /protein_id="ABD24523.1"
FT                   /translation="MMALAAAGGAGGFGLRTTPPSRAASPASASRLPAYLNGLERHLTR
FT                   HWRPLAARIERWFAARDLAPDLAEDIGSARWFRGFGTMLALGAAAVFFWPDFAPLQAAP
FT                   LTALDSAATDEFRVQGIRPLAYGADNGRRMNATAAVIPLAAAPERPSVDLAATLGAGDS
FT                   FPRMLQRAGLSSVDIVRVLDLVGGQVSPGTIPAGTRFAIRLGARTSPAQPRPLEQLSFR
FT                   PRFDLALDVHRSGGGLTLASNAIAVDTTPMRVRGIVGQSLYRSARAAGAPPTAVQDYLR
FT                   AIDQHMAFEEIAPGDEFDLVFANRRASSGEQQPGDLIYAGVVRAGKPVLQLLRWGNDGG
FT                   FYSPQGMAEGAQERESFLGAPVNGRITSGYGARRHPILGYVRMHAGIDFAAGWGAPIYA
FT                   ATDGRVTFAGWHGGHGNYVRLDHGGGIGTGYGHMSRIAVAPGMSVRRGQVIGYVGSSGL
FT                   STGPHLHYEMYRGGQTVNPLSMGAITTRATVDPAQLAAFRARLAQVTAIHANALR"
FT   sig_peptide     complement(76230..76301)
FT                   /locus_tag="Saro_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.947 at
FT                   residue 24"
FT   gene            76481..77512
FT                   /locus_tag="Saro_0075"
FT   CDS_pept        76481..77512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24524"
FT                   /db_xref="GOA:Q2GC99"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC99"
FT                   /protein_id="ABD24524.1"
FT                   /translation="MTGGDLAGALAAARTVEPTAGDHTAPGHTHETACLNCGTALIGSH
FT                   CHACGQAAHVHKTLGAFFHDLLHGVFHFEGKIWRTLPLLVARPGQLTREYIDGRRASYI
FT                   SPIALFLFCMFLLFTTISSLSGDIGTKAQTSVAAALEQERNDLRELEASRTASATDPAE
FT                   LAKVDKALAETRDNIAALEKLQTTGITVGNVSTEGLDNISDVPAIAEAVRIWKENPRLA
FT                   LYKVQTYSYKLSWALIPISVPFLWLLFPFSRRFGLYDHTVFVTYSLCFMTLLAILAMLG
FT                   SKVGIPGLGLLALVPPVHMLLQLRGTYGVTWFGAWWRTWFLSMFAFTALMLFGVLILVE
FT                   AGG"
FT   gene            complement(77647..79581)
FT                   /locus_tag="Saro_0076"
FT   CDS_pept        complement(77647..79581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0076"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24525"
FT                   /db_xref="GOA:Q2GC98"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC98"
FT                   /protein_id="ABD24525.1"
FT                   /translation="MNDDQPQGNPWIKSLLVWGGIFLALLLVVSMFGSRVDQTAATIPY
FT                   SAFRSQVSDGLVRSVEIAPERITGTLKNGGQFATIPVPGDSDLPKLLQDNGVQYAGKAA
FT                   EQPNMLMYILVNSLPFLLILGVAFFALRQVQKGGGSGAMGFGKSKAKMLTERSGRVTFD
FT                   DVAGIDEAREELQEIVEFLRDPSRFSKLGGQIPKGALLVGSPGTGKTLLARAIAGEAGV
FT                   PFFTISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIVFIDEIDAVGRHRGHGLGNSNDE
FT                   REQTLNQLLVEMDGFEANEGIIIIAATNRPDVLDPALLRPGRFDRQVVVPIPDIEGREK
FT                   ILSVHMKKVPLAPDVNPRTIARGTPGFSGADLANLVNEAALLAARRNKRLVAMQEFEDA
FT                   KDKVMMGAERRSMVMTDDEKKMTAYHEAGHAIVSVHEPASDPIHKATIIPRGRALGMVM
FT                   RLPERDSYSYHRDKMHANLSVSMGGRVAEEIIFGHDKVSSGASSDIQYATSLARSMVTK
FT                   WGMSDKLGPLQYEDQQEGYLGMGGSQRLFVSDETNKLIDMEIRGLVDGAHERARDILKT
FT                   NEDKLHLLAQALLEYETLTGDEIKELLETGHIDRPQSPSGPSRPVTAQGSAVPRAGKKF
FT                   GGSASPQPA"
FT   gene            complement(79691..80671)
FT                   /locus_tag="Saro_0077"
FT   CDS_pept        complement(79691..80671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0077"
FT                   /product="tRNA(Ile)-lysidine synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24526"
FT                   /db_xref="GOA:Q2GC97"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC97"
FT                   /protein_id="ABD24526.1"
FT                   /translation="MGEGGESLSGAASRFRADWQALDPSGRVCLAVSGGPDSLALMLLM
FT                   QEVAPRDFCVATVDHGLRAESAAEAAMVAGLCEMRGIAYHTLRLDLAGGSAVQERARKA
FT                   RYAALADLARRDGLSAVVTAHHADDQAETLVMRLNRGAGLRGLAGMRAASSVPGAGEVR
FT                   LLRPLLGWRRAELVALVEDAGLAPVLDPSNHDHRYERVRIRDVMASTKALLPSGFAASA
FT                   SHLAEADAALEWAVERLWLDIGMSAEGSTWNPPEDLPRVLALRLLERVVMHLGGTVPRG
FT                   PDLVRWLATLRAGGVATLAGVKGDARSGAWRFSRAPEHRSDRRPD"
FT   gene            complement(80685..81668)
FT                   /locus_tag="Saro_0078"
FT   CDS_pept        complement(80685..81668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24527"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC96"
FT                   /protein_id="ABD24527.1"
FT                   /translation="MTITIRGRLPLVASLAALGLGLGLPLAVPVAAQSSTTKATTQVDP
FT                   EMRLRRMEAEIRAIQRKVFPDGAGKTFVPEITPGQSTAAPVGTPAAPAVSDLLARMDAV
FT                   EAQLSRMTAQIEEGQNRAARLEERLAKLEAAAAPPPAEEPAAEAPAVPAAKPAAVTPAP
FT                   AKPAATPAKPAAGKPVAPPAARVAAVQAIEKPSTGDAGMDEYSYGFRLWEGKFFPEAQQ
FT                   QLQIFVDRYPKHRMISFGRNLLGRAWLDDGKPGTAAQFFLQNYLADKKGARAPDSLLYL
FT                   GVAMVKLKDTEKACGAFAELAATYPDEVAGRLKGQYDAARAGVKCK"
FT   sig_peptide     complement(81570..81668)
FT                   /locus_tag="Saro_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.885 at
FT                   residue 33"
FT   gene            complement(81777..82778)
FT                   /locus_tag="Saro_0079"
FT   CDS_pept        complement(81777..82778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24528"
FT                   /db_xref="GOA:Q2GC95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC95"
FT                   /protein_id="ABD24528.1"
FT                   /translation="MAEAGGLNDISNIDTTPFPAGEPRRGGVGETLRAAREAAGLDIKQ
FT                   LSLRTRVTTRHLEALESGDYSVLPGRPYALGFAKSYARAVGLDDKAIGEAVRAELNRQA
FT                   PPPPPRVINQFEVGDPIKTPSRLTGWLAAGLVVAIAAAGLTLWRSYYLPSAELPPLVGA
FT                   EEASPAPSQVAVVPLPSAAPSGPVVFTARENGVWVKFYDGQGQQILQKELAKGETFTVP
FT                   SGAQNPMLWTGRPDALDITVGGQAVPRIAEREGIVKDVPVSAAALMARGTTPAPAAVSA
FT                   GAEQTSQVAPSAPRPRPAVARRPVVAQPSASPVSDLRPAESTETVAPSTGMN"
FT   gene            complement(82906..85185)
FT                   /locus_tag="Saro_0080"
FT   CDS_pept        complement(82906..85185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0080"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24529"
FT                   /db_xref="GOA:Q2GC94"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC94"
FT                   /protein_id="ABD24529.1"
FT                   /translation="MPMLSAVAAARQILTSLHEVMASRSGAQAKLNQIVEVIGENLDSE
FT                   VCSIYLLREGMLELFATRGLNQAAVHVTRLAVGEGLVGTIAGNVETLNLAEAAAHPDFA
FT                   FRPETGEEKFHSFAGVPIVRRERAVGVVAVQHVEPRRYEEVEIEALQTVAMVLSELIAN
FT                   AELIDDEETLGVPAHLTGPDRLKGLTLVKGLASGVAVYHQPRVTIEHVVAEDTEAERQR
FT                   VYLAFDKMREQIDRMASQAEFGVGGEHEEVLETYRMFAYDEGWSRRINEAIDSGLTAEA
FT                   AIERVQQRTRMRMRQIDDPLLADRMHDLEDLSNRLLRIVSGQLGTAASMGLKGDAILIA
FT                   RNLGPAELLEYDRRRLKGVILEEGSLTAHVVIVARAMGIPVVGRMRALRGKVREGDQLL
FT                   LDGDQGVVDVRPAPSLVEAFEARFAKNRERQAHYAAMREVEPVTRDGRRITVLMNAGLR
FT                   DDTPMLNLTGADGIGLFRTEFQFLVSATLPSRERQTRLYRDVIDAAGDRPVVFRTVDIG
FT                   GDKVLPYLRHNDGETEENPAMGWRALRVALERDGLLKVQARALLEAAGGRTLNVMFPMV
FT                   TEPWEFDAAKAVFEGQLAFLRRQKKLLPEAIRYGAMLEVPALAECLDLLAPKLSFLSIG
FT                   TNDLTQFLFAADRANPKLAERYDWLSPAILRFLRRVVRTLEPFGTDVTVCGEMGGRRLE
FT                   ALALLGLGINRLSITPAAVGPVKELVRKVDLGEIRAAMDGWLADPPHDLRSAIAEWAFF
FT                   KGIECD"
FT   gene            complement(85389..85547)
FT                   /locus_tag="Saro_0081"
FT   CDS_pept        complement(85389..85547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24530"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC93"
FT                   /protein_id="ABD24530.1"
FT                   /translation="MESSHISALQTKHAGLERQIEMEMARPLPDDTLVATLKRKKLKIK
FT                   EELSRFH"
FT   gene            85777..85974
FT                   /locus_tag="Saro_0082"
FT   CDS_pept        85777..85974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0082"
FT                   /product="protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24531"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC92"
FT                   /protein_id="ABD24531.1"
FT                   /translation="MTEEEMRKRLAALRLEHRDLDAAIDALSTAGVRDQLQIARLKKRK
FT                   LLLKDQIAMIEDYLIPDIIA"
FT   gene            86066..86605
FT                   /locus_tag="Saro_0083"
FT   CDS_pept        86066..86605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24532"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC91"
FT                   /protein_id="ABD24532.1"
FT                   /translation="MAGMPCPDYATVMAFMPSLNPRIVDALHAQALGLADAVRTRFEAL
FT                   RREALDAAGSDCEDLHRVRVSCEALRTTTRVMHCLAWLLNHRAYFAGELSQLQLRRHGR
FT                   LITNFPASEPEVVASLPDDARTLVHESERLYERIQRLENAWRTQGASSESAIDALRQRL
FT                   VRAVAGTSDAGTSDAA"
FT   gene            complement(86610..88079)
FT                   /locus_tag="Saro_0084"
FT   CDS_pept        complement(86610..88079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0084"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24533"
FT                   /db_xref="GOA:Q2GC90"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC90"
FT                   /protein_id="ABD24533.1"
FT                   /translation="MSGDLVLVIDAGTTSTRALLFGRDGRCHGVMQSEFAQHYPRPGQV
FT                   EHDADEIWRATLGCMREVVGVVGIERIAAIGVTNQRETVVAWDRTTGQPLARAIVWQDR
FT                   RTAPMCDRLRSEGAEPLVQSRTGLLLDPYFSGTKMRWMLDNEPAVAGAARDGRLALGTV
FT                   ESWLVWKLTGGARHVTDASNASRTLLLALDGADWDEELLDLFGVPRAVLPEVTDSLGEF
FT                   GAALPEWLDASVPVRGLAGDQQAATIGQGCLAPGEVKATYGTGAFVLAAMGDAVPRSGH
FT                   RLLGTVLVQDKGVRSFALEGSVFVAGSLIKWLRDAMGLVGSAAETAALAASVPDSGGVV
FT                   LVPALSGLGAPHWRPDASAALTGMTFSTTRAHVVRAALEAMAHQTLDLMDAFAADRAPW
FT                   TSLRIDGGMSANDWVAQDLADILDLPVERPVMVETTALGAGMLAAVASGWFGSLGEAEA
FT                   MRGSVTRFEPRMAPGVRAARIARWREALAKV"
FT   gene            complement(88076..89545)
FT                   /locus_tag="Saro_0085"
FT   CDS_pept        complement(88076..89545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0085"
FT                   /product="homodimeric glycerol 3-phosphate dehydrogenase
FT                   (quinone)"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24534"
FT                   /db_xref="GOA:Q2GC89"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC89"
FT                   /protein_id="ABD24534.1"
FT                   /translation="METPYDLAVIGGGVNGAAIARDACGRGLSVLLLERGDLAQGTSSA
FT                   STKLIHGGLRYLEHREFALVAEALHERETLWRQAPHIIWPMRFVLPIVPEGRPWWMLRA
FT                   GLWLYDRIGGRKALPPASRVRLDGRMGLQPEIRRGYEYSDCWVDDARLVVLLARDAADR
FT                   GAEVRTRCPVTALRREGHLWRIEAGGDVFHAAMTVNAAGPQVGEIMDRAHAPRPALLRR
FT                   VRGSHIVVPRLHDDPRALFLQLADGRIYFAIPWQYAFTLIGTTDSEEGADADPPHATEE
FT                   EIAYLLDAANHYFRRSLRREDVVWTYAGVRLLADDGSGRPEAATRGYRLEVDRGRDRHS
FT                   APMLSVLGGKITTHRTLAEAALERLGVTDNAGWTASAPLPGGDFTPDGLDEADNLAPVE
FT                   QEIAAQAQQLSRPTIHRLARAYGTEALGFVRGDMGRHIGQGFTEAELDHLTGREWAQTA
FT                   EDVLWRRSKLGMWFSAEEVAALKAALGEEVR"
FT   gene            89584..90519
FT                   /locus_tag="Saro_0086"
FT   CDS_pept        89584..90519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0086"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24535"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC88"
FT                   /protein_id="ABD24535.1"
FT                   /translation="MHGASTIPIAHGMAQTPPIPDRESWPTGLSEQLEPLVRRVLAPNP
FT                   SPYTFTGTQTYIVGAGREVAVLDPGPDGADGEGHVDAILAAVGDARIVAIVCTHTHRDH
FT                   SPASRPLQAATGAPIIGCAPLAMEDDGPRADASFDALYLPDRVLSDGERLSGDGWTLEA
FT                   VATPGHTSNHLCYSLVESGALFTGDHVMGWSTSVVSPPEGDMAAYMASLQRLHDREDRV
FT                   LYPAHGPQIDNPRQLVRGMLGHRRQRERQIVRLLEDGGPHAIEEFVGAMYKGLDPRLNG
FT                   AAGRSVLAHLIDLERQGRVRIEDERWMIHA"
FT   gene            90501..91166
FT                   /locus_tag="Saro_0087"
FT   CDS_pept        90501..91166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24536"
FT                   /db_xref="GOA:Q2GC87"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC87"
FT                   /protein_id="ABD24536.1"
FT                   /translation="MDDPRLTNPTVPSTAPTTRDGTLARVSLLPWALFLVTLAAAAFLA
FT                   WKLWQPEDIGDPLATSLVAFEKQDKLTVFSAELAPVVSSDDARLFGLVKSKQVAVIPAR
FT                   VDYTVNLAKVGRERLAWNAPDQTLTVRLPPLTVSRPNLDEARAQYLRDGIWISREAQDK
FT                   LTRDNTRLAEAQAVQQAANPVLMELARGAAKEAIRQNLSIPLQVAGYGKAQVVVTFDQ"
FT   gene            91248..91976
FT                   /locus_tag="Saro_0088"
FT   CDS_pept        91248..91976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24537"
FT                   /db_xref="GOA:Q2GC86"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC86"
FT                   /protein_id="ABD24537.1"
FT                   /translation="MATAATSTAYPYSRDQRFFTRMAIGMALFVVFAFGQWALRGFSSP
FT                   TTAPVWVHLHGIAMLSWLALVVVQNQLAASGNIALHRKLGWTGLGLVFVVAGLGMFTGR
FT                   MAIELHRVPPFFSNAYFLALTHFGVLIFAAMVIAAIAMRRNTQWHRRLMTGAMILILEP
FT                   AIGRLVPAPILGPVLTPVSEATFQLCVVGVMAMHDVKVRGTVHPATRISALAVIVLFAL
FT                   VMGLSVFPPFVSLAEGIAAG"
FT   gene            92038..93036
FT                   /locus_tag="Saro_0089"
FT   CDS_pept        92038..93036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0089"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24538"
FT                   /db_xref="GOA:Q2GC85"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC85"
FT                   /protein_id="ABD24538.1"
FT                   /translation="MTVQPANLSGLDLRAEIDRLRKERKAVILAHYYQRPEIQDLADFV
FT                   GDSLELSRKAAATDAEVIAFCGVKFMADTAKILSPEKIVVLPDLDAGCSLEDSCPPDKF
FT                   KAFREAHPDHIALTYINCSTEVKALSDVIVTSSSAETILSQIPPEQKIIFGPDRHLGGY
FT                   LNRKFGRDMLLWPGVCIVHEAFSETELLKLKAQHPDAPVAAHPECPPHIVDHADYVGST
FT                   SGILQYAKTMTGDTLIVATEPHIIHQMELAMPDKTFIGAPGADGNCNCNICPYMALNTM
FT                   EKLYLALRDLSPRIEIEEDMRLAAKKSLDRMLDMASGTVGLGDLGARPFGS"
FT   gene            complement(93172..94065)
FT                   /locus_tag="Saro_0090"
FT   CDS_pept        complement(93172..94065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0090"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24539"
FT                   /db_xref="GOA:Q2GC84"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC84"
FT                   /protein_id="ABD24539.1"
FT                   /translation="MTNSSEPGPTLRPRPMHFLALLTGNVALALGPWFVRLADSGPVSA
FT                   GLWRLALALPLLAIFALRGREPMWGYQRKDWAIIVGAGVVFALDLASWHVGIERTRLGN
FT                   ATLFGNSGSVILMVWGLIAMHRRPHLREFAAVALALGGAGLLLGRSMEIDTRTLAGDLF
FT                   CILAGLFYVVYILLVQHVRGRFGSWSLLFWSSLAGCPVLLVTALALGEPVLPGTWWPLV
FT                   GLMLASQIVGQGLLVYSLRHFPPLVIGLVLLTQPAVSVVVGWLSFGEVLALPDAIGMAL
FT                   VGAALVLARLGEGKSA"
FT   gene            94149..95252
FT                   /locus_tag="Saro_0091"
FT   CDS_pept        94149..95252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0091"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24540"
FT                   /db_xref="GOA:Q2GC83"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC83"
FT                   /protein_id="ABD24540.1"
FT                   /translation="MHEPLFQPVRLGAIEAPNRIIMAPLTRGRANPQAVPTPIMGEYYR
FT                   QRASAGLIISEATAISPEGAGWPSAPGIWTDEQTEAWKPIVDEVHAAGGRIVLQLWHMG
FT                   RVVHPYFLGGEPPVSASATRAPGHAHTPEGTKDYETARPLRLDEIPRLIDDYGRAAENA
FT                   RKAGFDGVQLHAANGYLIDQFLRDGTNLRDDDYGGSPENRVRLMREVMERLISIWGKER
FT                   VSIRLSPNGDSQGVDDSNPEATFGEAARVLEELGVGFVELRQPGPEGTFGNTDVPKQDG
FT                   LIRSIYTGPLVLNSDYTPEEAAADVASGRADAISFGRPFISNPDLVERIRVGAHLNPNK
FT                   GVPATWYFPGEAGYTDYPTLAEETAIA"
FT   gene            95267..96148
FT                   /locus_tag="Saro_0092"
FT   CDS_pept        95267..96148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0092"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24541"
FT                   /db_xref="GOA:Q2GC82"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC82"
FT                   /protein_id="ABD24541.1"
FT                   /translation="MPPRSWLFVPGDSEKKLGKAMATGAHAVIVDLEDAVAPAAKPQAR
FT                   VLARDWLGIHRQHVTENRPVARWVRINAIDTGMWREDLQVVMAGAPDGVMLPKCEGPEQ
FT                   VRQLAAEIYELEQRNRVPNGSTRILPLVSETAKSALTITSYVDEPMPRLAGLTWGAEDL
FT                   SAVLGATRKRDAAGAWTDAFRFIRAQCLLTSHAKGVWAIDTLHDDFRDEAGTKRAAEAA
FT                   RADGFTGMLAIHPSQVPIINTAFAPTEAELAEAEAIVALFAASPYAGTLQYNGRMVDQP
FT                   HLRMAKQLLGRT"
FT   gene            complement(96131..96439)
FT                   /locus_tag="Saro_0093"
FT   CDS_pept        complement(96131..96439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24542"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC81"
FT                   /protein_id="ABD24542.1"
FT                   /translation="MNFRSICLAACLPLPLLVAGCNRKADEGKAAAGAEVLPGSISDAM
FT                   IDLDTSTASPPLAPVKAQGSRKAEGASASEAAEEPAATPATPAASASASAPASGSAE"
FT   sig_peptide     complement(96362..96439)
FT                   /locus_tag="Saro_0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.612 at
FT                   residue 26"
FT   gene            complement(96436..97104)
FT                   /locus_tag="Saro_0094"
FT   CDS_pept        complement(96436..97104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0094"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24543"
FT                   /db_xref="GOA:Q2GC80"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC80"
FT                   /protein_id="ABD24543.1"
FT                   /translation="MAASETIEIRRETAQVPYREALDAMASRNAAIAEGTAPELIWLLE
FT                   HPPVYTAGTSASPDELLDPRFEVVEAGRGGRYTYHGPGQRVGYVLLDLRKRARDVRGFV
FT                   HALEGWVIETLADFGVESWRAEGRVGIWTRGADGREAKIGAIGVRIRRWVTMHGFSVNL
FT                   SPDLAHFGGIVPCGIEEFGVTSLAALGREVTPDQWDEALLSHLDGFLARLDTPCPPEAA
FT                   "
FT   gene            97182..98003
FT                   /locus_tag="Saro_0095"
FT   CDS_pept        97182..98003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24544"
FT                   /db_xref="GOA:Q2GC79"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC79"
FT                   /protein_id="ABD24544.1"
FT                   /translation="MMPRLDSSLAWKTATRLVATNRDVLMAIAGVFFLLPGLAFSVFVP
FT                   EPQMAPGTPPGEMMEIMAEAWTSSLPLLIVVTLLQMAGTVTVLIVMTDPARPTVAQSIR
FT                   RGFMALVPYVLAQVMVGGALGMGFLVLVSAAALTGVQAIGAIAILAAFLAMVWCSLRMA
FT                   LVAPVLAIEAERNPVAALRRSWQLTRGNSGRMLAFFFLAGLLFAVVYGLAMMLVGVVLV
FT                   LTTGGSVQHVLNAAVSSAITSGALVYFIAMLAAVYRQFAGPPKEEMIQIFE"
FT   gene            complement(98012..98638)
FT                   /locus_tag="Saro_0096"
FT   CDS_pept        complement(98012..98638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0096"
FT                   /product="generic methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24545"
FT                   /db_xref="GOA:Q2GC78"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC78"
FT                   /protein_id="ABD24545.1"
FT                   /translation="MTSTQAARQPIIQRAKRKAERMLGPAGIFFKGFLKHPAMVGAIVP
FT                   SSNRTIERVLSKVNWEECRLFVEYGPGVGTFCRPVLEKLRRDGRLIVIDTNPDFIEYLQ
FT                   KTIGDSRFIAVHGSASDVEEIVRAHGFENADYVLSGLPFSTLPEGVGPAIMGATHRVLR
FT                   PGGAFLVYQYTARARDLMGQFFRHIDKGFEPLNVPPCVISWGWKE"
FT   gene            98769..100091
FT                   /locus_tag="Saro_0097"
FT   CDS_pept        98769..100091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0097"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24546"
FT                   /db_xref="GOA:Q2GC77"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC77"
FT                   /protein_id="ABD24546.1"
FT                   /translation="MTEGPIRLPKERMALLFAVMLVTAAGNTAMQSVMPSVGTRLGIAD
FT                   VWVSLAYSWSALLWVMMAPYWARRSDRRGRKAMMALGVTGFILSFAFCGAILHFGLDGW
FT                   FGAGLTMALFALARSLYGGFGSAAPPAVQAYVASRTGRADRTKALSLVASSFGLGTVLG
FT                   PALAPLMILPGLGLIGPFAVFALFGVIVLVLLRMRLPDDDPRFAARGEVMAAPFSASSN
FT                   PRMVEDRPDGSPDELPEAEPLHQGPDHLRWSDRRLRPWLLAGLIGGHAQAMLLGVIGFL
FT                   LLDRLGLRGDPDAGAGPVGLVLMAGAVATLLAQWGLIPMLGLGPRTSTLWGMGLAAAGV
FT                   IPVAMGNDLHTIAVGFALASVGFGLFRPGFTSGASLAVSPREQGQSAGIVASVNGAAYI
FT                   GAPAIGVWFYNHSQWLAWGAMEVLALGVVALCLVAMQKDPD"
FT   sig_peptide     98769..98864
FT                   /locus_tag="Saro_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.467 at
FT                   residue 32"
FT   gene            100138..101661
FT                   /locus_tag="Saro_0098"
FT   CDS_pept        100138..101661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0098"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24547"
FT                   /db_xref="GOA:Q2GC76"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC76"
FT                   /protein_id="ABD24547.1"
FT                   /translation="MTPSASAMAPSSTPQKVIARGVGSNAFSFVIRFAARASFLYVGAR
FT                   LYGAANYGVFTMASAMVELAVPVASLGLKRMIFPWLEEEAHGDSPRPATHVLLDALLLA
FT                   ACAGVAVALLLILGTRLLPASVVSDQLRLAFALLAPAVLGQVTGDIALAATRWTHKMRY
FT                   EVIARGLVEPYVLTGVALVAWHAGLHDTGMLLGYWAGSIALAGFSLWSARHCLGSLQMR
FT                   RWRPNLNGLAHRARSLVPASGSDFLTNLAQRIDLYLVGFLLGDAAVGVYGVLRQLRTPI
FT                   LQVRQAFDGILTPLTARTLKTDGELATGEATAAATRVILTIQLGVVLLMAAAGDALLDL
FT                   FGAHYATGYSALLAMVLAETINGAFGVSELILYYRRPALALKVNLILIAIAAATIPLLT
FT                   PHYGILGASMAMLLAAVVAALLRRYWLAGLGVRRHPLHAAVPAVAAGVSVLLGAYAGWV
FT                   VRMSLLQGAPAGLVKATPPLLALAFYLLFVWGWRKARPGILSLDRYRVS"
FT   gene            complement(101654..102610)
FT                   /locus_tag="Saro_0099"
FT   CDS_pept        complement(101654..102610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0099"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24548"
FT                   /db_xref="GOA:Q2GC75"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC75"
FT                   /protein_id="ABD24548.1"
FT                   /translation="MTRLAGAGDAKRPKRPREMQDALNFYLYHPLAWRLAKVLSRTPLT
FT                   PNMVSVIGGLLVVAAGAVYFNMDSTGGTWQLGWPWGALLGMILHMSWHVVDGADGDLAR
FT                   LTGKSSPIGEMVDGVCDYLSHIIVYVLLAFVLTRQIGAGPAWAWTLAAGASHIVQSNHV
FT                   EVQRRFYQYWTYGVPWLNNARDKGGDLFGSRGLVARFFESIARGYLYLAAGMTPYARRI
FT                   DAAVGSAMAAGDETRLQAIRAEVAREQKPLLRFLKLLGPNPRAIVLGLAMIAGSPVWYF
FT                   FYQAVVLNVLLLISVRLHNRAAMATANRVDGPAPALS"
FT   gene            102849..103934
FT                   /locus_tag="Saro_0100"
FT   CDS_pept        102849..103934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0100"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24549"
FT                   /db_xref="GOA:Q2GC74"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC74"
FT                   /protein_id="ABD24549.1"
FT                   /translation="MREARLAGLVSCEVNGGAGWNPTAATRAEAVRLGGPMPVSFAGGN
FT                   TSVQGLVAVIRGDALPPAQAIADAVAGRNEPVEGVEITSGPGIDEAIARAVSAGRDAAA
FT                   RLEAAGRAILRGTAKPTDGIVSRHVNRPLSQAISTVALRIPGFRPVHATIGTAVIAMAM
FT                   FACLLLGGESGLVAGALLFQAASIFDGVDGEVARATWRTSPEGARMDSLIDAATNLAFL
FT                   AGVAFNLQLQGRIFAASLGYTGLALLAIGLFLIGRAAARSNAPFSFDLVKEHYRAKGAA
FT                   ADRTGSPVAGNSPSGGGEIRDTRPSQIMQWLTFMTSRDFFALVFALLIAGGLAALVLAL
FT                   FAIAAAGWLVAVILALVPKQA"
FT   gene            104030..105130
FT                   /locus_tag="Saro_0101"
FT   CDS_pept        104030..105130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0101"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24550"
FT                   /db_xref="GOA:Q2GC73"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC73"
FT                   /protein_id="ABD24550.1"
FT                   /translation="MKPIKVAVIGVGNCASSLVQGVAYYRNNNSSQGLIHDRIGGYGAG
FT                   DVDFVLGVDVDARKVGKDIAEAIFAAPNNTTVFQPNVPPTGAKVIMGRVSDGVAPHMTT
FT                   VGDKGFIVSDQPEATQADIVKALKDSGAEVLLNFLPVGSQNATEFYMECALEAGVAVVN
FT                   CMPVFIASTPEWEAKFREKRIPIVGDDIKAQVGATIVHRVLSSLFAARGVNVERTYQLN
FT                   TGGNTDFMNMLDRQRLGSKKESKTEAVQAMLAQRLDDENIHVGPSDYVPWQKDNKLCFL
FT                   RLEGAQWGNVPMNLELRLSVEDSPNSAACVMDAIRCCKVALDRGEGGALIGPSAYFCKH
FT                   PPQQFNDDVAAQMVEEYASVEKLAAE"
FT   sig_peptide     104030..104095
FT                   /locus_tag="Saro_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.763) with cleavage site probability 0.718 at
FT                   residue 22"
FT   gene            105225..105974
FT                   /locus_tag="Saro_0102"
FT   CDS_pept        105225..105974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0102"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24551"
FT                   /db_xref="GOA:Q2GC72"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC72"
FT                   /protein_id="ABD24551.1"
FT                   /translation="MDALIIAAGYGSRLADLSPSKPLTPVAGVPLIEIGVRQAMEAGVT
FT                   RVVVVTGHKADMVEAFLADLSQRAGIEIVPVRLSDWSTPNGHSVMAGATRCEGNYLLMM
FT                   ADHMFEADILARLLLEDRPERGVTLAIDRRTDNPLVDPDDATWVKMDDEGRITAIGKTI
FT                   APYDAVDCGAFLATPELAVAIREAIAEGKPGSLSDGMQRLADAGRAGTMDIEDAWWMDV
FT                   DDPRAHALAEELAPWHLARTFAAIGQD"
FT   gene            complement(106017..106511)
FT                   /locus_tag="Saro_0103"
FT   CDS_pept        complement(106017..106511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24552"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC71"
FT                   /protein_id="ABD24552.1"
FT                   /translation="MTKPRRMYAAAIAVAATAAALTGASTAASANAPNCAGPVSDTWIN
FT                   VTVDGVRNGNGLMAVTLYADEPRKFLVKKGSMYVGRVDATAPETKMCLFVPKPGVYALA
FT                   VYHDEDSSRNIKRSGVLGLPEEGFGFSNNPPTIASIPSFRSVRLNISKTGLSTRIHLKY
FT                   P"
FT   sig_peptide     complement(106419..106511)
FT                   /locus_tag="Saro_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.624 at
FT                   residue 31"
FT   gene            106888..107547
FT                   /locus_tag="Saro_0104"
FT   CDS_pept        106888..107547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0104"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24553"
FT                   /db_xref="GOA:Q2GC70"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC70"
FT                   /protein_id="ABD24553.1"
FT                   /translation="MTPLISPSILSADFARLGEEVRAIDAAGADWIHVDVMDGHFVPNI
FT                   TIGPMVVKALRPHTTKPFDVHLMISPVDGYLQAFADAGADIITVHPEAGPHIHRTVQAI
FT                   KALGKKAGVSLNPGTPAKMLDYLIDDVDLVLVMSVNPGFGGQSFISSQLRKIEAVRKMI
FT                   DKSGRDIHLEVDGGVDTRTIRSCVDAGADVLVAGTATFKGGPSQYAANIAALKGLG"
FT   gene            107549..109435
FT                   /locus_tag="Saro_0105"
FT   CDS_pept        107549..109435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0105"
FT                   /product="Heparinase II/III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24554"
FT                   /db_xref="GOA:Q2GC69"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC69"
FT                   /protein_id="ABD24554.1"
FT                   /translation="MENSGFPVIGSRQAAKAPHESAIPLAGSREEPLVDIADSYLPLDE
FT                   DQTAAPIADPTAVEPGRSLALADFAPPALGAGDRLVRLAYRMGLPASAIHPFRKRAKTR
FT                   LTATVTPPLPGDPAAGKALRAGHFLVHGFKSPIADTAFSGPRLPPPFERMVHGFRWLRD
FT                   LESGGTRAQCTQVAERILATWLKANPKPNPTPAWDVGNVGHRLLNWMIHAPLVLSGQDR
FT                   GFRSRMLHTIEDTARWLDRHVAKADDRLGEVAGWCAIVATGLLMADGKPRRLYGEAGLV
FT                   RALGELVSDDGGVLSRSPLCQIEAIELLVSLRACYDAIRSEPLPQIGTMLNLLVPPLLA
FT                   LLHGDGGLGNWQGAGAIEADRIEELVRATGVRTRPLRDARQWGYQRATAGKAVLQFDAG
FT                   PPPVARHARDGCASTLAFEFSHGPDRLIVNCGGAAFAGGLIPLRLEQGLRATAAHSTLT
FT                   IDDFNSTAVLINGRLGSGVSEVEVDRRTLSADGNGPGATRIEASHNGYVGRYGLTHRRI
FT                   LILRDDGSELRGEDLLVPAGRKGKRGTIGVALRFHLGPHIELATSADGKGVTLALPDGS
FT                   LWQFRSGRDAVSVEESLWADGQGRPLATRQLVVTAKVPRSGESFSWLLKKMR"
FT   gene            109446..111035
FT                   /locus_tag="Saro_0106"
FT   CDS_pept        109446..111035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0106"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24555"
FT                   /db_xref="GOA:Q2GC68"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC68"
FT                   /protein_id="ABD24555.1"
FT                   /translation="MTEVTIKRALLSVSDKSGLVDLGKALAARGVELLSTGGTAKALRD
FT                   AGLAVKDVSEHTGFPEMMDGRVKTLHPTIHGGLLAVRDNPEHAAAMAEHAIGAIDLVVV
FT                   NLYPFEATVAKGAEREEVIENIDIGGPSMVRSAAKNHEYVTILTDAADYAAFLGELDQT
FT                   GGATTLAFRRKMAAKAYAATAAYDAAISQWFATVDQQEHFPPVLAAAHTRVTTLRYGEN
FT                   PHQDAALYVPRNPAVTGLPQATQVQGKELSYNNYNDANAALELVAEFAGAKPTVVIVKH
FT                   ANPCGVATAETLLEAWKDALECDSVSAFGGIVATNVPLDGPTANAICEIFTEVVVAPGA
FT                   DDAAKEAFARKKNLRLLLIDSLPDAGRKGLVTVPIAGGLLVQDRDAGKIDKSDLKVVTK
FT                   RAPTERELEDALFAWTVAKHVKSNAIVYAKDGVTAGIGAGQMNRRDSSRIAAAKAREAA
FT                   ETHHFSEVRTVGSAVASDAFFPFADGLMAAVEAGATCVIQPGGSIRDEDVIKAADEAGL
FT                   AMVFTGMRHFRH"
FT   gene            111131..112870
FT                   /locus_tag="Saro_0107"
FT   CDS_pept        111131..112870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0107"
FT                   /product="CBS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24556"
FT                   /db_xref="GOA:Q2GC67"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC67"
FT                   /protein_id="ABD24556.1"
FT                   /translation="MLKRLPALLRWLRKQVRASELVFLALAIGVGMAGGLFTVILGAAA
FT                   RTVQHVLYDLPPDLRLSAAPSLPLSVLIVLPLGGLVLAAFNWAAGVRRRALVDAVEANA
FT                   LHGGRMSAMDSAVVAGQTVISNGFGASVGLEAAYAQVGGLFGSLGARLLSLRRPDARIL
FT                   VGAGAGSAIAAAFGAPLAGAFYAFEIVIGAYTPSAIAPVVAAALAGAQVARRLGVVPYV
FT                   VSAEPGPAIHTAGYIAYGGLGAVCALLGIVLMRAVALVETGSRKAIPGPWRPAIGGLLL
FT                   IPLAMLTPQALSAGHSALHLDMTETLSLAFVAMILLVKSASSIVSLGFGFRGGLFFASL
FT                   FLGTLVGHLYAGLLALGLGHPVLNIGNASLVGMAALAVAVVGAPFTMAMLVLEATGNFS
FT                   LTGAVLAASLVSSTLVRELFGYSFSTWRLHLRGETITSARDVGWVRTLTAGRMMRRGMA
FT                   TIDGSATIAELRRRFPLGSTSRVVVTDTSGKYAGIVTIAAAFADGVNSEAAVTSVCHSA
FT                   QATLSPEQDIVQIMGRFDDLATDELAVVDMQGNVLGLVTEAHVRRRYAEELDKAQRDLF
FT                   GER"
FT   sig_peptide     111131..111268
FT                   /locus_tag="Saro_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.542 at
FT                   residue 46"
FT   gene            complement(112945..113574)
FT                   /locus_tag="Saro_0108"
FT   CDS_pept        complement(112945..113574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0108"
FT                   /product="cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24557"
FT                   /db_xref="GOA:Q2GC66"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC66"
FT                   /protein_id="ABD24557.1"
FT                   /translation="MSTKFRYAATLSIAATFITTLLSTSGSHAAAQGINAPVASVTTFI
FT                   SQPVVQPVAKPTAAIATQASEGEAGEAASSLAELVENTQAPDSLSNELECLAGAIFFEA
FT                   KSESLAGQLAVGRVIVARANSGRFPSSYCGVVFQPSQFSFIRGHAMPAINRNSRAWQNA
FT                   VRIAVIADEGLWKSPVEGAMFFHASHVSPRWGKVRMARVDSHIFYR"
FT   sig_peptide     complement(113485..113574)
FT                   /locus_tag="Saro_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 30"
FT   gene            complement(113790..114131)
FT                   /locus_tag="Saro_0109"
FT   CDS_pept        complement(113790..114131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24558"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC65"
FT                   /protein_id="ABD24558.1"
FT                   /translation="MSARLPAHAEVSGLIRLTQAAGGFAMVLNKGERDAGTLLIVIVEN
FT                   QGLATLHERMPQLDGTRKWTTTKHQLIENKKEFEDYLTRRMVQDPDVWIVELTVADRER
FT                   FVRDNLSQS"
FT   gene            complement(114133..114615)
FT                   /locus_tag="Saro_0110"
FT   CDS_pept        complement(114133..114615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0110"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24559"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC64"
FT                   /protein_id="ABD24559.1"
FT                   /translation="MTPPEPADSAHLHWRALEGLYASAPVNSLFESRLEIVAEGVSRIH
FT                   FEVTPSCFHAAGAAHGTIYFKMLDDAAFYAANTLVTDRFLLTTSFNLFFTRPIQGGRVT
FT                   AEGRWVSGRRRVLVAEARLIDEEGEEVGRGTGTFQRSRIPLSGLDGYNAGLRAALG"
FT   gene            complement(114602..115063)
FT                   /locus_tag="Saro_0111"
FT   CDS_pept        complement(114602..115063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0111"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24560"
FT                   /db_xref="GOA:Q2GC63"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC63"
FT                   /protein_id="ABD24560.1"
FT                   /translation="MTALFTISPQAVRVIRAETKQQILADLSRCFAEVYALDAETVIEG
FT                   IEEREKLGSTGFGRGVAIPHARIDGLEKPVAAFFRLENPVEFAAADGMPVDCVFGLLSP
FT                   AQAGATHLQALAAISRLMRDERMHERLVSAPDAEAIYGLLVNVIDRDAA"
FT   gene            complement(115237..115818)
FT                   /locus_tag="Saro_0112"
FT   CDS_pept        complement(115237..115818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0112"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24561"
FT                   /db_xref="GOA:Q2GC62"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC62"
FT                   /protein_id="ABD24561.1"
FT                   /translation="MDIRVSGHQVDTGTALQSHAEERLGTIVDKYFSRALSSQVTLGKA
FT                   PHGGFRCDIVTHVAQGLILKGSAIAQDAHIALDQSADKIEKQLRRYKRRLKDRHEGADH
FT                   ARRADEANLAQDAAYTVFVHDEAGEDEPADAPLVIAETRVDVPTASVSDAVMMLDLRNT
FT                   NALMFKNAGTGVHNMVYRRGDGSIGWVEPR"
FT   gene            complement(115877..116569)
FT                   /locus_tag="Saro_0113"
FT   CDS_pept        complement(115877..116569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0113"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24562"
FT                   /db_xref="GOA:Q2GC61"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC61"
FT                   /protein_id="ABD24562.1"
FT                   /translation="MMREIVFDTETTGLDPRSGDRLVEIGCIEMFNRVPTGAVFHCYFN
FT                   PERDMPAEAEAVHGLSIAFLSDKPKFAEKADDLLAFIADSPMVAHNAGFDFGFINNELE
FT                   LCGREPVSRDRMVDTVAIARRKHPGAKLSLDALCSRYGIDRSHRTKHGALLDAELLAQL
FT                   YVELQGGRQIGLELAAQSAIAVTEEVVTVTSSVTRVFRSPRPHSASAEELARHAEFMAG
FT                   FSEPIWSR"
FT   gene            complement(116615..117220)
FT                   /locus_tag="Saro_0114"
FT   CDS_pept        complement(116615..117220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0114"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24563"
FT                   /db_xref="GOA:Q2GC60"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC60"
FT                   /protein_id="ABD24563.1"
FT                   /translation="MTRPFVMGLTGSIGMGKSAVALMLREMGVPVFDADAAVHQLQGPR
FT                   GPLLPAIEAAFPGTTGPEGVKRQDLGARVFGDADALRRLEAIVHPAVARMREAFMIEHM
FT                   GEPLVVFDIPLLFEKGHGKDLDAVMVVSAPAEVQRQRVLARPGMTVEKFAHILSLQVPD
FT                   AEKRARADYVIDTGLTLAETEGQVAELVRAIREKNPRG"
FT   gene            complement(117217..118089)
FT                   /locus_tag="Saro_0115"
FT   CDS_pept        complement(117217..118089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0115"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24564"
FT                   /db_xref="GOA:Q2GC59"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC59"
FT                   /protein_id="ABD24564.1"
FT                   /translation="MSTSPKTLPYAEVIGDPIAQSKSPVIHGFWLEALGLEGDYRRAHV
FT                   RAGELADYLAARRADTDWRGCNVTMPHKQAVIPLLDRLDPLAARIGAVNTIVPEDGALV
FT                   GYNTDAPGFLEPLRPLLDQVHYFRMARVLGTGGAARAIIAALADEHMVIVLAGRNVEKA
FT                   RALLDELHPEGEHHVAPLEHFSDETDFVFDDREGCLDLVVNASSLGMTGQPPLAFDMTH
FT                   APPGSVFYDIVTSPLETDFLKTAKAAGFRTVDGLSMLIGQADHAFRRFFGAVPPRGEAD
FT                   AQLRERLLA"
FT   gene            complement(118086..118673)
FT                   /locus_tag="Saro_0116"
FT   CDS_pept        complement(118086..118673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0116"
FT                   /product="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24565"
FT                   /db_xref="GOA:Q2GC58"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC58"
FT                   /protein_id="ABD24565.1"
FT                   /translation="MTIILASQSASRKAMLEAAGVPFEARSSNVDEASIKRELIAVSGC
FT                   EVASVLAEAKALPVSLAAPGRMVLGGDSLVEVCGRQFDKPVSRENAAEHLEFFSGKEMH
FT                   LHSAAVLMRDGRVVWKTCELAKLRVRTLSPEFIQSYLDREWPAVSGCVGVFRIEALGVQ
FT                   LFDQIEGSHFTVLGMPLMALLGALRAEGELPS"
FT   gene            complement(118670..119512)
FT                   /locus_tag="Saro_0117"
FT   CDS_pept        complement(118670..119512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0117"
FT                   /product="protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24566"
FT                   /db_xref="GOA:Q2GC57"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC57"
FT                   /protein_id="ABD24566.1"
FT                   /translation="MQRLHLHLLSDSTGETLEMIAKAALAQFDGADVVRHFWPMVRSMQ
FT                   HLDRIMGEIAANPGLVLYTLVNAETRERLEQRCAALGLPSVAALDAVTDALQQQLGIQA
FT                   KGRPGRQHMMDEAYFARVDAIQFTIAHDDGVGWENWEEADIVLAGVSRSSKTPTSIYLA
FT                   NRGYKVANIPIVVESPPPSMLFSLRRPLVVGLTTSPERLIAVRRNRLLSLNQAPETAYV
FT                   DNEQVTREVQFARRMFADNGWPVIDVSRRSIEETAAAVINLYNERTAAGASGDGVKPI"
FT   gene            119850..120875
FT                   /locus_tag="Saro_0118"
FT   CDS_pept        119850..120875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0118"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24567"
FT                   /db_xref="GOA:Q2GC56"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC56"
FT                   /protein_id="ABD24567.1"
FT                   /translation="MPGPLLKTLQGENISRRPIWLMRQAGRYLPEYRELRAEKGGFLAL
FT                   VYDTDAAAEVTVQPIRRFGFDGAILFSDILIVPYAMGQDLQFLAGEGPHLSPRLLDAAL
FT                   NSLVAVPGRLSPIYETVAKVKAQLSPETTLLGFAGSPWTVATYMVAGEGSRDHHDTRAL
FT                   AYRDPSAFQAIIDAITEVTIEYLSGQVEAGAEGLQLFDSWSGSLAPAEFERWVIAPNAR
FT                   IASAMQQRYPHVPVIGFPKGAGEKLSAYARETGVNAVGVDETIDPLWAARELPANMPVQ
FT                   GNLDPLLLLSGGPELERQTIRVLEAFADRPHVFNLGHGIGQHTPIENVEALLKIVRGWS
FT                   R"
FT   gene            120973..121398
FT                   /locus_tag="Saro_0119"
FT   CDS_pept        120973..121398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0119"
FT                   /product="conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24568"
FT                   /db_xref="GOA:Q2GC55"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC55"
FT                   /protein_id="ABD24568.1"
FT                   /translation="MLYLWLKAGHVIFVIFWMAGLFMLPRFFVYHQEAPEGSPENAVWV
FT                   DRERKLMKIIMWPALLVVWVLGLLLAVDIGAFQQGWFHLKLAFVLVLTAYHFWLANYAQ
FT                   LLASGVRKLSGKKLRMLNEIPGIAAAVIVIMVIVKPF"
FT   gene            121800..123056
FT                   /locus_tag="Saro_0120"
FT   CDS_pept        121800..123056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0120"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24569"
FT                   /db_xref="GOA:Q2GC54"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC54"
FT                   /protein_id="ABD24569.1"
FT                   /translation="MHLKDLKKKTPAELVQMAEELEVEGASTMRRQDLMFAILKEMAED
FT                   GEEILGIGTIEVLPDGFGFLRSPEANYLAGPDDIYVSPNQVRKWGLRTGDTVEGEVRAP
FT                   KDGERYFAITRLIKVNFDDPEAVRHRVNFDNLTPLYPNERLKLDTLDPTVKDKSARVID
FT                   LVSPQGKGQRALIVAPPRTGKTVLLQNMAKAITDNHPEVFLIVLLVDERPEEVTDMQRS
FT                   VKGEVISSTFDEPASRHVQVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSS
FT                   GKVLTGGVDANALQRPKRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGN
FT                   SEIVLDRKVADKRIFPALDVGKSGTRKEELLVPKDQLSKMWVLRRILMQMGTVDAMEFL
FT                   LDKMKDSKTNEDFFATMNQ"
FT   gene            123162..125729
FT                   /locus_tag="Saro_0121"
FT   CDS_pept        123162..125729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0121"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24570"
FT                   /db_xref="GOA:Q2GC53"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC53"
FT                   /protein_id="ABD24570.1"
FT                   /translation="MPATFPSMAQRIPAQPRKSAHTGVVKAVLGPTNTGKTHLAIERLC
FT                   AHSSGAIGFPLRLLAREVYDRVCAIKGADNVALITGEERIEPKGARWHLCTVEAMPSRP
FT                   DLAFVALDEAQLSADPERGHVFTDRLMHTRGREETMLLGSSTLEPMVKALVPEAEVVTR
FT                   PRFSTLTHVGAKKLSRIPPRSAIVAFSAEQVYVMAEMLRRFRGGAAVVMGALSPQTRNA
FT                   QVAMYQAGEVDYLVATDAIGMGLNLDVHHVAFAGLSKFDGHRQRRLTTAEMAQIAGRAG
FT                   RHQRDGTFGALAGMGGHDPEFTPEEIYAIEEHRFAPLTRLFWREAEPRFDSIATLIEDL
FT                   ESPPPRPELATPPQAIDLAVLKRLAEDVDIASGVRGQRSVQRFWDVCRLPDFRQQGYET
FT                   HSRFVARLWQDLRHGYLGADYVAQAIAQLDNPSGDIDTLQARIAAIRSWAYIAQRPDWV
FT                   LAKDEMSARARAVEARLSDALHARLTERFVNRRTAVLMRKAGADAGLLPVRLGDEGAVL
FT                   VDDEPIGHLEGFRFVVDPLARAEDRKLLLAAAERHLPGLLASRANVLVAAAGEPDGIEF
FT                   EDTALVWQDTVVARIERGRHMLSPRIKPDLALDRLAPGCKAEVLAALDGWFAAQHKRHL
FT                   APILALDEASRDPASGPELRALLLHLVESGGVLPREQSGLDRLDPAQRDRLRKLGVRIG
FT                   SLDLFLPAALRPAAMQAWHRLARIWSRPLPLPPESMQPVVHAKIAPAGYRRLGNECLRV
FT                   DLAEKLLHAAHRTRLGTKARRVFLDPAVARSMNLSTAAYAALLRAGGFRVHMGRALPER
FT                   AFGPPQPPLWDWRPSRATTASDAPPPPRPPIGAFAALADLVGR"
FT   gene            125747..126037
FT                   /locus_tag="Saro_0122"
FT   CDS_pept        125747..126037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0122"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24571"
FT                   /db_xref="GOA:Q2GC52"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC52"
FT                   /protein_id="ABD24571.1"
FT                   /translation="MRIDKFLWFTRFAGTRNLAQGWVEDGHIRLNGRRIERCSADVRLG
FT                   DVLVLPMRSRVTVIEVLALPARRGPAPEAQACYRVLDGPGATPLARPQTDT"
FT   gene            126051..126389
FT                   /locus_tag="Saro_0123"
FT   CDS_pept        126051..126389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0123"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24572"
FT                   /db_xref="GOA:Q2GC51"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC51"
FT                   /protein_id="ABD24572.1"
FT                   /translation="MTYVVTDACIRCKFMDCVEVCPVDCFYEGENMLVINPSECIDCGV
FT                   CEPECPAEAILPDTESGLEQWLELNAKYSAEWPNITAKKDAPADADEHKGEEGKFDKYF
FT                   SAEPGEGD"
FT   gene            126726..127250
FT                   /locus_tag="Saro_0124"
FT   CDS_pept        126726..127250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0124"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24573"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC50"
FT                   /protein_id="ABD24573.1"
FT                   /translation="MAGKALAFDVGDYVVYPKHGVGRVVELQDEEIAGMKLQLYVLRFE
FT                   KERMTLRVPVNKVEAIGMRKLSSDKTLREALDTLKGKPKVKRTMWSRRAQEYEAKINSG
FT                   DLVSIAEVTRDLFRADDQPEQSYSERQIFEAASSRLARELAAMEKTDEPAALKKILAIL
FT                   NEHAPKYYETA"
FT   gene            127423..128208
FT                   /locus_tag="Saro_0125"
FT   CDS_pept        127423..128208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24574"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC49"
FT                   /protein_id="ABD24574.1"
FT                   /translation="MLQSFVRAMAGVAVLGIATMLGGCDAANVSFNGKKGVPLPELDLS
FT                   GPAPTTIALLGPDNVRVTQGEKLTITVEGEGADKLRFALSDGQLGITREDLKLGSSNGS
FT                   ATVNVTVPALSEIMLAGSGNLTADQVGGAGEAKIVVAGSGTVDARAIDTKSLKVDVVGS
FT                   GKLRAAGKAKEMKMTVAGSGDAEMDGLNVDEAKVDVAGSGNARFASNGHVNASIMGSGE
FT                   VRVFGRATCRVKSMGSGKLVCEGGVTPESGSTESAAGEQ"
FT   sig_peptide     127423..127503
FT                   /locus_tag="Saro_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.941 at
FT                   residue 27"
FT   gene            complement(128212..129159)
FT                   /locus_tag="Saro_0126"
FT   CDS_pept        complement(128212..129159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0126"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24575"
FT                   /db_xref="GOA:Q2GC48"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC48"
FT                   /protein_id="ABD24575.1"
FT                   /translation="MEPTKPSKVHPPDNHGLEHAAQVIAAGGTVAVPTETVYGLAARAD
FT                   DDAAVAGIYRAKGRPDFNPLIVHVPDVTAAEGLAVFDKRARALANAFWPGPLTMVLPRR
FT                   EGAALASAVSAGLPTVALRCPAHPVMQALLKNCGLPLAAPSANRSGGVSPTSAAHVAAS
FT                   LGQRVDLILDGGETRQGIESTIVGMRDDGTWAILRPGPITEASIAAVLGGKSDVVTSAK
FT                   IEAPGQLASHYAPGKPVRLNATQAGEGEFLIGFGSVVGDVNLSTSGDLAEAAARLYSCL
FT                   HLGAAASEPAIAVAPIPDEGIGTAINDRLRRAAA"
FT   gene            129220..130938
FT                   /locus_tag="Saro_0127"
FT   CDS_pept        129220..130938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0127"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24576"
FT                   /db_xref="GOA:Q2GC47"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC47"
FT                   /protein_id="ABD24576.1"
FT                   /translation="MSFTPPTADQILAIRVSAGIDELAQSERFAAATPDLVEAIVEGIG
FT                   AFAAGEWAPLHRAGDQVGAKCGNGRVTLPAGYVEAYRSFVEQGWGSINGPVDFGGQGLP
FT                   FTLATAVLETLGAANMGFTLLPILTVGAIEALDHHGSEAQKALYLPKLISGEWSGTMNL
FT                   TEPQAGSDVGALRSTATPITEGPHAGKYRIAGTKIFITFGEHDAAENIIHLVLARTPGA
FT                   PDGSRGISLFIVPKFHVEQDGSLGARNDVRCVSIEHKLGIHASPTCVMSYGDNGECIGE
FT                   MVGHENGGLRAMFTMMNSARINVGSQGVQIAERAFQQARTYARDRVQSTRAGAPGKNPV
FT                   AIIEHPDVRRMLMRMRALTEGSRALLYYTAGQVDRGALGNEAAQKRAELLVPMLKAWGT
FT                   DIGCEVASLGIQVHGGMGFIEETGAAQHLRDSRIAPIYEGTNGIQAADLVTRKLGYDNG
FT                   GVLQALMAEIAAEMEDVPEVAALAKDAAAIGQWMSSTASLDDKLAGSVPFTTMCAVAVA
FT                   GWQLARQSRASDLHSKIAVTKFFNRVIVPEARGLGSSAMAGAALLYDLDADALAG"
FT   gene            130935..131750
FT                   /locus_tag="Saro_0128"
FT   CDS_pept        130935..131750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0128"
FT                   /product="protein of unknown function DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24577"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC46"
FT                   /protein_id="ABD24577.1"
FT                   /translation="MTEALLTRIADALDRLVPPRAQSADWRAFPAYVWDGKAARGIDPL
FT                   EAPSLDLMQGIDKQKSAVVENVARLSRGAAAHDMLLWGARGMGKSALLRAATLAAQAAN
FT                   PGSIALVQASPDAGLADLFAILRTVDRRFLVFLDDLGFDAADTDGARKLRSWLEGGVEA
FT                   RPANVRLAVTSNRRAIVERHLSEQDDPVNPRDVVDDRLALADRFGLSLGFHNCTQDDYL
FT                   AIVAGYATHFGLAWEEADALEWSKRRGGRSGRVAWQYVNELAGRAGRAL"
FT   gene            complement(131784..133289)
FT                   /locus_tag="Saro_0129"
FT   CDS_pept        complement(131784..133289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0129"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24578"
FT                   /db_xref="GOA:Q2GC45"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC45"
FT                   /protein_id="ABD24578.1"
FT                   /translation="MSHCPCKAPGIDLRTMNLIKKILISLVVILVLVGAYVAWSVRGTP
FT                   AQFALNDTTGPRPKLADPDEQTIPTIKTADPIGWKDGEAPVAAEGLQVTRFADKLDHPR
FT                   TVFTLPNGDVLVAETNSPPRKVGGVTGIVMNFLMKQVGAGGPSPNKIVLLRDGDGDGRA
FT                   EQRFVMENPALDSPFGMAFRDGRLLVANHNAVLSFPYQLGQTSLSGKPEKLMDLPGGGN
FT                   HWARNLLLSPDGTQLFVTVGSASNIAEGGIDAERGRAAIHEYDFAKKRSREFAGGLRNP
FT                   NGLDFNPNSEELWTVVNERDQLGSDLVPDYLTNVPFGSNYGWPWAYWKKNIDWRVKEPM
FT                   PEYLMDYVRKPEYGLGAHVAPLGLAFARGGNLLGDKFQQGAFIARHGSWNRRPLSGYDV
FT                   VFVKFDALGNVLPKSPVPVLTGFLTEDQKARGRPTWVAFAKDGALLVSDDTGGVIWRVT
FT                   APGAKPAAEVKPLPKRAAPPQPKGTGKFIMKPNADSDLVKPQD"
FT   gene            133354..133836
FT                   /locus_tag="Saro_0130"
FT   CDS_pept        133354..133836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0130"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24579"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC44"
FT                   /protein_id="ABD24579.1"
FT                   /translation="MFTFAPTEGHSRAELHADLLEAARALTDGEPDGVANMANVAALIW
FT                   QFLPDLNWAGFYRMVEGELVLGPFVGKPACIRIPLGKGVCGTAAASGETQLVADVHAFP
FT                   GHIACDAASRSELVVPVLRDGGVIAVIDLDSPSPSRFDEEDARGIEALARAMAHRI"
FT   gene            133981..134679
FT                   /locus_tag="Saro_0131"
FT   CDS_pept        133981..134679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0131"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24580"
FT                   /db_xref="GOA:Q2GC43"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC43"
FT                   /protein_id="ABD24580.1"
FT                   /translation="MLRHLSLAALVFCAMTAPAVARDDDRSSAGGHGGWSGGWQGGYVP
FT                   GPVYYPPMFGPPYPTVVMAHPVDGPPPPVAYPQGYASPDPRWGEMIERCRKVQGDSGVG
FT                   GALLGGVAGGVVGNRVVDGNRTLGTVAGAAVGAIAGAAIDKAEDSDLRRECDDYFRSMP
FT                   RQAYGYPGGGYAPYGYMMVPVMLPPQKPCVETTVVTEKWVDEPVRSRYIPRRAPAVKEK
FT                   RVKEKRVYTG"
FT   sig_peptide     133981..134046
FT                   /locus_tag="Saro_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(134788..135942)
FT                   /locus_tag="Saro_0132"
FT   CDS_pept        complement(134788..135942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0132"
FT                   /product="Long-chain acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24581"
FT                   /db_xref="GOA:Q2GC42"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC42"
FT                   /protein_id="ABD24581.1"
FT                   /translation="MSLDLIPRTAYNEDHEAFRQTVRRFLQEEIAPNAEKWGDDGIVPK
FT                   SIWPKAGELGMLCPTVPEEYGGLGLDFGYNAIVDEESSYYGRVATGFSLQSDIVANYLV
FT                   SYGSEEQKKKWLPKMVSGEVITAIAMTEPGTGSDLQGMRTTAKKDGNHYVINGSKTYIT
FT                   NGQNADLILVCCKTDTEIQPAWKGVSIVLVEADREGFKRGRNLDKIGQDEADTSELFFE
FT                   DVRVPITNCLGEEGKGFIYLMSELPQERLSIAVGAQASAQKAFDDTVEFTRERKAFGKP
FT                   ILDFQNTRFTLADIKAKLQVGWAHLDWALSRHLRKELTPEEGAAAKLWHTELQWEVMDK
FT                   CLQLHGGAGYMNEYAIARAWRGARVTRIFGGTNEIMKELIGRKL"
FT   gene            complement(136094..137041)
FT                   /locus_tag="Saro_0133"
FT   CDS_pept        complement(136094..137041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0133"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24582"
FT                   /db_xref="GOA:Q2GC41"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC41"
FT                   /protein_id="ABD24582.1"
FT                   /translation="MSGEDAVKTPARRTGLGRGLGALMGEVRREEPIVRISVSGESATG
FT                   GEVRDGGLALLAVGSIEPHPEQPRRHFDEEALEELAQSIAARGVIQPVVVRPLGGNRYQ
FT                   LVAGERRWRAAQKAQVHEIPAIVRKLNDRDVAALALIENLQREDLNPVEEAKAYQRLAD
FT                   SEGLTQAEIAKFVDKSRSHVANMMRLLGLPDDVLDMVVRDELSMGHARSLINAPDPAGL
FT                   AREIVGKGLSVREAEKLVRKASRPESGRRQAREAKDPFGQADIAAIQQHLEDFLGLKVT
FT                   INADADPTTGAVTIRYKNLDQLDLICQRLTGGEF"
FT   gene            complement(137038..137814)
FT                   /locus_tag="Saro_0134"
FT   CDS_pept        complement(137038..137814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0134"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24583"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC40"
FT                   /protein_id="ABD24583.1"
FT                   /translation="MITVAVANQKGGVGKTTTAINIATALAATGWKSLLIDLDPQGNCS
FT                   TGIGIPAGERERSSYDLLIDQASIAECMMPTRIPGLDIVPATVDLSGAEVELVSVEDRT
FT                   HRLRNVLNADTGHDICLIDCPPSLGLLTLNALTAADTILVPLQCEFFALEGLSQLLQTV
FT                   ERVQERFNPDLGILGIVLTMFDRRNRLTDQVADDVRSCLRDLVFDAVIPRNVRLSEAPS
FT                   HGLPALIYDHACPGSQAYMKLARELIGRLPERRKAA"
FT   gene            complement(137811..138503)
FT                   /locus_tag="Saro_0135"
FT   CDS_pept        complement(137811..138503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0135"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24584"
FT                   /db_xref="GOA:Q2GC39"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC39"
FT                   /protein_id="ABD24584.1"
FT                   /translation="MTLVTEVEAQAWLREVLHVDDASMSRLAHLVDLLLAENERQNLVA
FT                   RGTLPHVWVRHIVDSAQLLHVSRETSGSGEWLDLGTGAGFPGLVIAAIQSDRPVTLVDS
FT                   RRLRTEWLQRAADALELSNVRVILSRVEDLESGAYAAISARAFAPLDKLLAISARFSTP
FT                   DTLWLLPKGAGAQHELQMLPESWHHMFHVEQSLTDPAAGIIVGRLLAGKQPAPHVSRQQ
FT                   APRKGKRT"
FT   gene            complement(138500..140359)
FT                   /locus_tag="Saro_0136"
FT   CDS_pept        complement(138500..140359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0136"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24585"
FT                   /db_xref="GOA:Q2GC38"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC38"
FT                   /protein_id="ABD24585.1"
FT                   /translation="MQQFDIIVVGGGHAGVEAAAVAARMGARTALVSFDPQTIGAMSCN
FT                   PAIGGLGKGHLVREVDALDGLIARAADASAIHYRMLNRSKGSAVQGPRVQADRKRFKAA
FT                   IQKMIAAQPDLHVVGGEVAALRLEQGRVTGVDLADGTALAGRAVVLCTGTFLGGRLFRG
FT                   EERMDGGRIGEDSAHRLAAQLRDAELPMARLKTGTPPRIDGRTIDWARLPEQPSDDDPW
FT                   TMSPLTPARPLPQVFCAIARTNARTHEIIRGGLDRSPLFTGAIGAQGPRYCPSIEDKIH
FT                   RFGDRDGHQVFLEPEGLDDFTVYPNGVSTSLPTDVQVAMIRSMEGLEQAVITVPGYAVE
FT                   YDHIDPRALRRSLEVKAIPGLYCAGQINGTTGYEEAAAQGLIAGMHAAAHVLGRAMPEL
FT                   DRANSYMAVMIDDLTLHGVSEPYRMLTARAEYRLRLRANNAASRLTPIGLAIGCIGDER
FT                   RKWFEDRSQARSRLETALAQPATPTELNRAGIPVRADGARRSLMEWLRFPEVTLDGLRD
FT                   WIGNEPFDPLLVEEVEEDAAYAPYLARQDAELRDLRASDAVPLGDGFPFADVPGLSREM
FT                   VERLERAQPDSLAAAGRIAGITPAALASLLVHARRRASAAVVA"
FT   gene            complement(140445..141758)
FT                   /locus_tag="Saro_0137"
FT   CDS_pept        complement(140445..141758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0137"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24586"
FT                   /db_xref="GOA:Q2GC37"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC37"
FT                   /protein_id="ABD24586.1"
FT                   /translation="MTDTIFALSSGQPPAGIGVIRISGPGAGAALSSLAGRLPSPRRAT
FT                   LATLADPRDGTHLDRTMVLWLPGPATATGEDCAELHLHGGRAVIAAVEAALSSLPGLRR
FT                   ARPGEFTRRAFANGRIDLAEAEGLADLLSAETELQRRTALAMAEGALSREVDEWRTTLL
FT                   QISARLEAALDFSDEDDVGAGDGTQRASLLPPHFAADCISLACSLNTWLDRPRAEPLKE
FT                   GFRVVLAGPPNAGKSTLFNALVEHEAAITAAEPGTTRDLLTHAAALDGVPFTFVDTAGL
FT                   RDEGAGEIERIGIARARAAAEKADLILWLGPEGLGPAGRTLWEIAARADDPGAGRKSQC
FT                   AFHLSAVTGEGMAAFRSALIAHARSALPAPGEAALNQRQHTHLSEVARALEDAAAEQDP
FT                   LLAAENLRLGRRGLDALVGRTGTEDMLDTLFGRFCIGK"
FT   gene            complement(141791..142051)
FT                   /locus_tag="Saro_0138"
FT   CDS_pept        complement(141791..142051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC36"
FT                   /protein_id="ABD24587.1"
FT                   /translation="MKVTVEVDCTPEEARRFLGLPDVSKANDVYVDTIAKAMQGVSSVD
FT                   QLHTYVKQLAPMGEIGLKLFQNFMEQGASGGFGGTRKPAKD"
FT   gene            142162..142860
FT                   /locus_tag="Saro_0139"
FT   CDS_pept        142162..142860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0139"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24588"
FT                   /db_xref="GOA:Q2GC35"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC35"
FT                   /protein_id="ABD24588.1"
FT                   /translation="MGEKITFAALDGEGEIPGYLATPDGPIRAAIIVIPEIFGVNAGIR
FT                   HKCEGWAAQGYMALAPDIFWRFAPGVELDPDVPEQMQEAFGYFQQYDADKGVKDIEAAI
FT                   RFLRGYEGIDKVGLVGFCLGGRMAYMAATRTDIDASVGYYGVMIDQMLNESHAIARPLM
FT                   LHIPTADHFVGPDAQKAIHDALDPHPRVTLHDYEGLDHGFAAEMGNRRDDDGAELADRR
FT                   TRDFFAQHLG"
FT   gene            142956..143342
FT                   /locus_tag="Saro_0140"
FT   CDS_pept        142956..143342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24589"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC34"
FT                   /protein_id="ABD24589.1"
FT                   /translation="MMKLGLAAWHRYMLSNDLALLDELVADDAVFHSPVVHTPQAGREK
FT                   VIMYLTAAGRVFGNGTFRYVRELVDGPEACLEFECEMDGIKVNGIDLVRFDLEGRIVDF
FT                   KVMVRPLKAINKVWELMAEQLQNT"
FT   gene            complement(143400..143744)
FT                   /locus_tag="Saro_0141"
FT   CDS_pept        complement(143400..143744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0141"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24590"
FT                   /db_xref="GOA:Q2GC33"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC33"
FT                   /protein_id="ABD24590.1"
FT                   /translation="MARVTVEDCVDKVPNRFDLVLLAAERARAISGGAELTVDRDRDKN
FT                   PVVALREIAEETVRPAVLKENLIQSLQRVLPDDDDEVDEIGSLSQSAEALRITAAAPVR
FT                   NTSLGADYDG"
FT   gene            complement(143844..145358)
FT                   /locus_tag="Saro_0142"
FT   CDS_pept        complement(143844..145358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0142"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24591"
FT                   /db_xref="GOA:Q2GC32"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC32"
FT                   /protein_id="ABD24591.1"
FT                   /translation="MSASEAILTREPSEIRALPSNVEAEAAFLGAVLIDNRILEELQTP
FT                   LKPEHFFAAVHGRVFERIQTLIDRKAVVTPVTLKPYFETDEGLKELGGTAYLARLTADG
FT                   QGLLNPRELAEQIYDLALLRELITVGRNLVEGALDTSDAVAPLEQVEKAEAALYAVAEG
FT                   AQTGSEAQSFGQATRTSLEMIEKALLSGGHISGKTTGLTSVNEKIGGLHDSDLIILAGR
FT                   PGMGKTSLVTNIAFNSADRLRRDMADGIAVKDSVGAAVAFFSLEMSADQLATRILAEQS
FT                   GISSEALRMGRISREDFQQLSFASQRLAELPLYIDDTPALTIGSLRARARRLKRRHDIG
FT                   LIIVDYLQLLQGSGRSDNRVNEISEISRGLKTLAKELSVPVIALSQLSRAVEQRDDKRP
FT                   MLSDLRESGSIEQDADMVWFVFREDYYVAAKEPKQPQGNDDPKVQEAHAAWQAEMERVY
FT                   GLAELIVAKQRHGSTGKVRLRFEARITRFSDLAPDDLRAAYSSNDE"
FT   gene            145505..145999
FT                   /locus_tag="Saro_0143"
FT   CDS_pept        145505..145999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24592"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC31"
FT                   /protein_id="ABD24592.1"
FT                   /translation="MGDPRISHIELDEATIIWRNADIEQERRIAIFDLIEENTFKPLRA
FT                   FEAGHEGPYRLKLSVEDGRLALTVSDDDGNGGGQLLETVILGLGRFRRPIREYFAICDS
FT                   YYQAIRKATATEIETIDMARRGVHNEAAEMLLERLQGKIDTDFATARRLFTLICVLHIR
FT                   G"
FT   gene            146028..146723
FT                   /locus_tag="Saro_0144"
FT   CDS_pept        146028..146723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0144"
FT                   /product="glycoside hydrolase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24593"
FT                   /db_xref="GOA:Q2GC30"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC30"
FT                   /protein_id="ABD24593.1"
FT                   /translation="MAKKRNTVRRRLLAALLLVVLVGAGAGWWTSRTWMPDRTRYPVQG
FT                   VWLSDDDGSVDWRFLRAAGADFAYLTASEGAGTRDSVYAAGVEAARLRGLQVGPVHVYD
FT                   LCAPADAQAANFVTVVPRDPELLPPAIALDIDSRTCPEPPGEAQMQSELTTFLNQVEKH
FT                   AEKPAILMVSRGLEKQYHLAAMIDRNLWVSQDFIEPGYAGRPWVMWTATKRLRLHGASG
FT                   PLRWVVVQP"
FT   sig_peptide     146028..146108
FT                   /locus_tag="Saro_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.853 at
FT                   residue 27"
FT   gene            146720..147157
FT                   /locus_tag="Saro_0145"
FT   CDS_pept        146720..147157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0145"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24594"
FT                   /db_xref="GOA:Q2GC29"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC29"
FT                   /protein_id="ABD24594.1"
FT                   /translation="MSIDLVAERREALVAAARTAMGTAYAPYSGFHVGAALLFEDGAIV
FT                   TGANVENASYGLSLCAETVACSIAAHAGRRGGLLAVAVSGGAGGRADAAISPCGRCRQV
FT                   LNELAALGGTDPLVICTSAKETVEMRLSALLPNAFGPANLA"
FT   gene            147206..147760
FT                   /locus_tag="Saro_0146"
FT   CDS_pept        147206..147760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0146"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24595"
FT                   /db_xref="GOA:Q2GC28"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC28"
FT                   /protein_id="ABD24595.1"
FT                   /translation="MAILSDKWIRDKALNEGMIEPFVENQRRDGCISYGLSSYGYDARV
FT                   APEFKIFTNVDSAVVDPKDFASNSFVDRETDVCVIPPNSFALARTVEYFRVPRDVLVIC
FT                   LGKSTYARCGIIVNVTPLEPGWEGHVTLEFSNTTPLPAKIYANEGACQFLFLQGNEPCE
FT                   VSYADRAGKYMGQRGVTLPRL"
FT   gene            147894..149066
FT                   /locus_tag="Saro_0147"
FT   CDS_pept        147894..149066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0147"
FT                   /product="Saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24596"
FT                   /db_xref="GOA:Q2GC27"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC27"
FT                   /protein_id="ABD24596.1"
FT                   /translation="MEKAERPYDVVVYGATGFTGRLVAEYLARHYGQEGPRWAMAGRSG
FT                   AKLAEVRALIEAPKNTPLIVADASDPASLADMVRQAKVVLTTVGPYQLYGEPLLAACVA
FT                   AGTDYADLCGEPVWMRQMIDKYGDDARHSGARICFSSGFDSIPFDLGVLMLQKEAVARF
FT                   GRPAPRVKGRVRGMKGGASGGTAASLKATLAALGKDPSLIPLMASPFCLTPGFEGPAQP
FT                   AGDKVQHDDALGSWETPFIMAAINTKNVHRTNALLGHAWGKDFVYDEMVLTGPGEQGKA
FT                   VAEHMAKTPMIGRPDDPLPGEGPSKEERETGFYDVLFVGEMPGGETIRYGVKGRYDPGY
FT                   GSTSRMIAETGIALLSSTAAGGIGTPGAILGETLVARLRAHAEIAFAPED"
FT   gene            complement(149157..149603)
FT                   /locus_tag="Saro_0148"
FT   CDS_pept        complement(149157..149603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0148"
FT                   /product="globin"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24597"
FT                   /db_xref="GOA:Q2GC26"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC26"
FT                   /protein_id="ABD24597.1"
FT                   /translation="MRIASEHAKTIVKATAPAIEKHGVDITTAMYKRLFQNDEVKAMFD
FT                   QAAQDSGEQPRRLAGAILAYAKNIDKLENLGSAVQRMVQRHVDTGVKAEHYPYVAEALL
FT                   PAIRDVLGAEVATDEVLAAWGEAYWMLADILIAAEKQAYLEAVA"
FT   gene            149630..150133
FT                   /locus_tag="Saro_0149"
FT   CDS_pept        149630..150133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0149"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24598"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC25"
FT                   /protein_id="ABD24598.1"
FT                   /translation="MLVFNLLDLIKRKIDTRYMQLTQHTDLGLRLLIVLARKGAAVSLP
FT                   AFSAEQGLSYHHVAKVAQALVHEGFATSQRGRSGGIALAREATNIRVGDVVRALERGMR
FT                   LADCGGCALRADCGLSGVLAEALEAFMAVLDRYTLADVSREGVPAFAPWTFAPPSPGCT
FT                   NRNP"
FT   gene            complement(150130..150531)
FT                   /locus_tag="Saro_0150"
FT   CDS_pept        complement(150130..150531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24599"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC24"
FT                   /protein_id="ABD24599.1"
FT                   /translation="MLALTLASCGGGGAMPAGKTTAIRSAPPPARTSVPRPAPVTRPYA
FT                   QVQMAPGLEGVIGADALQLGRVFGPPRLDVIEDDARKLQWSGTACILDVYLYPQPGSSR
FT                   PTATYVDARRGDGRDVDRAACVAALRKGS"
FT   gene            150718..151713
FT                   /locus_tag="Saro_0151"
FT   CDS_pept        150718..151713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0151"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24600"
FT                   /db_xref="GOA:Q2GC23"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC23"
FT                   /protein_id="ABD24600.1"
FT                   /translation="MSDPLYDVIAIGNAIVDVMAPCEDADIARLGLAKGGMTLVDTARA
FT                   KELYDAMGPAREISGGSAANTLAGLAALGANCAFIGQVADDQLGEVFAHDIRAGGIAFD
FT                   TPTRADEPPTARCLIFVTPDGQRTMNTFLGASQFLPAEALDDATIAAAQVLYLEGYLWD
FT                   PEEPRKAMRRAIAAARNAGRKVAFTLSDAFVISRHGDDFRALIDAGQIDILFANEHELA
FT                   ALTGIEDFHVGIEQLAAKVPTVVVTRSENGAHAISQGERAHVPAEPIAKVVDTTGAGDL
FT                   FAAGFLYGYVRGRPLAESLTLGAICAAEIISHYGARPEADLKDLVAQRLG"
FT   gene            complement(151725..153050)
FT                   /locus_tag="Saro_0152"
FT   CDS_pept        complement(151725..153050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0152"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24601"
FT                   /db_xref="GOA:Q2GC22"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC22"
FT                   /protein_id="ABD24601.1"
FT                   /translation="MTFTRRSLLAGAAATASLAVTARAQVIPPPGFATPSGTFPFPPEV
FT                   YRERRARLMSVLKDGVAVIHGAPRDQTGGPVSPPFHQSGDFAWLTGIADEPGAVLVLAP
FT                   DERTFREFLLLPSRDIETERWDVERLPLGSLIEARTGMQRVRRTGSLDALVTQIAARSR
FT                   TLHFMGPIVSASAPVPPAMDLYGRIMARVPGCTLKDQSALLPSLRTVKEPRELDLMRKA
FT                   LAATQAGHLAAMKAVRPGMTERQLTAVLEDGFRQGGGEGLSYDSIVATGRNAASLHYAH
FT                   GNATIGSQDLVLIDAAASVGGYACDITRTFPASGRFTAAQRADYELVLAAQDAAARLLK
FT                   PGVIHEDMTEAANAVFRKAGRIDEFTHGLGHFVGLDVHDAGDYAKPIPAGAVLTIEPGL
FT                   YNQQMNQGIRIEDLYLVTANGCERLSTGIPRTVQEIEAFMVR"
FT   sig_peptide     complement(152976..153050)
FT                   /locus_tag="Saro_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(153225..153653)
FT                   /locus_tag="Saro_0153"
FT   CDS_pept        complement(153225..153653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0153"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24602"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC21"
FT                   /protein_id="ABD24602.1"
FT                   /translation="MTIAQVIAGRGEVWSCHADDSVADAVDMLARYRIGALPVEDGTNG
FT                   VAGIFSERDMIRCLHKHGEAALHMKVRDMMTAPVVTITPQTSVLEALALMTQRRFRHLP
FT                   VVEGGHMVAFVSIGDLVKHRIDKIEAEADAMRVYIQQA"
FT   gene            153797..154090
FT                   /locus_tag="Saro_0154"
FT   CDS_pept        153797..154090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24603"
FT                   /db_xref="GOA:Q2GC20"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC20"
FT                   /protein_id="ABD24603.1"
FT                   /translation="MAPRSPLDDPHNASFAWARYRMLMKWMAGFTGAVVVLVSVLLYHW
FT                   VGFVSIHFYIATALGIGFAMLLMAALMGLVFLSSGTGHDESIEDPLDDERTR"
FT   gene            154071..154466
FT                   /locus_tag="Saro_0155"
FT   CDS_pept        154071..154466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0155"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24604"
FT                   /db_xref="GOA:Q2GC19"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC19"
FT                   /protein_id="ABD24604.1"
FT                   /translation="MTSGPVEVGRLRAYLGPMSETAIQTPVTLAPSAAARVAAIAAKQG
FT                   KPAILRLSVEGGGCSGFQYRFGLADAPEEGDTIAETDGVRLVVDEVSLGLLEGSMVEYV
FT                   ESLGGAAFRVTNPQAASGCGCGASFAI"
FT   gene            154525..155304
FT                   /locus_tag="Saro_0156"
FT   CDS_pept        154525..155304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0156"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24605"
FT                   /db_xref="GOA:Q2GC18"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC18"
FT                   /protein_id="ABD24605.1"
FT                   /translation="MTLKVASFNINGIKARLPRLLEWLEETRPSVACLQEIKTQDEGFP
FT                   AEEFEKIGYRAIWHGQKGFNGVAILADGEQPVEVQRGLAGDPEDEHSRYLEADVFGLRV
FT                   VCIYLPNGNPQPGPKFDYKLRWMERLRARMADIASEEVPALVIGDYNVIPEDKDTFSVK
FT                   AMASDALMQPESRDAYRRLLNDGWTDAIDLFNPQGGVWTFWDYQAGAWQRDHGFRIDHA
FT                   LLSPELADRLVAAGVDKDYRGREKASDHAPVWVTLRD"
FT   gene            155351..155611
FT                   /locus_tag="Saro_0157"
FT   CDS_pept        155351..155611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24606"
FT                   /db_xref="GOA:Q2GC17"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC17"
FT                   /protein_id="ABD24606.1"
FT                   /translation="MNGGLCMASLRVKPGQGIRLPRSVPVVFKSDSMGLFKPDLFRSLA
FT                   FGFLMGTAVMAMSVGATAWASADSAPVTNSGTSHATGQTGR"
FT   gene            155613..156290
FT                   /locus_tag="Saro_0158"
FT   CDS_pept        155613..156290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0158"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24607"
FT                   /db_xref="GOA:Q2GC16"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC16"
FT                   /protein_id="ABD24607.1"
FT                   /translation="MRRPVLAAALLAGIVTASCQQTAQAEGAVAAPEAAVQADEAPGRK
FT                   VAIFAGGCFWGVEGVFSHVKGVTSVVSGYHGGEKKTASYDVVGTGRTGHAEAVRVTYDP
FT                   AKVRYDQLLRIFFAVVTDPTQLNYQGPDDGTQYRNALVPMDKEQARVAAGYLAQLKRLD
FT                   LWKRPIVTAVEPYKTFYPAEGYHQDFMANNPDHGYIRRWDAPKVQALKRMFPDLYKPAF
FT                   TRN"
FT   sig_peptide     155613..155690
FT                   /locus_tag="Saro_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.776 at
FT                   residue 26"
FT   gene            156327..156797
FT                   /locus_tag="Saro_0159"
FT   CDS_pept        156327..156797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0159"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24608"
FT                   /db_xref="GOA:Q2GC15"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC15"
FT                   /protein_id="ABD24608.1"
FT                   /translation="MAGHHHHHDFAGEKLVKAARDALVEAGEQWTEMRADVFEALAARD
FT                   RPASAYDIAEGVGTRRGKRVAANSVYRILDLFVRTNLARRVESANAYVANSHPGCRHDC
FT                   IFLICDLCGKAVHIDDDSLTGALRQAAQGAGFAEVRPVVEIRGHCSECASGE"
FT   gene            156827..158104
FT                   /locus_tag="Saro_0160"
FT   CDS_pept        156827..158104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0160"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24609"
FT                   /db_xref="GOA:Q2GC14"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC14"
FT                   /protein_id="ABD24609.1"
FT                   /translation="MEPTSSEPRHLPTKRQFAAVISGNALEFYDFLSFSFFAVNLSRVM
FT                   FPAGAPGSALLLTLMTAGAGFGARPLGAILFGVLGDRIGRRPTMLATFALMGVSALGLA
FT                   LTPDYAAIGPAAPILVVLFRLLQGLAAGGDVGPTTAFLAESAPSERRGMLIALQLVAMR
FT                   MGVLASGLVGLVLASVLTPAQLDSFGWRIAFAIGAGIVPLAFILRRRLDETLHMPETGP
FT                   DVVTELAPRAYAAALLGVCGFLLAGAAGDFLFIYAVSFLKIAVTNGYIVQMAAAGTQIV
FT                   GLVLGGWLGDRIGRRRVNLVTAILAALTSLPLFRWGIEGSAPARFGVAAALLLLMATVS
FT                   AAVAYAAFVETTPKRHRAGLVGIGYGVMVALTFGLTPVVLTRYMTATGDLAAPGYAFVV
FT                   AALLLVASALLLPERRPRHIGKVRFT"
FT   gene            158147..160069
FT                   /locus_tag="Saro_0161"
FT   CDS_pept        158147..160069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0161"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24610"
FT                   /db_xref="GOA:Q2GC13"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GC13"
FT                   /protein_id="ABD24610.1"
FT                   /translation="MSQEPATPLLDTVKTPDDLRKLAPTQLRQLADELRVEMISAVGQT
FT                   GGHLGSGLGVVELTVAIHYVFNTPEDRLVWDVGHQAYPHKILTGRRDRIRTLRQAGGLS
FT                   GFTKRSESEYDPFGTAHSSTSISAALGFAIANKLSGRLGKGIAVIGDGAMSAGMAYEAM
FT                   NNAEAAGNRLIVILNDNDMSIAPPVGGLSAYLARLVSSGPFLGLRDIARRLSRKLPRPL
FT                   HEAARKTDEFARGMAMGGTLFEELGFYYVGPIDGHNIDQLIPVLENVRDAAEGPCLIHV
FT                   VTQKGKGYAPAEAAADKYHGVQKFDVITGEQVKAKAAAPAYQNVFGETLAKLADADPTI
FT                   CAITAAMPSGTGVDKFAKAHPDRTFDVGIAEQHAVTFAAGLAAEGMRPFCAIYSTFLQR
FT                   AFDQVVHDVAIQNLPVRFAIDRAGLVGADGATHAGSFDVTYLATLPNLVVMAAADEAEL
FT                   VHMTYTAALHDSGPIAFRYPRGNGVGVPLPEVPERLEIGKGRIIRQGSKVALLSLGTRL
FT                   AEALKAADQLDARGLSTTVADLRFAKPLDVALIRQLMTTHDVIVTVEEGSIGGLGAHVL
FT                   TMASDEGLVDGGLKIRTMRLPDLFQDHDAPEKQYDEAGLNAPHIVDTVLKALRHNSAGV
FT                   SEARA"
FT   gene            complement(160099..160779)
FT                   /locus_tag="Saro_0162"
FT   CDS_pept        complement(160099..160779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0162"
FT                   /product="NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24611"
FT                   /db_xref="GOA:Q2GC12"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC12"
FT                   /protein_id="ABD24611.1"
FT                   /translation="MQGNLVPLAAATSCFVGSHFLLSGPLRRVIAKSLGRPTYLTIYSL
FT                   VAIATLTWAIVAFDRAPAAPALWDGTNAVAWALASVLTIVSLAFFIPSFAGNPVLPGRK
FT                   AAGLGTVVPTGVFTITRHPMMWAFALWALAHIIVAPTGRSLIFMSGMIVLALLGSHFQD
FT                   KRKIAGNNREFAPWQRRTSYWPRLDKLGAIGLIWLLAALVWVIITLIHWELFGIPAGLW
FT                   MWIG"
FT   sig_peptide     complement(160708..160779)
FT                   /locus_tag="Saro_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.868) with cleavage site probability 0.865 at
FT                   residue 24"
FT   gene            complement(160892..163015)
FT                   /locus_tag="Saro_0163"
FT   CDS_pept        complement(160892..163015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0163"
FT                   /product="Amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24612"
FT                   /db_xref="GOA:Q2GC11"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC11"
FT                   /protein_id="ABD24612.1"
FT                   /translation="MVANEISFLPWPDVPVMPATPARELRRQGQQTRSHARMAQIEMTA
FT                   DQTPTPHRPEGPDPAGEWFGHPAQLKRLFTTEMWERFGYYGMRAILTLYLAKHFLFNDT
FT                   TSTGIYGGFTALVYLTPLIGGLIADRYLGSKRSVKFGAILMAVGYFMLCFGGDAAKPYA
FT                   TIEGQRYEVTVTKTDAGEVRSVEMNGQRLEIAGNEDKSVSLKATDGTEARRIAPGGFES
FT                   DGERSPLHITILLVGLSLVTVGNGFFKPNISTIVGTLYADGDRRRDAGFTIFYMGINLG
FT                   SLISQFFCPILAESVGWWAGFGLAAIGMTFSWLLFQFDGGRLDGYGERPAGADPRKDWL
FT                   IYGAALVCVPLFWFLFTNLMAYVPPAAGEGLVGYFLGLPIMGKLMFGTFLLAVPGILVW
FT                   ALAAGSRVEFQMMVAAMVLIVFNTVFWTLFEQAGSSLTLFAERNTQLEIGWTRPLFAMF
FT                   RASPASYYLFFAILLGGLGWLLAWFFGQGEVPETRRKISLGFGIAMLAGFGGMLYARTQ
FT                   GFGSEPVYVMPAGQTQIFNALFIVTLAPVFSVMWNALARRGVEPSIPVKFALALMGVGG
FT                   GFLLLVWGAQFADAQFRVGLAWLAGLYLIHSMAELCISPVGLSMITKLSMARIVGMMMG
FT                   VWFLSIAVAQYVAGMVAQVASVETVGGQVTNLKVSLDTYVGVFTTIGWVSVGIGVVLLV
FT                   VAVPLRKLMHGVT"
FT   gene            163049..163438
FT                   /locus_tag="Saro_0164"
FT   CDS_pept        163049..163438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0164"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24613"
FT                   /db_xref="GOA:Q2GC10"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC10"
FT                   /protein_id="ABD24613.1"
FT                   /translation="MGAPLYRGLYYGNIAPMSSSSRPVYLRLRDEIAAGIIDGRYPEGA
FT                   VLPSVRAFATEQGANPLTVAKAYQQFQDEGLVTVQRGIGMFVAPGAATALLARERQTFL
FT                   RDEWPEIAGRIRRLGLSLADLAELA"
FT   gene            163591..163872
FT                   /locus_tag="Saro_0165"
FT   CDS_pept        163591..163872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0165"
FT                   /product="histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24614"
FT                   /db_xref="GOA:Q2GC09"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC09"
FT                   /protein_id="ABD24614.1"
FT                   /translation="MIRSELLQALAKESPGMRSEEIERVVDVFFDEIAKRLAEGGRVEL
FT                   RGFGAFSTRERDARKGRNPRTGETVEVPGKKVPYFKAGKEMRQRLNAD"
FT   gene            163991..164075
FT                   /locus_tag="Saro_R0001"
FT                   /note="tRNA-Leu3"
FT   tRNA            163991..164075
FT                   /locus_tag="Saro_R0001"
FT                   /product="tRNA-Leu"
FT   gene            164436..165092
FT                   /locus_tag="Saro_0166"
FT   CDS_pept        164436..165092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24615"
FT                   /db_xref="GOA:Q2GC08"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC08"
FT                   /protein_id="ABD24615.1"
FT                   /translation="MAHIDDQLPPQDGPDSAEQRTAPRFTLLIRAAKLIVDDEREFLCV
FT                   IRDASISGLKIRLFNPLPDHKSLRIEMSNGDRYAVEQVWADGEYAGLQFLDEVGIERLL
FT                   DESHGPFPKRQVRLRIRLDAVLHSGGEAVRVAFQDISQQGAGIECDKWLLMNELVRVET
FT                   GVLPPIYAKVRWRSHPRYGLLFEQTFKLDELARIAAPLQTGDAQVAGRAANSRTA"
FT   gene            complement(165119..166585)
FT                   /locus_tag="Saro_0167"
FT   CDS_pept        complement(165119..166585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0167"
FT                   /product="sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24616"
FT                   /db_xref="GOA:Q2GC07"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC07"
FT                   /protein_id="ABD24616.1"
FT                   /translation="MTEDEAITQLRRFVAALESGSRRNANDAAFALLAGNPPLGDRWQS
FT                   IAHVMQTNGEYSAAHLAMARFAAHRADPNARFAQAAMLAQTGQLEEAWKVMGSVPFGVP
FT                   SVSGHHYIRGTIAVNLGHIEDAEKHLLAAIEAEPALGQAMLSLAAARKRKAGDPIGDRI
FT                   LSAEPRMEGAPPLERAHFHYAAGRVHFDRREPDEAFRHFSAGAELVRGWRSYDAAADAR
FT                   DAAECRQGFDRDFVDKINNLVTLDTSQPIFVTGLPRSGTTLVEQILVSHSAVSGGEELG
FT                   RMGVVRRDLTSLSAKGLSDYLQAGGNADDLAALYLHLGQERFGKEGRFVDKALNTSRFT
FT                   GLIAALLPHAPIVWLRRDPADCAFSAYRTYFINGLDWSWNLEDIATHFALEDQLFHHWS
FT                   RMFPDRILAVDYQQLVQEPQAQIRRILAHCNLEEEPQVFRPHETQRVVSTASVMQVREP
FT                   INTGAVGAAGAYRLHLAPFVDRYEALSAAT"
FT   gene            complement(166719..169919)
FT                   /locus_tag="Saro_0168"
FT   CDS_pept        complement(166719..169919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0168"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24617"
FT                   /db_xref="GOA:Q2GC06"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC06"
FT                   /protein_id="ABD24617.1"
FT                   /translation="MKIKTFSALRASAAPLALVVAGFTASTAFVAPAMAQDYTRGNLVG
FT                   EVLDGNGAPVSGAQVTIRSNEQGFTNTTTTDSSGQFRVTALPTGTYSVTVTVDGAVVVQ
FT                   DNSASVVAGSNNSYRYSTGEAAAGGAIVVTGSRIKTNDFAQNTSGLTLNVQEVAESVPI
FT                   ARSQSALILLAPGTNAGDTGFGDCPDCVSFGGASIAENSYYVNGLNTTNFRTFVGNNVV
FT                   PFEFYRTFDVKTGGWSAEYGRALGGVTSAVTKSGSNNFEYGAVVAYTPDFLSEDSPNTY
FT                   LDDTGSLKSLNSRDYRERLEANFYLSGPIIKDRLFFYGLVTPRYSVSEDTSPSSGYRVR
FT                   AKSNTPFYGGKLDFIPFDGHRIEGTFWSDERTINYDYYNVDALGNEKTGIITGINREGR
FT                   EINKIGGKNWIVQYTGQFTDFFTLSGAYGENRYKRYDVISGGDSAVPTIQTQLAYDGNG
FT                   EPVTSLKTIAGVPVSPTDGQDLRKVMRIDADLYVNLLGSHHFRFGFDREDLSVTEDTFY
FT                   TGDRTYRFTANYIRTRTYLNEGSFKTKQTAFYIQDSWDLLNDRLNLQLGVRNDQFQNYG
FT                   ITGGKYLDLKNQWAPRLGASFDVFGDKLTKIQAFWGRYYLPVATNTNIRLAGAETYYEQ
FT                   RFGYAPGVVGSNYDTNGVPIGQQFDSSGAPILGSLTGANSLNCPDFGPGAGQKCRTVFS
FT                   DGLPGPTDTLVSSTLKPMYQDELIFGITHRMEDWTFGLRYINRRLKQTLEDIAIDEAVN
FT                   RYCEQQNLDCATSSGSPIWSGFHQYVLANPGEAVTVRLDGDPTKPGTTDVVTLSPELLG
FT                   YPKAVRKYDSIEFTASKAFNGTWGFDFSYTWQKLRGNYEGSVKSDNNQDDAGLTQDFDV
FT                   PGLTTGSYGTLANNREHTFKLFGSWQPVDWLRIGANLTVQSPRSFSCIGVAIPDYIKLL
FT                   QAGESAVLNGGAASQYGAASFYCRNPKGNQNGTTVTNDITGETSVLVNRGTAFKSDWSK
FT                   NLDLGFQFKLGEALGNSNFRIDVFNVFNWKSKTDFVEFGETDSGATRADYRLPTGYQAP
FT                   RQVRFTWTMRFGANNGAD"
FT   sig_peptide     complement(169812..169919)
FT                   /locus_tag="Saro_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 36"
FT   gene            complement(170278..171132)
FT                   /locus_tag="Saro_0169"
FT   CDS_pept        complement(170278..171132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0169"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24618"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC05"
FT                   /protein_id="ABD24618.1"
FT                   /translation="MIRRRDFLSSGIAATTVLLLGNTPLPPIIIDEGGQPTQGGWLRGR
FT                   TSGVTGLALDGKGVAMGADGAFLIAFDRDAPPLARLVATVAGGQAVARDIVVATRAWQI
FT                   EHVNVAKRPGAVPDEEFLRIRKGELARIAAARARRTGAEGWRQDFVRPAPGRFSGRFGA
FT                   QRIYRGEPGSYHSGLDIAGGAGTAFIAPADGVVTLAAADSPFSLEGHLLMLDHGNGLNS
FT                   AFLHCSALSVVEGETVRQGQVIGRIGSSGRATGPHLHWSIRWEESRLDPLLFLPQLVSA
FT                   ATL"
FT   sig_peptide     complement(171067..171132)
FT                   /locus_tag="Saro_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.719) with cleavage site probability 0.674 at
FT                   residue 22"
FT   gene            complement(171151..171354)
FT                   /locus_tag="Saro_0170"
FT   CDS_pept        complement(171151..171354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24619"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC04"
FT                   /protein_id="ABD24619.1"
FT                   /translation="MLMSQSGRLARLHYLSGGFRQLSAGDHVVCAVSGQTIPLDMLRYW
FT                   CAERQEAYATAEISVRRHLEGK"
FT   gene            complement(171381..172742)
FT                   /locus_tag="Saro_0171"
FT   CDS_pept        complement(171381..172742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0171"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24620"
FT                   /db_xref="GOA:Q2GC03"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC03"
FT                   /protein_id="ABD24620.1"
FT                   /translation="MKRTVEDRFGFVRVRGELSGVKRAASGHLYLCLKDENARLDGVMW
FT                   RGNAQRLNFRPEDGVEVIATGKLTTYPGRSNYQIVIDRMEIAGEGALLALLAKLKARLE
FT                   GEGLFDPARKKALPFLPRTIGVVTSPTGAVIRDILHRLSDRFPCRVIVWPVLVQGQGAA
FT                   AQVANAVRGFSAMEPGGPIPRPDLVIVARGGGSIEDLWSFNEEEVVRAVADCTIPIISA
FT                   VGHETDTTLCDFAADLRAPTPTAAAELAVPVQAELAAFVADLNARQRRALGRQLGQARE
FT                   RLEARSQRLPQPHALLQGQAQRVDDLGDRLRLALLHRTEIAASQLARHAGALRPALLSA
FT                   RVDRERERLAARRLRPEALLQRIDHARGKVDALDRLRRSLNPEAPLERGYVLVTDSDGH
FT                   LVKDRATAATRAALTLKFADGTLDVSTGAPPPAGSRSASKPRQAARPEGQQELF"
FT   gene            172861..174150
FT                   /locus_tag="Saro_0172"
FT   CDS_pept        172861..174150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0172"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24621"
FT                   /db_xref="GOA:Q2GC02"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC02"
FT                   /protein_id="ABD24621.1"
FT                   /translation="MNILLLGSGGREHALAWKLAQSPLTGKLYAAPGNPGIAQHADLVA
FT                   LDLTDHASVVTFCETNRIGLVVVGPEAPLVDGLTDSLRAAGFSVFGPSRAAAQLEGSKG
FT                   FTKDLCARADIPTAGYVRAKSLEEARAALAEFGAPVVIKADGLAAGKGVVVAMTMEEAE
FT                   AAVDDMFDGAFGSAGAEVVVEEFLTGEEASFFALTDGATIVPFASAQDHKRVGDGDTGP
FT                   NTGGMGAYSPARVLTPELEAQALSQIIAPTVKAMADEGMPYSGVLYAGLMLTEQGPKLI
FT                   EYNARFGDPECQVLMMRLESDLVELLLACADNKLSSIQPPRFSNEVAMTVVMAAQGYPG
FT                   TPKKGGRIDHIPAAEAGGAKVFHAGTVLSGDGVLSANGGRVLNVTAKGPTVKSARDAAY
FT                   AAVDAISFPEGFCRRDIGWREIEREEAASV"
FT   gene            complement(174140..174769)
FT                   /locus_tag="Saro_0173"
FT   CDS_pept        complement(174140..174769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0173"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24622"
FT                   /db_xref="GOA:Q2GC01"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC01"
FT                   /protein_id="ABD24622.1"
FT                   /translation="MTQHEDDLAANYAGAFDGRLPFGQCPALVVVDLVEAYLQPGSPLY
FT                   AGIEAALESAVRLTDAARNAGIPVIFTNVEYQPGGTDGGVFYRKVPALRVFEKGSPLGA
FT                   FPAVLSPREDEIVITKRYASAFFATHLASTLTSLGVDTVLICGTSTSGCIRATALDACQ
FT                   HGFLPFVVRDACGDRHQAPHEANLFDLQAKYAEVIGEAEALAFLRR"
FT   gene            complement(174769..175971)
FT                   /locus_tag="Saro_0174"
FT   CDS_pept        complement(174769..175971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0174"
FT                   /product="succinyl-CoA:(R)-citramalate CoA-transferase"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24623"
FT                   /db_xref="GOA:Q2GC00"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GC00"
FT                   /protein_id="ABD24623.1"
FT                   /translation="MTMTTTNPGPLRDIRVVELGQLLAGPFCGQLLGDMGADVIKVEPP
FT                   VTGDPMREWGQGADKVQWEVIARNKRSVSANLRIPEGQALVKKLIAHADVVIENFKPGT
FT                   MEKWGLGPDVLLAEKPGLIIARMSGYGQTGPYSDRAGFGGIGEAMGGWRYIVGEPDRPP
FT                   SRMGISIGDTLTATYGCMGVLAALHERSRSGRGQVIDAALYESVLQVMEGLVPEYDRSG
FT                   LIRERSGSVLKGIAPSNVYSCKDGEFMIGANKDSLWKRLATAMGRPELGDDPRYATHLA
FT                   RGENQDELDALINDWTRTLTIDEVDALMIEYSIPAGRVYRAPDMLADPHFKAREAIIEV
FT                   ETERFGPLKMQSSFPRLSATPGSVRRPAPSRVGQHNAEVYGELLGLGESDLAHLAEQGV
FT                   I"
FT   gene            complement(175968..177854)
FT                   /locus_tag="Saro_0175"
FT   CDS_pept        complement(175968..177854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0175"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24624"
FT                   /db_xref="GOA:Q2GBZ9"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ9"
FT                   /protein_id="ABD24624.1"
FT                   /translation="MPATIVQTNEKPFERVAIDPVTLDIIENALRNARIEMDATLVRTA
FT                   MSPGIREQGDAFPLIADHTGKMIVGQFGSFIGGFLENYEGTLEDGDMIFLSDPYSVGGA
FT                   ISHSNDWLVLLPVFKDGRLIAYTSMFGHQSDIGGKVVGSMPINARSIFEEGVRIPPVKI
FT                   WKKGEYNADLIRLVMHQTRKPDWCAADLNALIAACRVAARRVIEMAERFGDDVYVSATQ
FT                   ELLARNHRAMKALVGMAVAEEPVSFEDYICDDGMGFGPYRIKCTMWREGEKVILDFAGT
FT                   DPQSVASINFFLNENMFKMFFGIYMIMVFDPQILFNDGFYDLIDVRIPEGSLLKPRFPA
FT                   ALSGRTHALGRIFDILGGLLGQKTPEFLNAAGFSSSPHLFYAGNDERPGKNGEWFQLFQ
FT                   IGFGGIPGRPMGDGPDGHSLWPGFTNVPNEFLERYFPMVIERYECEPDSGGAGLHRGGN
FT                   GIRMTYRFLSKGTIAIHDDRWFVPPWGVNGGEPGARARKILEKPDGTQTIVGNKVEDLE
FT                   VEAGDILHFITWGGGGWGDPLARDPALVGKEIVQGLVTPQGARAYGVVADGSGKVDEAA
FT                   TAALRAELCASRGELPLFNYGPGIETLRANCEAETGLPAPVQPEWPLLEAAE"
FT   gene            complement(177868..179916)
FT                   /locus_tag="Saro_0176"
FT   CDS_pept        complement(177868..179916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0176"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24625"
FT                   /db_xref="GOA:Q2GBZ8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ8"
FT                   /protein_id="ABD24625.1"
FT                   /translation="MGYRLGVDVGGTFTDLLLFDTASSAFWRHKTPSTPHDSSEGILNG
FT                   VTAICEKAGIAPGDVDFFLHGTTVATNAVLEGKGARVGLVTTEGYRHVMQIARSFVPGG
FT                   LAGWIVWPKPQPLAALEDTVTIAGRISSEGDEIRPIDDTDIRTQLSALKANGVEAITVS
FT                   LINAYANGMHEKRVGELAAEILPGVPVSLSHEVLPEMQEYERTLTTVANAAVRPVVGKY
FT                   VSNLRSRLAEAGMNGKLSLLRSDGGLMSAQKAEEHPVNILMSGPAGGVTGAIWVGRNAG
FT                   IRNILTLDVGGTSTDVALIENLEARRQRTTEVGHLSVRASALDVKTVGAGGGSIAYVPE
FT                   LTRALRVGPQSAGAVPGPVAYGKGGTLPTVTDANVVLGYLPENLLGGTFNLDREGAKKA
FT                   VQTIADALGIDLMAAARGIIDIVNENMFGALRMISVQQGYDPRDFALMGFGGAGPLHVN
FT                   AVARLMGSWPAISPVSPGVLCALGDATTRMRTETARSFSRLASQTEAADLIAILDEMAA
FT                   QTRAELLADGVPEDEISTAFEVDVRYAGQAFEVPLTITADVLNADGISGILERFDAEHK
FT                   RLFTFNMDTPHEIVNLRAVAMGRALDLPAAELEKGDGNPIGAKMRDHTLWMDGREQAAV
FT                   IYDRSRLRAGDVIPGPAIVCEMDSTTLIESGCTGTVDHVGNILINLA"
FT   gene            complement(179921..180835)
FT                   /locus_tag="Saro_0177"
FT   CDS_pept        complement(179921..180835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0177"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24626"
FT                   /db_xref="GOA:Q2GBZ7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ7"
FT                   /protein_id="ABD24626.1"
FT                   /translation="MSRRISFVEVGPRDGLQNEKTLVSTADKLELVRLGLDAGARRIEV
FT                   ASFVNPKRVPQMADAEAVCAGLPSVDSVSYIGLVLNGKGAERAIATGRLHELGAVCVST
FT                   DGFAIANQGQTSDESLDVAKAIVGMARDAGLKGQATIGAAFGCPFEGEVSEDRVVAMAA
FT                   SLAEADPIEVALADTIGVADPAHVSRLVRRVIEAIAPLPVRVHFHNTRGTGIANVWAAV
FT                   EAGASVVDAALGGLGGCPFAPGAAGNVSSEDVVYMLHRAGVETGMDLSKLIAANHWLAG
FT                   VMNRKLPGMVAQAPAFPKIVQEN"
FT   gene            181101..183626
FT                   /locus_tag="Saro_0178"
FT   CDS_pept        181101..183626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0178"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24627"
FT                   /db_xref="GOA:Q2GBZ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ6"
FT                   /protein_id="ABD24627.1"
FT                   /translation="MRASRLLLNSSALGLLLAATPALAQEVPQDSAASADGGETIIVTA
FT                   RRQNERLQDVPASVSVLTATALQNTGATKAEDFTQLTPGVTIVTGTAEAGDTQINIRGI
FT                   NGARDAESSVALVVDGILKTNTAQLNQPQGTLTQVEVLKGPQGALYGRNAAAGAIVLQT
FT                   LKPTDTLSGGLRASYANEATYEATAHIAGPLGDNIGFVLSGYYFTTDGWWRNTLLNNSK
FT                   TVDDKENWAIDGRVMVGQGTSTQLDLKARYAEFHGASLPFNASFHLPLFGTVNPAFYED
FT                   VNKHEFNFYNNIRATNDQKSFDVSAKIDHEFGNGMKLVAWALYSDVKQDLVADGTSADF
FT                   ARYISNADSAVDSSVASCFASTAALTGFPVNQPGFIGQIPVPFLFAPSTGSTFGPYSPT
FT                   TCDGIQYQLRNQKDFSTEVRLLSDTDGPLTWQLGAYYLHIDRKTGVSLGADTGQGVIKQ
FT                   LYNAPDTANPTSLLLADKFRTNVYAAFGAAEWKPSEVFTGGIALRYDIEDRVANSLVPD
FT                   VTDPFTGGPINPGLAFGAFKPQNATFKQLQPKVTLSFHPSPALNIYANWGIGFKSGGFN
FT                   NQGSAAVVDQNFNQFINAGVTIDDQYRKEKSSAFEAGIKGELLDGRVTYDLAAYYTRVT
FT                   DMQFFEFFVGSFGLLRVVSNIDRVDIKGAELNLTGKVVDGWKVFGSFNVTDSEIKKNRS
FT                   RPYTVGNKSPYTADWTINLGTEINAPINDSVKLLLRADYRITGPTWFHSVQDQERPTLF
FT                   SGLLPISELNFLPPSFGNARYDVARRDAFGVLNLRAGINTDRYRIAVFADNLLDRKYIA
FT                   EAIPAIEFGGSFISPGARRLIGVEVGASF"
FT   sig_peptide     181101..181175
FT                   /locus_tag="Saro_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            183684..184328
FT                   /locus_tag="Saro_0179"
FT   CDS_pept        183684..184328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0179"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24628"
FT                   /db_xref="GOA:Q2GBZ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ5"
FT                   /protein_id="ABD24628.1"
FT                   /translation="MSKASQEAYRKIRAGILSGHFPAGQFVPEDEFAQFCGLSRTPVRE
FT                   AIAELVSEMLLQRSDTNRVFVPVWSDDDEEELFALRAMLESHCATRAARFITDEQIDEL
FT                   RAHCDFIDRAISQSDGPDVSGFVEGNRRFHAVILAAAQSERLGQLLRFVVSQIVVHRTA
FT                   EQYTRADMEQSQRDHRDLVSAFAMRDEIWAGAIANTHIRRAANAYRTMRQG"
FT   gene            complement(184339..184839)
FT                   /locus_tag="Saro_0180"
FT   CDS_pept        complement(184339..184839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0180"
FT                   /product="Hemerythrin HHE cation binding region protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24629"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ4"
FT                   /protein_id="ABD24629.1"
FT                   /translation="MAQTTFTDAIALLKADHRNVEALFDKFENARSAQKQALALQICNE
FT                   LKIHTIIEEEIFYPALQGKIEDETYTEAYVEHDAAKVLINDIMASSPEDDFFDAKVKVL
FT                   GEEIKHHVHEEEARSEGMFSQARDAGVDLVALRDAMMARKQELMQKAKAEALPEAQLRV
FT                   VQS"
FT   gene            184945..185745
FT                   /locus_tag="Saro_0181"
FT   CDS_pept        184945..185745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0181"
FT                   /product="phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24630"
FT                   /db_xref="GOA:Q2GBZ3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ3"
FT                   /protein_id="ABD24630.1"
FT                   /translation="MIDMNDTEQHLKARERWPSVLWLIRHGQSAGNVARDMAMAAGDLR
FT                   IALDHRDVDVPLSGLGREQARALGHWFASGEEGGRPEIVLASPYARAVQTAELFREAGG
FT                   CSPALRICVDERLREKEFGILDGLTTLGIREFQPEQADFRKVLGKFYHRPPGGESWVDV
FT                   IFRLRALLDTVSLHYAGKRVMIVAHQVVVLCLRYIIEHMTEADILAIDREGDIANCAIT
FT                   QYRLERGGPGDGELVLERFNVVAPMIREGTPATREPDQMVAARG"
FT   gene            185738..186619
FT                   /locus_tag="Saro_0182"
FT   CDS_pept        185738..186619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0182"
FT                   /product="protein of unknown function UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24631"
FT                   /db_xref="GOA:Q2GBZ2"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ2"
FT                   /protein_id="ABD24631.1"
FT                   /translation="MAEVTTLDGAWLRANPLPLPDEESDKNARGRVFVVGGCMTVPGGV
FT                   RLTAEAALRSGAGKVRIATVEPTAVILGAFLPEVAVLPQPMDEAGEIDAAVARIADDVR
FT                   RCDALVIGPAMGCKRQASALVGMALAEEARAGLVLDAAALMALSDHALALCRRERPAVL
FT                   TPHIGEIAALLGRDAGEIDKDRVAATRDCAERFGSVVVLKGAVSIVAEPGGATFSYSGG
FT                   NVGLATGGSGDVMAGIAAALIARGAEPTVAALWAVWLHGEAGRRCAETVGPLGFLASEL
FT                   LGFIPQVMQRAA"
FT   gene            complement(186588..186974)
FT                   /locus_tag="Saro_0183"
FT   CDS_pept        complement(186588..186974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0183"
FT                   /product="Ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24632"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ1"
FT                   /protein_id="ABD24632.1"
FT                   /translation="MIASREEIAQAERALELLGGFAPKRHILLCAGPEKDKCAPRAVGD
FT                   EAWNYLKKRLGELKLGGAQGVLRNKVGCLRVCIAGPVAVVYPDNVWYHSCTPPVLERII
FT                   QEHVIGGVPVEDYRLRQPAASLAE"
FT   gene            complement(186971..189067)
FT                   /locus_tag="Saro_0184"
FT   CDS_pept        complement(186971..189067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0184"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24633"
FT                   /db_xref="GOA:Q2GBZ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR018910"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBZ0"
FT                   /protein_id="ABD24633.1"
FT                   /translation="MKTNSLIAATALAVALAAPAHAEQAAPLSPQDLVTLSRLGGTAIS
FT                   RDGNMIAYVVTTTDPVSYKRTPSLWVKPAGKGEPRRIDTAGSASDPAFGPDGALYYLSD
FT                   RKVGESERTQVWKVDPATDVTAQVTAFATDVAGFELSPDGKRIAVWGDIARTCPTFGCE
FT                   SDGNTALPGPGTGRHYKDGAGFVRHWDAWETPGNYSRVFAFDIGPDGKVTGEGKAADGP
FT                   VGTLTGDSPVKPFGGGEDVAWSADSQSLFFVARQADRNEPTSTNLDIWHSKLDGTAPTN
FT                   LTEANKATDNTPAPSPDGKWLAYAAMARPGYEADRLVVNLVNLQTGERRELTGAWDRSV
FT                   ASLAWTPDGKALIATAEDVLDTPAFRIDPASGKVTRLVLNPGREGHVGNVVPLKDGRLL
FT                   YTRDTIDAPAELYIGKPGKGGTRLTDVATTALSQRAPVVTQRFSFKGADGDTVWGQITK
FT                   PGWVKGRMPSVLFVHGGPQGSYNDSWSNRWNPRVWASQGYAIVSIDFHGSTGYGQAFTD
FT                   AINRQWGGKPLEDLQKGFAAAIALDGQIDGENACAAGASYGGYMMNWIAGNWPDRFKCL
FT                   VQHDGVFDARAMAYETEELWFDEWEHGGHPYYEAPEEFEKWNPVNHVAKWKTPMLVITS
FT                   EKDFRIPYTQGLAAFTALQRRGIPSELLVFPDENHWVLKAKNSLQWHQTSFNWLERWLK
FT                   KGDK"
FT   sig_peptide     complement(188999..189067)
FT                   /locus_tag="Saro_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(189125..189562)
FT                   /locus_tag="Saro_0185"
FT   CDS_pept        complement(189125..189562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24634"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY9"
FT                   /protein_id="ABD24634.1"
FT                   /translation="MRQAGEPSVEEILESIKKVIARDNRMEAQGRADAAHARPRKESPA
FT                   RPAEVLELTETADDEADEALAEGLIADSATASMRESLAALSMLSQPGAAPQIVRSGETS
FT                   LEGLVREMLKPMLADWLEKNLPAMVERMVSAEIARIAGKRG"
FT   gene            complement(189604..191061)
FT                   /locus_tag="Saro_0186"
FT   CDS_pept        complement(189604..191061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0186"
FT                   /product="Type I secretion outer membrane protein, TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24635"
FT                   /db_xref="GOA:Q2GBY8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY8"
FT                   /protein_id="ABD24635.1"
FT                   /translation="MTTGKALRLLLTASAAALIATPALADDLREALTSAYNTNPTLQAA
FT                   RANQRATDEGVPLARSSALPSLSGTATYTEFLKKTPNAFTAPDRSLSADLSLGVPVYAG
FT                   GAVKNSIRAAKTRVEAGQEDLRATESGIFSQVVAAYMDVIRDSAIVGLNRNNVEVLEVN
FT                   LKATSDRFDIGDVTRTDVAQSNSRLALARGDLRTAQANLVSSRERYIQVVGKAPADLQP
FT                   PPPLPGLPATPDDAVDFALENNPDLLAARERSKAAGFDVKVADAAKLPTISLFGGSNYT
FT                   DYFNTLGGNSSAAFAQHQTTAQAGVRASIPLYQGGAPAAQTRQAQARESATLEQEIGVE
FT                   REVIATVRSAYASWKAANEIIAMNQTAVDAAALSLEGVRAENTVGNRTILNILDAEQEL
FT                   LRAQVQLVAARRNAYVAGFNLLAAMGKADANDLGLDGGALYDPQVNYDRVKNRIWDWDR
FT                   DPTPVAKSTRTVDTPAQDATIAPTPTP"
FT   sig_peptide     complement(190984..191061)
FT                   /locus_tag="Saro_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(191067..191660)
FT                   /locus_tag="Saro_0187"
FT   CDS_pept        complement(191067..191660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0187"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24636"
FT                   /db_xref="GOA:Q2GBY7"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY7"
FT                   /protein_id="ABD24636.1"
FT                   /translation="MTVVEDRPAADEMLVARRAMIDSQLRVSGVNTPAILAAFAAVPRE
FT                   DFVPADRRTVAYADRAQPLGDGRSLSPALTYGQMLEAAAATKDDSVLVISPNGYLAALA
FT                   GHLAGTVARADSLTDAKGGPYSLILIDGAAEVLPESLAALLSDEGRIVTGLFDRGVTRL
FT                   GVARKALGKVVATPLAEADFAVLPEMAAPRKWSF"
FT   gene            191828..193351
FT                   /locus_tag="Saro_0188"
FT   CDS_pept        191828..193351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0188"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24637"
FT                   /db_xref="GOA:Q2GBY6"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY6"
FT                   /protein_id="ABD24637.1"
FT                   /translation="MAEMVTIKEADLIESVADALQYISYFHPMDYIRALGEAYKAEQGP
FT                   AAKDAIAQILTNSRMCAEGHRPICQDTGIVNVFIEWGQDCRLESDLSLQDVVDEGVRRA
FT                   YNNPDNKLRASVLADPAFTRRNTRDNTPCVLHVEMVKGNKVTVDVAAKGGGSENKSKFK
FT                   MMNPSDSIVDWVIEMLPQMGAGWCPPGMLGIGIGGTAEHCVLLAKKALMEPIDMAQLKQ
FT                   RGPQTDIERLRIEIFDKVNALGIGAQGLGGLSTILDVKIMDAPCHAAGKPVAMIPNCAA
FT                   TRHAHFTLDGSGPTFLERPKLDEWPEVHWAPDSAARRVDLDTLTQEEVQSWKAGDRLLL
FT                   NGKMLTGRDAAHKRIKDMLAKGEELPVDFKGRVIYYVGPVDPVRDEVVGPAGPTTATRM
FT                   DSFSDTMLDLGLLASVGKAERGPAATQSIANHKSAYLMAVGGAAYLVARAIKEAKVVGF
FT                   EDLGMEAIYEFTVEDMPVTVAVDSGGQNVHQLAPLVWKKKIAEEHLLPA"
FT   gene            193439..195367
FT                   /locus_tag="Saro_0189"
FT   CDS_pept        193439..195367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0189"
FT                   /product="histidine kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24638"
FT                   /db_xref="GOA:Q2GBY5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY5"
FT                   /protein_id="ABD24638.1"
FT                   /translation="MTLSQIDPGVPRVPARQVILSAVALWLCYFVLITVRGLVVELGDF
FT                   SDLLWRRALVTVAGIVVTVACWPLLRRFDARPLATRVGAALVIMLPAALALAAVNQWAF
FT                   APVEKRMIERISTDQGDEAPTRTSQVTVKNGDGKGGAVKIRHDMAGNVLVDVLDEGFVP
FT                   PVPAPPPAPPPAPRTPHPTHAPGSTAHASPTTEPLLSEEDVAELRNLGDERTIEALKNA
FT                   GIVQNPDGSTVISQPGLYVRQYADGRSEVRTGGKVYVVGDDGEVESILSGARDPVPPEP
FT                   PAPAASAVPPAPPAPPAPAISAAMQEKVREAARRETEKALGKADALRKAALARAREARA
FT                   RHADAHPVAQPSVSARPAVSAEPAASATPEPSPSEIVTEDYRGSDHVTIIRQTVENEGL
FT                   WRQLTDVALGRYFLLIAWAALYLALGNGEQLRAAEYREGEYRRAAKASELRSLRYQVNP
FT                   HFLFNTLNSLSALVMVGRSEQAERMIQSISRFYRHSLAGDPTADVPLEDEIALQRHYLD
FT                   IEAVRFPDRLRCEFDVPDDLMTACVPGMILQPLVENSIKYAVSTTIRPVTIRIAAREAG
FT                   GFLILTVADDGPGESFVNGGTGIGLANVKSRLAARFGEDAAKVESGPLPAGGYATVLTL
FT                   PIVRNEC"
FT   gene            195378..196112
FT                   /locus_tag="Saro_0190"
FT   CDS_pept        195378..196112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0190"
FT                   /product="transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24639"
FT                   /db_xref="GOA:Q2GBY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY4"
FT                   /protein_id="ABD24639.1"
FT                   /translation="MRTLIVDDEPLAVERMQILCARIPALQVVGTASDGAAALRLIEAL
FT                   APDLVLLDMTMPEVDGLGVARALAGQASRPAVVFVTAHDDFAVEAFDCDAVDYVLKPVA
FT                   QERLERAVERAQARRSAAPETPLTPERAASEWIEEFWVPHRSELIRVAASDLERIDAER
FT                   DYVRLHVGQRSYLMLHTIAGLEARLDPDRFIRLHRSTIVRRDRIAGLKHDGLGVWSAEL
FT                   ADGTMQRIGRTYLARVKAMAGR"
FT   gene            complement(196166..197983)
FT                   /locus_tag="Saro_0191"
FT   CDS_pept        complement(196166..197983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0191"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24640"
FT                   /db_xref="GOA:Q2GBY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY3"
FT                   /protein_id="ABD24640.1"
FT                   /translation="MQLSDFAAYPNLVAMFLDRAGTRGDSPFLWAKHDGQWRPISWAET
FT                   VRQVCLLAEALRGLGLNPGDRVALVSENRPEWCVADLAIMAAGLVTVPTYITNTERDHL
FT                   HILENSGARAVIVSTAKLSQPLLPAALSAPCVEHVIGMEPLRQMQAGKLSFHDWDTMMT
FT                   GDAAAARRAVDERLRTVDRADLACIIYTSGTGGSPRGVRLHHGSILQNVEGAAHILAED
FT                   FGWDEEVFLSFLPLSHAYEHTGGQFLPIGMGAQIFYSEGLEKLASNIEEVRPTIMVVVP
FT                   RLFEVLRTRIMKQVEKQGRVANYLMDRALSIGGRKAAGKGRLIDAPMNLVLDRTLRPKI
FT                   RARFGGRMKAMVSGGAPLNPDVGVFFQSMGLTMLQGYGQTEAGPVISCNRPRVGLKMDT
FT                   VGPPMKGVEVKIAEDGEILVRGELVMHGYWQNEAETARAVPQNGPNAGWLHTGDIGHLD
FT                   KKGRIVITDRKKDMIVNDKGDNVSPQKIEGMLTLQPEIAQAMVSGDKRPYIVGLIVPDP
FT                   EWALDWSRAQGEHFDFKKLQDLPAFRNAIRAAVDRVNKDLSVIEKVRQFTFTDEAFSID
FT                   NGEMTPSLKIRRHKIRERYGARIDGLYKA"
FT   gene            complement(198104..199855)
FT                   /locus_tag="Saro_0192"
FT   CDS_pept        complement(198104..199855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0192"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24641"
FT                   /db_xref="GOA:Q2GBY2"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY2"
FT                   /protein_id="ABD24641.1"
FT                   /translation="MKMPPLLLRYAPLAGVLLASACVPPPSAPVAPAPRPAADGSVPVE
FT                   GPGLVSAADPRAAEAGAQMLRLGGSATDAAIATMLALTVVEPQSSGIGGGGFLVTGDAA
FT                   GAVSTIDGRETAPRAATPEWFYVGGKPLPYADAIPGGRSVGVPGNLRLAAHAHNARGRL
FT                   SWRTLFQPAIRLARDGFAITGRLRSSLESFARTGALDPAARALFYGPDGQPLPVGTIVR
FT                   NPALAATLEGIAARGADSFYTGDNAATLAAKVGTAPVNPAPMTTADIAAYKAVERTPLC
FT                   GQYRTYRICGMGPPSSGATTVYAILEQLERFDMKTLGPASPVAWHLIAESQRLAYADRD
FT                   QYLADADFVQVPVAGLSDPAYLAGRSALISESATMPTVLPGTPPGAKLAFARAEPQDEN
FT                   GTTHFVAVDRWGNAASYTSTIEGPFGSGLMVGGYYLNNELTDFNIVPDKDGKPTANRVE
FT                   GGKRPRSSMAPTLVYGPDGKLRLAIGAAGGATIPAQVAKAIIGVLDWNLSARDAIALPV
FT                   IFAPGGDTVFVERGTSLEAMIPALQKLGHAKILARPPGFKANAIERVGNTWRGAADPRS
FT                   EGIAVAP"
FT   sig_peptide     complement(199790..199855)
FT                   /locus_tag="Saro_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.862) with cleavage site probability 0.837 at
FT                   residue 22"
FT   gene            complement(199866..200915)
FT                   /locus_tag="Saro_0193"
FT   CDS_pept        complement(199866..200915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0193"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24642"
FT                   /db_xref="GOA:Q2GBY1"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBY1"
FT                   /protein_id="ABD24642.1"
FT                   /translation="MTPYSLLRPLIFRIPAEPAHRLTIKALGLAQGGTTLAPTPSLAQR
FT                   IAGLAFPNPVGMAPGFDKNAEVPDAMLGLGFGFVEVGTVTPRPQEGNPKPRLFRLVEDR
FT                   AVINRMGFNNEGAQAVTNRLVRRRETGKHGLPGIVGVNIGANKDSADRIADYALMTRLM
FT                   APLASYLTVNISSPNTPGLRALQDEGALAALLDAVIEARGNMTTPVFLKLAPDLEPADI
FT                   DSICRIAIEKQLAALIISNTTITRPVLRSAHAGEAGGLSGAPLRELALQRLRDFRKASG
FT                   GAIPLVGVGGIATVDDAWERIRAGASLIQIYSAMVYEGPGLARRLVAGLERKVREAGLT
FT                   SIAEAVGSE"
FT   gene            201349..201789
FT                   /locus_tag="Saro_0194"
FT   CDS_pept        201349..201789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0194"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24643"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR014290"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBY0"
FT                   /protein_id="ABD24643.1"
FT                   /translation="MRLSSMADYAVVTMCAAARHCGQQRVSAQQLADETGLPAPTVQKL
FT                   VSKLSSAGLLKSVRGARGGLKLARPAAAITLADIVEAVEGPIALAPCSEHGRHDCTLES
FT                   ACTVRPHWPAVDAALRGALAGIPLTQLSRPAVQAVPVAEVLA"
FT   gene            201786..203267
FT                   /locus_tag="Saro_0195"
FT   CDS_pept        201786..203267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0195"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24644"
FT                   /db_xref="GOA:Q2GBX9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX9"
FT                   /protein_id="ABD24644.1"
FT                   /translation="MTDNTEVKDQAAREAAARVAEYEHGWVSDIEQEYGPKGLSEDTVR
FT                   FISAKKDEPEWMLEWRLKAYRHWLTMPTPEWAKLNIPPIDYQEAYYWAAPKAKPKLGSL
FT                   DEVDPEILRVYEKLGIPLEEQKVLAGVEGARKVAVDAVFDSVSVATTFRKELEAAGVIF
FT                   RSISEAIREYPDLVRKWLGKVVPMHDNYFATLNCAVFSDGTFVYIPEGVRCPMELSTYF
FT                   RINAENTGQFERTLIVADKGSYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTV
FT                   QNWYPGDAEGRGGIYNFVTKRALCQGARSKVSWTQVETGSAITWKYPSCVLNGEDSVGE
FT                   FYSVAVTNNHQQADTGTKMIHNGKGSRSTIVSKGISAGKSNNTYRGLVRVAPQAEGVRN
FT                   FTQCDSLLLGSDCGAHTVPYIEVRNPSATIEHEATTSKISDDQLFYAMQRGLDQESAVA
FT                   LIVNGFAREVLQQLPMEFAVEAQKLLGISLEGSVG"
FT   gene            203407..203928
FT                   /locus_tag="Saro_0196"
FT   CDS_pept        203407..203928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24645"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX8"
FT                   /protein_id="ABD24645.1"
FT                   /translation="MKKTLSLRPASERADVPNIQKKGRGWVISGSRLDAIHDMAREMRR
FT                   EPDEAHAALAEELAKEDLGKYKFKRYAVIGSAIVDFACQPLKLVVALDRGDAPEIERRR
FT                   DASLAAVGLKVVRYDAAEVLGDPEGAGRAVLAAMKARYEELRAAARPQRSTYSRSGARP
FT                   QRSHSPRSRG"
FT   gene            203940..204683
FT                   /locus_tag="Saro_0197"
FT   CDS_pept        203940..204683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0197"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24646"
FT                   /db_xref="GOA:Q2GBX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX7"
FT                   /protein_id="ABD24646.1"
FT                   /translation="MLTIENLQANVADKPILKGLSLTINAGEIHAIMGPNGAGKSTLGY
FT                   TLGGRPGYEVTGGSATLDGADMLGMEPHERAAAGLFLGFQYPVEIPGVSFVQFLREAAN
FT                   AQRKARGEAPLSGGEFLKLAKEKAALLRMDMDMLKRPVNVGFSGGEKKRAEMVQMGILD
FT                   PRIAILDETDSGLDIDALRICGEGINAIMRKPDKAVLLITHYQRLLDYVKPDFVHVLAS
FT                   GRIVKSGGPELALELEEHGYEAVAA"
FT   gene            204680..205414
FT                   /locus_tag="Saro_0198"
FT   CDS_pept        204680..205414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0198"
FT                   /product="SufBD"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24647"
FT                   /db_xref="GOA:Q2GBX6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX6"
FT                   /protein_id="ABD24647.1"
FT                   /translation="MTALALPTRKDEAYRYADLAALEKLWPLPAQEIRVAAGEEGALAV
FT                   VLDGGNDAARDISIVLEDGASFDLRLLNAGSAYGRIAVAVRLGKGARFHLGAAQVAGGE
FT                   QVAEIVTEVTHAEPDAVSSQVVRSVLGGKATGTYLGRVVVARGAIGTDGEQSIRAMLLD
FT                   RRATANARPELEIYADDVKCAHGCAVGELDATGLFYLQSRGLPPAEAKKLMLQAFIAEA
FT                   FVGAADEEVLTDAALKALEAVL"
FT   gene            205411..206622
FT                   /locus_tag="Saro_0199"
FT   CDS_pept        205411..206622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0199"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24648"
FT                   /db_xref="GOA:Q2GBX5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX5"
FT                   /protein_id="ABD24648.1"
FT                   /translation="MSVDTITRGAQWPGLLNPDGSRWHYLDTAATAQKPQVVIDAVTRA
FT                   LGADYATVHRGVYARSADMTLAFEAARRKVAGLVNGDEGEIVFTRGATEAINLVAQTWG
FT                   QANLKAGDRILLSTLEHHSNIVPWQLLRDRTGVEIDVCPLTEDGRIDLAAAERILTPAH
FT                   KLVALAHVSNVLGSVLDVAQAVRLARAVGAKILLDGCQAVPRLAVDVKAMDADFYVFSA
FT                   HKLYGPTGIGALWAKAAILDAMPPWQGGGAMIDRVTFERTTYAPAPQRFEAGTPAIVEA
FT                   IGFGAAVDFVQAQGLDAIHAHEVALVAKAREALGRMNSVRLFGPEDSAGIVSFAIEGVH
FT                   PHDLGTILDEEGVAIRAGHHCAQPLMDHLGVPATARASFGIYSDESDIAALVRGIERTK
FT                   RIFG"
FT   gene            206619..207101
FT                   /locus_tag="Saro_0200"
FT   CDS_pept        206619..207101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0200"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24649"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX4"
FT                   /protein_id="ABD24649.1"
FT                   /translation="MSSEDPKFAVEEVEAVAAPRRAFVEDAVEETPAEKLERKRDYLEG
FT                   FLAAKPEGVSPGEPGGDIYEGVVNALKEIFDPEIPVNIYDLGLIYGVDVSDDAHVMVTM
FT                   TLTTPHCPVAESMPGEVELRVSAVPGVREAEVNLVWDPPWDPQKMSDEAKLELGML"
FT   gene            207125..207487
FT                   /locus_tag="Saro_0201"
FT   CDS_pept        207125..207487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0201"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24650"
FT                   /db_xref="GOA:Q2GBX3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX3"
FT                   /protein_id="ABD24650.1"
FT                   /translation="MTTETKVRRPRPAAVILTASAEARIANLMENAPEGAIGVKLSTPR
FT                   RGCSGLAYSVDYVTEANPMDERIETPGGLFFIDSASVLYLIGSTMDWQEDDFTAGFVFQ
FT                   NPNAKGSCGCGESFTV"
FT   gene            207563..208901
FT                   /pseudo
FT                   /locus_tag="Saro_0202"
FT   gene            complement(208948..209598)
FT                   /locus_tag="Saro_0203"
FT   CDS_pept        complement(208948..209598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0203"
FT                   /product="DUF81 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24651"
FT                   /db_xref="GOA:Q2GBX2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX2"
FT                   /protein_id="ABD24651.1"
FT                   /translation="MAILLVPLIGLVIPPGEAVVVSNMLGLLIGLVGARKVWNEGDKSA
FT                   GVIGSLAMLLTPVGLVVLFATPPGIARVLIALVAIGAFGLVLLPTRPGHAPGRLETGLT
FT                   GAAAGLLTGFAGMPGPPVVPYYLRRPIPREVARASMLTVFLLTSIASTVAALALGLASW
FT                   RDALFAVVLFVPVLAGNHLGSLAFGKVSDAAWRGFVGFLLAMSALMAIVRLIG"
FT   gene            complement(209688..211682)
FT                   /locus_tag="Saro_0204"
FT   CDS_pept        complement(209688..211682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0204"
FT                   /product="Ser-tRNA(Thr) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24652"
FT                   /db_xref="GOA:Q2GBX1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBX1"
FT                   /protein_id="ABD24652.1"
FT                   /translation="MSELLKITLPDGSVREVAPGSTPADIAAAIGPGLAKAALAAKVDG
FT                   ELVDLTRPFTADAQLALVTAKDEAEALDLARHDYAHVLAEAVQALFPGTQITFGPSTDD
FT                   GFYYDFAPKDRPFTDEDLPAIEAEMRKIIAANKPLRREVWSREQLISRWKQQGESFKAE
FT                   WAAELPENEELTVYWSGDDWLDMCRGPHLPSTGKLDPNAFKLTRVSGAYWRGDQKNAML
FT                   SRVYGTGWLNKKQLDAHLTRLEEAAKRDHRKLGNEMDLFHLQQEAHGSVFWHPKGYLIW
FT                   RELEAYMRRAIDGAGYREVKTPQVMDARQWEQSGHWGKYRENMFVIPDEVPNVDDEGPI
FT                   VSNDADWMALKPMNCPAHVLIFRQGIKSYRELPLRLYENGCCHRNEPHGALHGLMRVRQ
FT                   FTQDDAHIFCREDQIVSEVQAFCELADRIYKHFGFTYSIKLALRPEKRFGTEEMWDKAE
FT                   RELRDAVVRAGLATEEYGWEELPGEGAFYAPKLEWHLTDAIGRTWQVGTIQSDRVLPER
FT                   LDASYIGEDGEKHRPVMLHRAIFGSYERFIGILIEHFAGRLPVWLAPVQAVVATIVSDA
FT                   DDYARDALAKLKAAGIRADTDLRNEKINYKVREHSLQKVPYLLVVGKREAEEGTVAIRI
FT                   LGEQHQKVMPLDEAIALLKGEATAPDLRA"
FT   gene            212005..212925
FT                   /locus_tag="Saro_0205"
FT   CDS_pept        212005..212925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0205"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24653"
FT                   /db_xref="GOA:Q2GBX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBX0"
FT                   /protein_id="ABD24653.1"
FT                   /translation="MQSFENEIAFITGGASGAGFGQAQVFGRAGAKIVVADVRAEAVER
FT                   AVAALKAEGIVAHGLVLDITDRQAYAGAADEVEQVFGAAPTLLFNTAGVNSFGPVEDTS
FT                   YDDFDWIVGVNLGGVINGMVTFVPRMIASGRPGHIVTTSSLGGLMGSALAAPYSAAKAA
FT                   VINLMESYRQGLDKHGIGVSVLCPANIKSNIAEASRLRPAQFGKSGYVENEESIASLHS
FT                   IHQHGMDPVELAEHVKAGIVANQLYIIPYPEAKDGLRQHFDAIVDAVLPLEADPEGARA
FT                   RTEALNAWAADRARVFMEKNAAQKA"
FT   gene            213013..213429
FT                   /locus_tag="Saro_0206"
FT   CDS_pept        213013..213429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24654"
FT                   /db_xref="GOA:Q2GBW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW9"
FT                   /protein_id="ABD24654.1"
FT                   /translation="MLARMTPERRQYTRAVMLLMGGYAATLVGVNLIFEASRPTGISAY
FT                   AAALLPALPVIGVFVVIGRLLASLRDEYQRYLLTRQVLIATAFMLSVATAWGFVESFGL
FT                   LPHVPAFYAAVLWFAGLGLGGCVNAVLERSGGAE"
FT   gene            213426..213617
FT                   /locus_tag="Saro_0207"
FT   CDS_pept        213426..213617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0207"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24655"
FT                   /db_xref="GOA:Q2GBW8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW8"
FT                   /protein_id="ABD24655.1"
FT                   /translation="MKNRLKVLRAERNWSQADLAERLEVSRQSVNAIETGKYDPSLPLA
FT                   FRIADLFGLAIEEIFERD"
FT   gene            213651..214397
FT                   /locus_tag="Saro_0208"
FT   CDS_pept        213651..214397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0208"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24656"
FT                   /db_xref="GOA:Q2GBW7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW7"
FT                   /protein_id="ABD24656.1"
FT                   /translation="MNGAMSDVSRFTLPSGLAMAYRHLPGRLPAVVFLPGYMSDMAGGK
FT                   AQAVLEWARERGRACLLLDYTGCGQSEGRFADGTLSRWRDEVVALIDHLGIASVQLVGS
FT                   SMGGWLMLLVAEALGERCRALVGIAPAPDFTEWGLSQSQRIELAAGRTVYEDNPYGPEP
FT                   TPTHALFWSDGERHKRLGHEIAFDGPVRLLHGQHDADVPWDISLRLAAALRSADVQVHL
FT                   VKDGDHRLSREGDIALLLRELAGLDA"
FT   gene            214390..215325
FT                   /locus_tag="Saro_0209"
FT   CDS_pept        214390..215325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0209"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW6"
FT                   /protein_id="ABD24657.1"
FT                   /translation="MPDTPEESPRMIDLPAPMFAIEMAQDAALMQVGPSPMPMRPSDLP
FT                   IPRRRKQAEEEAGLVRPDLPQQDRLALCLAKAASDPDAAMVEVQTWLGESRDTGQQVRA
FT                   NQCLGMLRSNAGDFDGALEAFSQAVTGIPREQEVAGVPLMAMAGNAALAGGKTDEALAW
FT                   FDRALAVKGFADNAALAAIQTDRSRALVALGRNAEAAGALDEAHRLAPEDAEGWLLSAT
FT                   LARRQDDLDRAQRDIEIAAKYAPRDPQVGLEAGVIAVLSGRDEAARKSWESVVAADPQG
FT                   EAGRTAKGYLEQLGPAPKSVAPSPAEKPAP"
FT   gene            215322..216314
FT                   /locus_tag="Saro_0210"
FT   CDS_pept        215322..216314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0210"
FT                   /product="luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24658"
FT                   /db_xref="GOA:Q2GBW5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW5"
FT                   /protein_id="ABD24658.1"
FT                   /translation="MKLSVLDLVSVVEGGTVREALDNSAAAARVAEECGYQRYWVAEHH
FT                   GMEGIASAAVAVTLAHIGHATSTIRIGAGGIMLPNHNPLVIAEQFGTLDALFPGRIDLG
FT                   LGRAPGADQRIVRALRKDTNRAAEDFPADVVELQLQFAGDPRVPLQAVPGKGARPQMWI
FT                   LGSSLFGAQLAAMLGLPYAFASHFAPDHLDAALKIYRERFQPSDVLDAPYCAAAINAVA
FT                   AETDEEATLLASSMDQAFVALRTGNPGKLKPPVPGYRDSLPPPALAMLEHVRQVSATGS
FT                   VETVRRGLKAFVERTGVDEVIVAASIFDQEARRRSLRLVAEAARETVTT"
FT   gene            216557..221278
FT                   /locus_tag="Saro_0211"
FT   CDS_pept        216557..221278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0211"
FT                   /product="glutamate dehydrogenase (NAD)"
FT                   /EC_number="1.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24659"
FT                   /db_xref="GOA:Q2GBW4"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW4"
FT                   /protein_id="ABD24659.1"
FT                   /translation="MASKSAVQSPSAAAGMPAAADTLPLALAERFAAALLPDEAADFDP
FT                   ARLAEAARFAAAAASVRKGGAPAIAIESVSGSESGGRHLRIAVVNDDMPFLVDSIASAI
FT                   TAQGLAIDRLVHPVVAVRRDAEGRLVEFPDGEAAGERRESVVYLETERADARQRRALLV
FT                   SLEETLADVRAAVADWPAMQAAMRDDAGGLADPEGAALLRWLADGMLTQLGSVTRRRDS
FT                   TEEKALGICRASERSLLAASSFDRAFRWFESAGKDGQGRAPLIVKANRIANVHRRVPLD
FT                   LFMVPRIEEGRVVALSVHAGVWTSAALAAAPDRIPRLRTQLSELMDKFGFAPNGHAGKA
FT                   LVHALTALPHDLLVSFAEADLERVATAMMSLVDRPRPRLALVEAPLARHMFAFVWLPRD
FT                   VLSTEVRLAIRDMLEAGAGAQVIDWSLQVEGSTLAMLRFVLDVREQASRADEATLDMQL
FT                   QSMVRGWSGAVEAELAAHEEPSRAAAIAARYADAFPLSYRNASGPAEAARDIRVLRTLT
FT                   GGNAPRRAVRLHRNVGEAALRLKLYQREGAIVLSDAVPVLENFGFRVLEEVPTPLDGGR
FT                   LGFIHDFLVSHPGDSTVEELLDRAGSIENSLAAVLNGAAEDDAFNRLIVAIGLTASDAN
FT                   WLRAFYRYLRQAGMTFGIPTVVEALKNAPAVTRGLIDAFIARHDPDFDGDREKAFTAAE
FT                   GRMKTGLAGVAAINDDRLLRQFRALVGAILRTNAFAPAAAEALAFKIDSALVPGLPKPL
FT                   PWREIFVYSPRVEGIHLRAGPVARGGLRWSDRRDDFRTEILGLMKAQRVKNAVIVPTGA
FT                   KGGFYPKHLPDPAKDREGWLAEGKASYQVFIRTLLSVTDNIVEGKVVHPANVVIRDGED
FT                   PYFVVAADKGTATFSDVANAIAEARDFWLDDAFASGGSKGYDHKAMGITARGAWLSVRR
FT                   HFLEMGVDVQAEPVRVAGCGDMSGDVFGNGMLLSKALKLVAAFDHRHIFLDPDPDPARS
FT                   WDERARMFELPRSSWDDYDKSLISKGGGVFPRSMKAIPLSPEIQAMLGLDVTEIDPESL
FT                   ISAILRAEVDLLWFGGIGTYVKASTQNNVDVGDPSNDAVRVSANEVRAKVIGEGANLGT
FT                   TQAARIEFALNGRESGGGRINTDFIDNSAGVDCSDNEVNIKIALAAAKRSGRLTEDARV
FT                   ALLSEMTDEVAHLVLEDNRLQALALSIAERGGAAAMPAWSRLIDVLEEGGDLDRKTEGL
FT                   AGAEDLARRAAAGQGLTRPELAVLLSSSKLVLQRELEESTLVDDPVLEEELVAAFPPQM
FT                   QEAFETEIVHHRLRREIIATKLANRIVNRLGPVIPFELCEEEGSGLAQIAAAFVAAERL
FT                   LDLKGTWALLDEATMPETLRLSLFERVAQGLRGHMADVLRAGRGSTRPDALIDDLFGGV
FT                   ALLSQTTAQLLRGEAQAQARRMADELAAAGVPADIAVRLVHLFDMDGAIGLAHLAGELN
FT                   VDAAALTGAFADLGAALGIDWAQQAARRMNPSDPWERLLVAGLARDFQQMRLDFLARSR
FT                   GASPDAFVADWLAVNAVPVRQFRSLVGRAQAAPAVGAAMLAQVASQARTLLGR"
FT   sig_peptide     216557..216619
FT                   /locus_tag="Saro_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.960 at
FT                   residue 21"
FT   gene            221359..222126
FT                   /locus_tag="Saro_0212"
FT   CDS_pept        221359..222126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0212"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24660"
FT                   /db_xref="GOA:Q2GBW3"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW3"
FT                   /protein_id="ABD24660.1"
FT                   /translation="MKAAVRALLLALLALVGASPLAAQERGPLVLAASSLQEALNEAAD
FT                   RWASLRHPRPVLSFAASSALARQVEAGAPADLFLSADEEWMDHVQGKGLLRPGTRARLT
FT                   ENRLVLVAPVASRVSLRIARSFPLAKALGGGRLALADPAAVPAGRYAREALVSLGVWTG
FT                   VAGQIAAAENVRAALALVEHGAAPLGIVYATDARASKAVRVVGVFPPASHRPITYPVAL
FT                   LKTSRNPQAEGFRRFLISREGRAILARHGFGAR"
FT   sig_peptide     221359..221430
FT                   /locus_tag="Saro_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.900 at
FT                   residue 24"
FT   gene            222107..222826
FT                   /locus_tag="Saro_0213"
FT   CDS_pept        222107..222826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0213"
FT                   /product="Molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24661"
FT                   /db_xref="GOA:Q2GBW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW2"
FT                   /protein_id="ABD24661.1"
FT                   /translation="MGSARDDGSALMGPEEWEIVRLSLKVSAVAVGACLPVAFALAWIL
FT                   ARGRFAGLVLLDALVHLPLVLPPVVTGWLLLIAFGPQGPAGRWLESWIGLTFLFRWTGA
FT                   ALAAAVMALPLMVRAIRLSIEGVDRRLEAAAMTLGASRWRVFRTITLPLALPGVVAGAV
FT                   LGFARSLGEFGATITFVSNIPGETRTLPLAIYSALQVPGAEAEVTRLALVSVLLSLAAL
FT                   VVSEVLARRAGRAGHVL"
FT   gene            222816..223424
FT                   /locus_tag="Saro_0214"
FT   CDS_pept        222816..223424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0214"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24662"
FT                   /db_xref="GOA:Q2GBW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW1"
FT                   /protein_id="ABD24662.1"
FT                   /translation="MSFEVRVRKRLGDTVVGATFAAEGGLTALFGPSGAGKTSVLNMVA
FT                   GLLPPDEGRIVVGGEVLFDSAAGVDVPVQRRRAGYVFQDGRLFPHMRVRENMVYGLAGE
FT                   GLMTPQAAADFLGIAHLLDRWPRSLSGGEAQRVAIGRALLSNPVFLLMDEPLAGLDRAR
FT                   REDVMRAIERLRDEVGLPILYVSHDRAEVERLAGRIVEI"
FT   gene            complement(223426..224685)
FT                   /locus_tag="Saro_0215"
FT   CDS_pept        complement(223426..224685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0215"
FT                   /product="6-aminohexanoate-dimer hydrolase"
FT                   /EC_number="3.5.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24663"
FT                   /db_xref="GOA:Q2GBW0"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBW0"
FT                   /protein_id="ABD24663.1"
FT                   /translation="MSYNIRRRATASERRATGRPWQLTMKKCALLTAALIAASPVRAEA
FT                   PAPLPPDPVISMRQHWLDADINSYNFRNSAQIFETRTVARGGKTWPLAKGPAATLPADY
FT                   DAWARRTYTNALLVIHDGRITFENYRNRTTPEDRFISFSMAKTITALLVGLAVEDGKIR
FT                   SIDDPVSAYVPELKGGGYDGVSIRHVLQMRSGVAYEERYDFGANPSLAALIHMNAIVAN
FT                   KERFADRARTIGKASEPGSRFNYATLDTAVLGWVVERATGEKLASYMSRRLWQPAGMEA
FT                   DGFWIADGPEGTGRELSGMGYNARLRDFGRLGLMLLNKGKANGRQVVPAGWVQQQTTMI
FT                   PFADSSALGLGRGYGFQTWQLDDEPGAYSAVGLAGQFIYVHPATNTVIVKLSHFPNPEP
FT                   AGVVEETLKGFHAIVAGYRK"
FT   sig_peptide     complement(224554..224685)
FT                   /locus_tag="Saro_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 44"
FT   gene            224840..226087
FT                   /locus_tag="Saro_0216"
FT   CDS_pept        224840..226087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0216"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24664"
FT                   /db_xref="GOA:Q2GBV9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:3LXD"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV9"
FT                   /protein_id="ABD24664.1"
FT                   /translation="MASEVQAERADVVIVGAGHGGAQAAIALRQNGFEGRVLVIGREPE
FT                   IPYERPPLSKEYLAREKTFERICIRPAQFWEDKAVEMKLGAEVVSLDPAAHTVKLGDGS
FT                   AIEYGKLIWATGGDPRRLSCVGADLAGVHAVRTKEDADRLMAELDAGAKNAVVIGGGYI
FT                   GLEAAAVLTKFGVNVTLLEALPRVLARVAGEALSEFYQAEHRAHGVDLRTGAAMDCIEG
FT                   DGTKVTGVRMQDGSVIPADIVIVGIGIVPCVGALISAGASGGNGVDVDEFCRTSLTDVY
FT                   AIGDCAAHANDFADGAVIRLESVQNANDMATAAAKDICGAPVPYKATPWFWSNQYDLKL
FT                   QTVGLSTGHDNAVLRGDPATRSFSVVYLKGGKVVALDCVNMVKDYVQGKKLVEARAQIA
FT                   PEQLADAGVPLKEMLA"
FT   gene            complement(226099..227148)
FT                   /locus_tag="Saro_0217"
FT   CDS_pept        complement(226099..227148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0217"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24665"
FT                   /db_xref="GOA:Q2GBV8"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV8"
FT                   /protein_id="ABD24665.1"
FT                   /translation="MVKTAVTSLEDRLKAEATRLGFAVCGIAPAADDPLRAERLEQWLG
FT                   EGRHGSMEWMETRLHHRRGPQSLWPEARSVIALGMSYAPADDPRRLADAGDRGRISVYA
FT                   QGADYHDVIKRNLKALARWLVAEEPGAGVKVFVDTAPVMEKPLGQMAGLGWQGKHTNLV
FT                   SRSHGSWLFLGAIYTTLGLDLDAPHADRCGSCTACQTACPTEAFPAPYRLDARRCISYL
FT                   TIEHKGPVPEEFRKALGNRIYGCDDCLAACPWNSFATTAQANRAFLPRAELAAPRLAEL
FT                   LALDDATFRQVFSGSPIKRIGRDRMVRNCLYAAGNSGDRALLPVVHNLLADPDPAVADA
FT                   ARWALVELG"
FT   gene            227195..228184
FT                   /locus_tag="Saro_0218"
FT   CDS_pept        227195..228184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0218"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24666"
FT                   /db_xref="GOA:Q2GBV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV7"
FT                   /protein_id="ABD24666.1"
FT                   /translation="MKIELGEWPVSGNAEGLAGTELAIEARGLVKRFDGFTAVDGVDIS
FT                   VPKGSIYGILGPNGAGKTTTLRMLLGIIDPDEGYRRVLGHERPTEVARRIGYLPEERGL
FT                   YPAMKAYEAIGFLAALRGVPLKEGRRRGRELLEEHGLGYAADRQIRQMSKGMAQQVQLL
FT                   GTLVHQPDLVVFDEPFSGLDALNQGKLERMIRALAERGTTVIFSTHVIAHAERLCDQVA
FT                   IIAGGKVPFAGPVDVARDRLRPQVRLETRAQDGPWRAVLPADARHEGAFWYFTLPEIGV
FT                   EPLLRALIEGDAGILSLSIERAGLHDAFVAIAGEAAARALEESAGETR"
FT   gene            228181..229425
FT                   /locus_tag="Saro_0219"
FT   CDS_pept        228181..229425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0219"
FT                   /product="ABC-type Na+ efflux pump permease component-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24667"
FT                   /db_xref="GOA:Q2GBV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV6"
FT                   /protein_id="ABD24667.1"
FT                   /translation="MIGLSEKLRAALVIARRDFVAVIFSKTFIFFLIGPAFPILVGGLA
FT                   GNIGAKVQQNVDRPTIGLALAGDEADRMLAARDELDGRLAGPIPEMVVLRRLAPGEDFD
FT                   ARAALADGERQVTAVVGGTLESPTLTAPGERARQWAGLVSNLAAHARAGGALVYPEVRV
FT                   AEVNTSVAKVKTGQAYTAQGAQVLLFLLTMLLAGMVLSNLVEEKGNKIIEVLAAAIPMD
FT                   AMFMGKLFAMLGVSLVGIAVWGTVGGGIVLVGGKALPAMATPAVGWPLFLALGFLYFAM
FT                   AYLLMGSLFLSIGGMATTVREVQTLSMPVSMFQLMVFFFASYALTMPGTWVEWLSIGFP
FT                   VSSPYAMLARAAQHEEVWPHVVALGWQVLWVVLIVRAGAQLFRRTVMKSGPARSRSGGR
FT                   GLLARLLRRGERKPY"
FT   gene            229503..230840
FT                   /locus_tag="Saro_0220"
FT   CDS_pept        229503..230840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0220"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24668"
FT                   /db_xref="GOA:Q2GBV5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:6HQW"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV5"
FT                   /protein_id="ABD24668.1"
FT                   /translation="MATQLAPEVPQFTYHSSPTATEAFAAWLKDNPQAIPAHSHPWDVS
FT                   RSDIYVEDRWQPIFAEMRAKAPVNRVPDSPYGAYWNVASHKAIMHVESLPELFSSSWQY
FT                   GGITIGDPPEDVDPQKLAERQLPMFIAMDRPDHTGQRRTVAPAFTPAKMVEMEAEIRRR
FT                   TASVLDSLPWGERFDWVDKVSIELTTGMLAILFGFPWADRRLLTFWSDWAGDVELTLAR
FT                   ELADTRFGFLGEMAHYFQRLWGARMQAPPSGDLISMMIHSEAMNHMSPQEFMGNLVLLI
FT                   VGGNDTTRNTMSGIVHALDKFPDQRELLERDASLIPNAVQECIRYVTPLAHMRRTATAD
FT                   TELFGNQIKAGEKVILWYISANRDETVFENPDKLMVDRPNARRHLSFGHGIHRCVGARL
FT                   AELQLRILLEEMHERRMRVRVAGEVERVRANFVHGFRKLEVELEKR"
FT   gene            230975..231466
FT                   /locus_tag="Saro_0221"
FT   CDS_pept        230975..231466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0221"
FT                   /product="Protein-methionine-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24669"
FT                   /db_xref="GOA:Q2GBV4"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV4"
FT                   /protein_id="ABD24669.1"
FT                   /translation="MMPDADRRRFLALLGAGAVMPLASACSARPAAKGTFPIMHSDAEW
FT                   RRLLTPEQYYILREAGTERPFTSPLLKEKRKGAFVCAADGNALFASGTKFESGTGWPSF
FT                   WRPLPRAVGTSSDRTLGMVRTEVHCSQCGGHLGHVFDDGPPPTGLRYCINGDALKFRPA
FT                   "
FT   sig_peptide     230975..231052
FT                   /locus_tag="Saro_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.547 at
FT                   residue 26"
FT   gene            complement(231568..231852)
FT                   /locus_tag="Saro_0222"
FT   CDS_pept        complement(231568..231852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0222"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24670"
FT                   /db_xref="GOA:Q2GBV3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBV3"
FT                   /protein_id="ABD24670.1"
FT                   /translation="MSRICELTGKGRQVGHNVSHANNKTKRLFLPNLQNVTLLSEKLDR
FT                   SFKFRVSTHGLRSVEHNGGLDNWLLKQSDTKLSARALKVKRELVKASAA"
FT   gene            231976..232431
FT                   /locus_tag="Saro_0223"
FT   CDS_pept        231976..232431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0223"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24671"
FT                   /db_xref="GOA:Q2GBV2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV2"
FT                   /protein_id="ABD24671.1"
FT                   /translation="MTRWPLPEPMRLALDEALRAADEGEVPIGAVVVKDGKVVAAAHNR
FT                   PRTLRDPTAHAEMLAIRAAAAQLGQERLEGCDLWVSLEPCAMCAGAIAHARIARVYYAA
FT                   SDPKGGAVEHGSRVFDQPTCLHRPEVYSGMGEAEAAEMLRTFFRDRR"
FT   gene            complement(232442..233143)
FT                   /locus_tag="Saro_0224"
FT   CDS_pept        complement(232442..233143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0224"
FT                   /product="ribonuclease T2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24672"
FT                   /db_xref="GOA:Q2GBV1"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV1"
FT                   /protein_id="ABD24672.1"
FT                   /translation="MIRQALALLLLSIPGAGLAQGWQCSIPPQIAVPRLPAPDAPPRLT
FT                   PITGYTLAASWSPEFCRTRKDDPRHATQCSGKHGRFGFVLHGLWPEGRDGQFPQYCPSR
FT                   RLPDAQTLRRNFCTTPSADLMMHEWARHGTCMSADPAAYFDKGRALFQSLRFPDMARLS
FT                   RTPGLDASKMREAMSVANPQLRPDMIRLLLGRDGWLREVHVCLSRRMKPARCPGGTKPA
FT                   DTVPVKIWRSF"
FT   sig_peptide     complement(233084..233143)
FT                   /locus_tag="Saro_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 20"
FT   gene            complement(233145..233567)
FT                   /locus_tag="Saro_0225"
FT   CDS_pept        complement(233145..233567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24673"
FT                   /db_xref="GOA:Q2GBV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBV0"
FT                   /protein_id="ABD24673.1"
FT                   /translation="MRPASIQWFERLYLGSLVIGLANLLFHYGKLSSMMGSLGGSMGFV
FT                   FVSFFAGLAISLAFWYLVARRASNLAKWFLVALVALGLLGLPGSFSMTGTLGTPYIALG
FT                   ALATLVQTVSVGLLFTPEARRWFADKGAPTSPDVFE"
FT   gene            complement(233605..234471)
FT                   /locus_tag="Saro_0226"
FT   CDS_pept        complement(233605..234471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0226"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24674"
FT                   /db_xref="GOA:Q2GBU9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU9"
FT                   /protein_id="ABD24674.1"
FT                   /translation="MSSFSIPGFDLEAFVAATLAEDLGQGLPGGGHDVTSESVIPADAR
FT                   FTGTMDSRDAITVCGLPIAAAFFRALDPQMKIEILVEEGARVAPGSDLMRLEGNARAML
FT                   TAERSALNTVQHLSGVATLTRQYVDAMGETQARLLDTRKTIPGLRHLEKYAVRTGGGTN
FT                   HRMGLWDAAMIKDNHVLVAGGVAEAVRRALSAGVRDVICEVDHIDQIEPALAAGATRLL
FT                   LDNMGPDLLRQAVALVAGRVPCEASGGVRLDTIGAIAASGVDYVSVGRLTQSAPAADIG
FT                   LDFTPLG"
FT   gene            complement(234587..235384)
FT                   /locus_tag="Saro_0227"
FT   CDS_pept        complement(234587..235384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0227"
FT                   /product="transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24675"
FT                   /db_xref="GOA:Q2GBU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU8"
FT                   /protein_id="ABD24675.1"
FT                   /translation="MTIRTILVDDEKLAIQGLQLRLQAFPDVEVIDTCSNGREAIRKIK
FT                   TEKPDLVFCDIQMPGFDGFSVVKGVMEIDPPLFVFVTAYSEHAIKAFEANAVDYLLKPV
FT                   EEDRLADALDRARTRLSEKRSREEAEKLKTVLAEVAPDAMPEIDDEGEPAAGRFEKLIN
FT                   IKDRGQIFRVDVDTIERIEAAGDYMCIYTGDNSLILRETMKDLERRLDPRVFQRVHRSK
FT                   IVNLDQVRQVRPHTNGECFLVLESGAEVKVSRSYRDVVARFVH"
FT   gene            complement(235497..236642)
FT                   /locus_tag="Saro_0228"
FT   CDS_pept        complement(235497..236642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0228"
FT                   /product="histidine kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24676"
FT                   /db_xref="GOA:Q2GBU7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU7"
FT                   /protein_id="ABD24676.1"
FT                   /translation="MAALPFRPTPFFGNKNRAFWRLQFLGWGGAMLLRAMSSIANAQPW
FT                   SFLVIVVIATITGFSISLLLSVIYRAVINRRPIVTWGVTALVLSAAVGLYAFIDSWVIS
FT                   LYRQGGDASFAQLFLGVFYLDLTLLISWTGLYYAINFFLQVEEQNDQLMRLEAQATSAQ
FT                   LAMLRYQLNPHFLFNTLNSISTLVLLKQTEPANAMLSRLSSFLRYTLVNEPTARVTVAQ
FT                   EIETLKLYLDIELMRFEERLRTEFRIDDAVRNALMPSLLLQPLVENAIKYAVSPMEYGA
FT                   EITIEAQLVGPMLRVTVSDTGPGLPPGTDPSTVFGVSTDSTGIGLANIRDRLAQAYGEN
FT                   QRFDISNRPEGGFQVVLELPFEARPAPPVATPARIPAGATA"
FT   sig_peptide     complement(236514..236642)
FT                   /locus_tag="Saro_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.976 at
FT                   residue 43"
FT   gene            complement(236715..237512)
FT                   /locus_tag="Saro_0229"
FT   CDS_pept        complement(236715..237512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0229"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24677"
FT                   /db_xref="GOA:Q2GBU6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU6"
FT                   /protein_id="ABD24677.1"
FT                   /translation="MADSQPRRLGAFALIAVLIALVGAVAGWWYESRRTDGESGEDAQL
FT                   EASLAGAGIDGKERAAIEGLVRSYILDHPEILPEAMERLQQREAGARIAPMRGALETPF
FT                   PGAVLGNPAGKVTLVEFTDYACTYCRQSVKALDALIAKNPDLRVVVRELPIIAPESAPA
FT                   ARMALAAAAQGKYPAYHKAMFEGPRPSDASIAAAAGAAGLDLAAARAFGARNDVEEELK
FT                   RNLEMARQLGINGTPAWVVGGRLIHGAVPEADLQAAIDDARKG"
FT   sig_peptide     complement(237432..237512)
FT                   /locus_tag="Saro_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.770 at
FT                   residue 27"
FT   gene            complement(237523..238908)
FT                   /locus_tag="Saro_0230"
FT   CDS_pept        complement(237523..238908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0230"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24678"
FT                   /db_xref="GOA:Q2GBU5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU5"
FT                   /protein_id="ABD24678.1"
FT                   /translation="MKRSARFPSIILARLLAALAALALCVEPAAAQSVLRDAETEALFR
FT                   DASAPIFKAAGFNPNAVDLVLLNDGSINAFVAGGQAIYIHSGLIGAADNVNELQGVIAH
FT                   ELGHITGGHIIRYDEGLKPATGITVLSLLLGGLAAAAGSPDAAMGVFMAGQQAALGKFL
FT                   AFSRAQESSADAAGAQFLAKAGISGRGSIEFFKKLQNQEFRYGYSPRRNPDAEFYSTHP
FT                   MTADRLTTLQDTYEKDPAWNSPPPAELQARFLRVKAKLYGYLAEPQDTLRAYPEYLTDV
FT                   PARYARAYAFHKEAFVDKALDETKALIAKDPKNPYFLELEGQILLESGRPAEAIPPLRE
FT                   ATALTGNEPLIATTFGHALIATEDKDNFAEAEKVLKTAVARDKDNPFTWYQLGVVYEAK
FT                   GDIPRARLASAEQQLMNMQLGDAVRSAEAAEAALPKGTPDWLRAQDIAMSARAMLERQK
FT                   KSR"
FT   sig_peptide     complement(238813..238908)
FT                   /locus_tag="Saro_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 32"
FT   gene            complement(238919..239863)
FT                   /locus_tag="Saro_0231"
FT   CDS_pept        complement(238919..239863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0231"
FT                   /product="Esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24679"
FT                   /db_xref="GOA:Q2GBU4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU4"
FT                   /protein_id="ABD24679.1"
FT                   /translation="MGWIGWTVVTFVLLAGLGFVAFRHALETNAVGVLNTADRLLNGGD
FT                   GAIRQVAAVRYGADPAQKLEMFVPAAAREPLPIVVFVHGGSWASGDPHDYRFMARTLCA
FT                   EGYAVVLAGYRLYPHARYPAMLEDGAAALRWVRDNAARLGGDPARIALMGHSAGAYNVV
FT                   MLTLDRQWLRGAGVDEHAIRGTVSLAGPFDFLPFDSPATIHSFGKAPDPSMTQPINFVR
FT                   ADAPPMLLVTGDSDTRVKPRNSRRLARLLSDAGAPNQPVVLRGVTHESIIMAFARPFSR
FT                   DRTVLDAVLPFLARVTARAPDAPASVAVQAAAR"
FT   sig_peptide     complement(239786..239863)
FT                   /locus_tag="Saro_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.934) with cleavage site probability 0.931 at
FT                   residue 26"
FT   gene            complement(239934..241280)
FT                   /locus_tag="Saro_0232"
FT   CDS_pept        complement(239934..241280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU3"
FT                   /protein_id="ABD24680.1"
FT                   /translation="MDTLRGFDRDSTGAEFDLGGYEDDVASEPPPVVGQDERRMQVRAY
FT                   NYWASQLGTGSFPRVTPLLEGHNPDFADNIVLLHFDAGIEDPAIVWLGQKLADECGTET
FT                   SIHRLSQIPGRSLLSRITDHYMQIIANQAPIGFEAEFVNQYGRTVLYRGILLPYSSDGT
FT                   AIDYIMGAINWKELADQQTTDELLLEIGQALDTAPIKSQPRRPLAEATDAWADGPAALD
FT                   LGDFPEPAFGLDDDILPLPAKADEPAPEALADWLASARELALVANSSEDRTRSALYAAI
FT                   GRAWDFALAAQGRPEDFAELLEDAGLTMQERAPMTPVVKLVFGADYDKTRLTEYATALT
FT                   HAQRVGLGQGELGRYLSEAPGGLKGVVNAERRLRREEAGKALAKRGPDALAESLRALAP
FT                   RKISEIAPPEGAEFALVMVRRLESGEIVALGEVADDAALFERAARHLIG"
FT   gene            complement(241371..242273)
FT                   /locus_tag="Saro_0233"
FT   CDS_pept        complement(241371..242273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0233"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24681"
FT                   /db_xref="GOA:Q2GBU2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU2"
FT                   /protein_id="ABD24681.1"
FT                   /translation="MTQDHPTSASTAASGPLRSVLYMPASNARAMAKARTLDCDAVALD
FT                   LEDAVAPEAKADARAALVAETQAGGFGHRRLIARINALSTPWGHDDIRALAAAPVEAVL
FT                   APKVDDAADIEALSRAMDDAGFPTEVALWVMIETPRAVLALERIAATAATTRLAGFVLG
FT                   LNDLAKDSGIAQLPGRAAFLPVLTMAVLAARANGLVVLDGVCNAIEDKDRLEAECVQAR
FT                   DSGFDGKTLIHPAQLEICNRVFAPTDAAIAEAQAIVAAFADPANAGRGALRVDGKMVEF
FT                   LHLAQAKQLLAKAEAIARR"
FT   gene            complement(242270..243529)
FT                   /locus_tag="Saro_0234"
FT   CDS_pept        complement(242270..243529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0234"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24682"
FT                   /db_xref="GOA:Q2GBU1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU1"
FT                   /protein_id="ABD24682.1"
FT                   /translation="MPAIPSQNPSGGALAPFRYPAFRAIWTANLFSNIGSMIQSVGAAW
FT                   LMTELTTSHLLVALVQASATIPILLLGMFAGAIADNYDRRRVMLAAQSGMLVVSAVLAV
FT                   LSYTDNIGPWSLLALTLMVGMGTALNGPAWQASVRLQVAHADLPQAISLNAISFNLARS
FT                   VGPALGGILISLWDTSLAFALNAVSYIGMIAVLAMWRPESLPPMREPMLGAIGRGIRFC
FT                   ASSSPIRKVLLRGLAMGLGAAGLQALMPSVARDMLKGSELDYGLMLGGFGIGSIVTALW
FT                   ISRLRRRLGSETVVTAATLIFASAQVLMASATNMPMAVVAAFMGGMGWASAMTSLNVAM
FT                   QLRSPEDILGRCLSIYQAVTFGGMALGAWAWGTVADVAGLPTALHAAALWLAASLALHF
FT                   FAPMPTREEGRLDVVPESRP"
FT   gene            complement(243529..243966)
FT                   /locus_tag="Saro_0235"
FT   CDS_pept        complement(243529..243966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24683"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBU0"
FT                   /protein_id="ABD24683.1"
FT                   /translation="MKRALALLPLALLGNAPATTTTTTISVDVTGLRNSKGMVYLCMTS
FT                   SPRLFPEGCDKDPQRHVASLRAGEAGTLVLRDVLPGRYAIVLLHDENGNKKMDKTLFLP
FT                   KEGFGFSRDAPVRMSAPKFEAAAFDVTGGKPLRMTMKVRYL"
FT   sig_peptide     complement(243904..243966)
FT                   /locus_tag="Saro_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.970 at
FT                   residue 21"
FT   gene            complement(243963..244673)
FT                   /locus_tag="Saro_0236"
FT   CDS_pept        complement(243963..244673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0236"
FT                   /product="C-5 sterol desaturase"
FT                   /EC_number="1.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24684"
FT                   /db_xref="GOA:Q2GBT9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT9"
FT                   /protein_id="ABD24684.1"
FT                   /translation="MNGVLVSAWAMTVIVAVRYLATSGLFAWLTARVRPGHYAGLDRQI
FT                   RSEIGWSLATAAIYGVPAGVVAWGWQERGWTRIYTDPHALPLWWMPVSLLLYLFIHDTW
FT                   FYWTHRWMHRPAVFRRIHAIHHASRPPTAWAAMNFHPVEAAVVSLLIPALVFAIPIHVA
FT                   VLGLVLLVMTVMGVTNHMGWEMFPRALVHSRAGNWLITASHHHRHHEQYRCNYGLYFRF
FT                   WDRLCGTDKGLSAP"
FT   gene            complement(244870..246366)
FT                   /locus_tag="Saro_0237"
FT   CDS_pept        complement(244870..246366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0237"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24685"
FT                   /db_xref="GOA:Q2GBT8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT8"
FT                   /protein_id="ABD24685.1"
FT                   /translation="MSYFSDLGLAEPILRALETKGYNDPTPIQRQAIPALLEGRDLLGI
FT                   AQTGTGKTAAFALPSLHRLAANPQPRKPASCRMLVLSPTRELAAQIADNMKGYARNLNL
FT                   IVDCVFGGVPIGKQARRLVPGVDILVATPGRLLDLIDNRALTLGRTEIFVLDEADQMMD
FT                   LGFIHALKRVANLLPKTRQSLFFSATMPKAIEDLGKQFIVNPVRVEVAPNSTTAERVEQ
FT                   YVTFINQAEKQALLTLRIRDLLKTKELDRALVFTRTKHGADRVVRHLSSAGIDARAIHG
FT                   NKSQAQRTAALEAFRQGSCPVLVATDIAARGIDVSGVSHVFNFELPNVPEQYVHRIGRT
FT                   ARAGADGIAISFCAPDEKPYLKDIERLTRVKVDALPLPENFTAEAAKLPAPSRKPAEQE
FT                   QDARRDARDARGNGGRGGQGRGQAHGGRAQGRDGRPRDASPRQDRREGDRGPVRNPLHT
FT                   DRTDRPERIEGERDGNKPRRFRPRGAPGVGAHRNKVRRAS"
FT   gene            246695..248005
FT                   /locus_tag="Saro_0238"
FT   CDS_pept        246695..248005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0238"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24686"
FT                   /db_xref="GOA:Q2GBT7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT7"
FT                   /protein_id="ABD24686.1"
FT                   /translation="MRLPMGLVAVLALVGTAAHAAPKGAEARMIATVDAEQARTLRFLE
FT                   VMVNQNSGSRNLEGVRRLRDIVVPEFTALGFTSRWIPMERTGRAGHLVLTHKGRQGAKK
FT                   LLLIGHLDTVFEPDSPFQTYVLNGEKATGPGVGDDKGGIAVILAAVRAMNAAGTLKGAS
FT                   IEVFLTGDEEEAGSPTEVARADLVAAARAADVALDFEGLSRENGRDMGSIARRSSQSWS
FT                   LTVEAKSGHSSGVWGANAGDGAIYAAAKIVNAFRTELPEPWLTLNVGLIAGGAEAEVAE
FT                   DNAHVSAQGKTNIIPGEVIARGDLRTLSPEQNRAAMRKMEEIVGRPYPGVTSARIAFSE
FT                   GYPPMAPTEGNKALLARLNQVNATLGLPEMQPLDPMKRGAGDISFVAEYIDGLVGLGPH
FT                   STGDHAPGETVDVPSIWTQAKRAALLMTRLSAEKSAR"
FT   sig_peptide     246695..246757
FT                   /locus_tag="Saro_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            248002..248190
FT                   /locus_tag="Saro_0239"
FT   CDS_pept        248002..248190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0239"
FT                   /product="protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24687"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT6"
FT                   /protein_id="ABD24687.1"
FT                   /translation="MSETHPPSPCTGVCEIDRVTATCRGCHRTLDEITAWFTASPARKH
FT                   AILRALAVRQSVSVTST"
FT   gene            complement(248163..249485)
FT                   /locus_tag="Saro_0240"
FT   CDS_pept        complement(248163..249485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24688"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT5"
FT                   /protein_id="ABD24688.1"
FT                   /translation="MHKIAISTAAMLALAPVPAFADGGPLSIGAAVRLRVESIDGQFRP
FT                   GASANDTMVSLRTAVDAQYDAGPVRFGAELWDARAWGQDKASSAGTGEVNALELVQANV
FT                   KVELGKRSLLTAGRFTLDLAGRRLVARQRYRNSTNAFTGAHLALADPRGGKLDLFWTMP
FT                   HVRLPDDAQGIRADRVRWDRESTDLMFFGGQGTLPGVLGGTFQPYAFRLVERDSPDRLT
FT                   RNRQLWTLGGRLFRQPAPGKWDHDVEAALQTGSVRRTTSASDLADLDVSAWMVHAELGR
FT                   TFSAPWKPRLAALFDAASGDGAKAGRFGRFDPLFGARRFEFGPNGLYGPFARSNMVSPS
FT                   LRIEVAPSKRTDAFLAWRSAWAENRRDSFGGTGVRDASGASGSLGGHQIEGRVRHWIVP
FT                   GLLQVDGGAAVLLKRRLLTDAPNAPATGNTTYGYVDVTLTL"
FT   sig_peptide     complement(249420..249485)
FT                   /locus_tag="Saro_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   misc_feature    249576..249864
FT                   /note="yybP-ykoY element as predicted by Rfam (RF00080)"
FT   gene            249771..250346
FT                   /locus_tag="Saro_0241"
FT   CDS_pept        249771..250346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0241"
FT                   /product="protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24689"
FT                   /db_xref="GOA:Q2GBT4"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT4"
FT                   /protein_id="ABD24689.1"
FT                   /translation="MLEAFTTSTAIVALAEIGDKTQLLAIVLATRFKRPMPIVLGILAA
FT                   TLANHFLAALLGATAAAFLDGTWFRFAVAVGFVAMGLWTLVPDKLDEDEEPRPSRFGPF
FT                   LTTLVAFFLVEMGDKTQIATIALGARFNDAIAVTAGTTLGMMIANVPAVFLGQELIKRV
FT                   PLDVVRMVAAALLVATGVWLFIQTLGIW"
FT   gene            250407..250910
FT                   /locus_tag="Saro_0242"
FT   CDS_pept        250407..250910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24690"
FT                   /db_xref="GOA:Q2GBT3"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT3"
FT                   /protein_id="ABD24690.1"
FT                   /translation="MSESVSASAEVTVEAAVEREARGVARGICRLFARNDIWCLPEMPL
FT                   RSGRRADLMGIDAKGQVVIVEIKVSRADLLGDGKWTDYLDHCDRFYWGLAPHLDRAVLE
FT                   TEDFLPHACGVIVADGYDAEIVRPAPTVPLAAARRKAEVERLARASLRRQLVGLDPHCA
FT                   AWGG"
FT   gene            complement(250928..251362)
FT                   /locus_tag="Saro_0243"
FT   CDS_pept        complement(250928..251362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT2"
FT                   /protein_id="ABD24691.1"
FT                   /translation="MQQPHSPGSDSRAMSQGGTDHLPAAGHAQFDHAAGSGMSMKWAAL
FT                   HEAAAVVCSLAGLQAEIRKSEIRNFPAMMRDTGGWRLDLACQGVDDLAAFMEPGLVALV
FT                   AVSARGLSPAPAALALWHEFVAARAALLALVPPPGIKRRT"
FT   gene            251494..251570
FT                   /locus_tag="Saro_R0003"
FT                   /note="tRNA-Arg2"
FT   tRNA            251494..251570
FT                   /locus_tag="Saro_R0003"
FT                   /product="tRNA-Arg"
FT   gene            251857..253635
FT                   /locus_tag="Saro_0244"
FT   CDS_pept        251857..253635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0244"
FT                   /product="Type I secretion system ATPase, PrtD"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24692"
FT                   /db_xref="GOA:Q2GBT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT1"
FT                   /protein_id="ABD24692.1"
FT                   /translation="MGRDYLKLFVARYRSSLVLVIAASVLLNLLVFAGTIYMMLVYDSV
FT                   LPSRSIPTLVGLFAMIVLVYLFQALFEAIRGEAMLSVANGVHDDLFAAVHHATVSRPLR
FT                   AAADKGDGLQPIRDLDAIHTFLAGPGPTALIDLPWVIVFLFVLTALHWWLGLTALVGVI
FT                   VLSAIALWSNRRTASATRQLQSVIGQRSASAQAEIRNAETAVAMGMQERLLTRTRGWEA
FT                   DFLESQSRLSRLVSRFGGAGRTFRVFLQSLILTVGALLVIDDKASGGVILASSVLSGRA
FT                   LAPVDSAIANWRGLVAASTGWERIVQLINAFQKAPPRSIELGAPSAELSIRDLWVAPPG
FT                   VQRMTVQGAALSLTPGQALAIIGPSAAGKTSLMKAMLGIWRPQRGEVRLDGATLDQWAA
FT                   ESLGRHIGYVPQTVELVDGTIGENIARFDPDATSDGVIAAARAAGMHETILAMPDGYDT
FT                   RLTGGGLELSAGQRQRVGLARALYGEPFLVALDEANSNLDSAGDAALAKAVEDVRKRGG
FT                   IVVMITHRPATLGPISHVAVMAGGRIIDLGERDEVMKRLSTANPGEPKDGQTVAARTGP
FT                   AKVGASKTGSEGEVAQ"
FT   sig_peptide     251857..251958
FT                   /locus_tag="Saro_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.989 at
FT                   residue 34"
FT   gene            253632..254972
FT                   /locus_tag="Saro_0245"
FT   CDS_pept        253632..254972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0245"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24693"
FT                   /db_xref="GOA:Q2GBT0"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBT0"
FT                   /protein_id="ABD24693.1"
FT                   /translation="MSLPAVMGGTNLPVPWDTDAPAPESATNLRRLAAIVGGLFVVLFA
FT                   MALVVPIGGAVIGNGQVGVQSRVKRIAHPTGGVIAEIAVTNGEHVKQGQLLMRLDDRVT
FT                   GADATYSSLTVEQLLAQRARLEAERLGLGSVTFPPELLNAGTPSAAKAMADEAHLFRMR
FT                   SVETAQVRAQLGARVNQYQQEIRGIEAQIASLRKQRTLIEPERQSVKDLWDKQLVTINR
FT                   LNQLERSAVDLDGSVGALNAQIAQARARITEAQEQSIQVSQQRRVDAGVELAQVNTALN
FT                   QQRLRSVAANDQQDRSEIRAPYSGTVEKIAFAAIGDVVRPAEPIMEIVPDRDVMVVEAA
FT                   IGPADIDQVAKGQVARVRFSAFNRAATPEIAGKVLYVATDRTENPESRASFYMVRIAVD
FT                   QAAIAREKLDLRSGMPAEVYIETGSRSLLSYFTKPLRDQFSRAFRDN"
FT   gene            254975..256591
FT                   /locus_tag="Saro_0246"
FT   CDS_pept        254975..256591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0246"
FT                   /product="Type I secretion outer membrane protein, TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24694"
FT                   /db_xref="GOA:Q2GBS9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS9"
FT                   /protein_id="ABD24694.1"
FT                   /translation="MRPKANGGVAWLALLLAETATGTVVSTVAPTVARAQEIASTFVEA
FT                   PELPPETPSDIADQLREPTPVAALPDALRRAYWSNPSLQAQRASVRGADWRIPQARAAY
FT                   GPKLSASGTYGWQRDNFETPAGVYTAFNGWTSTAQAILTQPLFTFGRNVAAEQFASAQV
FT                   EYQRNVLRSTEQQTMLDAIGAYVGVLRDRAAVGIARDNLALLEQELSDNQARFNAREVT
FT                   STDVQQVETRVDLGRAQLLAAQRAAAGSEATFLRTTGAPAAENAAAPNPLSLPVRTIEE
FT                   AYLFAELHNPVLFAAQAREKVSRAQAASARADLMPRVDLRGSADYGTLSPYSNALRQNT
FT                   LRGEVVLSAPLFESGVRRARLAEADAANDADWRLVDAAMRENRAAIADAWSEWQAQTGG
FT                   IARLGEAVESARKAYDGALLQERAGLRTTLDVLDLARELLSARNGYNNAIAGATIAKAR
FT                   LLFAMGSLDYAWLMPDEARYDADGHLQDVRHKGDVPLLTPLFRALDSVVAGGGKPRPLR
FT                   DPSAKATTSGFTLTEQPAPGQ"
FT   sig_peptide     254975..255043
FT                   /locus_tag="Saro_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.450 at
FT                   residue 23"
FT   gene            256820..257794
FT                   /locus_tag="Saro_0247"
FT   CDS_pept        256820..257794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0247"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24695"
FT                   /db_xref="GOA:Q2GBS8"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS8"
FT                   /protein_id="ABD24695.1"
FT                   /translation="MQRLAALLDPFVIALLATVALASVLPARGAAVAWVDLAAQAGIVL
FT                   LFFLHGAKLSREAIIAGARNWRLHLATLAVTFVMFPLLGILIGALHVLPRELAAGMLFL
FT                   TLLPSTVQSSIAFTAIARGNVAAAVCAASFSNLAGIFLTPALVALLMGGSTGGLSWDSV
FT                   EKIVGQLLLPFVVGHLMRPWIGEFVARNKAWLGRVDRGSILLVVYAAFGAAVVEGLWQK
FT                   VAPESLALLTVLCLALLGLVLGMTTLLGRAMGLPREDAVVLLFCGSKKSLASGVPMAGV
FT                   LFPAAQVGIVLLPIMVFHQLQLIACALLAPKLAKGAPGGEREA"
FT   sig_peptide     256820..256909
FT                   /locus_tag="Saro_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.477 at
FT                   residue 30"
FT   gene            complement(257827..259188)
FT                   /locus_tag="Saro_0248"
FT   CDS_pept        complement(257827..259188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0248"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24696"
FT                   /db_xref="GOA:Q2GBS7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS7"
FT                   /protein_id="ABD24696.1"
FT                   /translation="MPRPEWLRQGRNPPFLSRLEPNGPSDRRNLMRAKPNDVDLRERAA
FT                   KVIPNGMFGHEATHLLPASFPQFFSRAKGAYIWDVDGNRYLDFMCAYGPNLLGYGDELI
FT                   DAAATRQLALGDTMTGPGPVLVDLCETLVDMISHADWVMVCKNGTDATTMALTAARAQT
FT                   GKRRVLVAEGAYHGAAPWCTPMPGGIVPEERAFISKYKYNDVASLEAAVAAAGDDLAAI
FT                   FASPFKHDAFEDQALPDPAYARRARELCDQTGAMLIVDDVRAGFRLVRDCSWELVGVRP
FT                   DLSSWGKSFANGHPISALLGSNSCRAGAEAIYATGSFWFSAVPMAAAIETLRILRESDY
FT                   LERTIRLGERLREGLAAAAARHGFSLRQTGPVQMPQILFNDDPDFRIGFAWAEAMLERG
FT                   VYVHPWHNMFLNGAMSETDIDFAIEAADGAFAQVREHVGELEPHATLMSLLGAH"
FT   gene            complement(259175..259891)
FT                   /locus_tag="Saro_0249"
FT   CDS_pept        complement(259175..259891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0249"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24697"
FT                   /db_xref="GOA:Q2GBS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS6"
FT                   /protein_id="ABD24697.1"
FT                   /translation="MHQLHRYNRAMTEGSEFQSKTTPTGRKQLFRRPRQKRSQQRFEAI
FT                   LDSAERLLERLEPDEISVYTLAEDAGISPPSIYQFFADAGQVFIALSERIHAHIVAGYN
FT                   RSYHGPFSTWQELMSIRFGEARDYYNSHAAARRLLLGSGLSATIRARDLQIDRQLAIRS
FT                   LEEFGQHFQVPDLPELVERFTELLVINDAMWTLSVHRHDCITDAYEEQARRAREAYTRT
FT                   FLPEYLPVREHPDAAA"
FT   gene            260029..262320
FT                   /locus_tag="Saro_0250"
FT   CDS_pept        260029..262320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0250"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24698"
FT                   /db_xref="GOA:Q2GBS5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS5"
FT                   /protein_id="ABD24698.1"
FT                   /translation="MIRFSQKHKLMAVLAATTYLFALPVVVRAQAADQSTGQSAGRADG
FT                   GLGEIVVTAQRRQQNVQDVPIAITAVTGEALRDSGVRDPRDLTLLVPSLSMQAGTAAST
FT                   TSLFIRGVGIGDFNSNTTGAVGVYVDDVFLGANAGKLFNVFDSEGIEVLKGPQGTLYGR
FT                   NTTAGAIRFSSRKPTDTLSGDVSALYGRFNEVRIEGGVGGPIAGDVLTARISGLYHRND
FT                   GTTFNRVTGHRVNNINLWAGRGILDFKPDADTLVRLTVHGGANNGGARQFQHRGQGVDF
FT                   FGDPAFLPDGTPTDGFGYADTDGDPYAGDYDVEGKERIRVFGASLLGQFTFGGVQLTSI
FT                   TAYEQVNRATLEDTDASPNQVITAYYEDRPRQFSQELRLQSVGENTFNWIVGGFYFHDN
FT                   LKTDSAFDLLRGLRDPSAPLEGFDPANSLGLLRYPYTQKTDSYAVFGQGDYKLTDRLTA
FT                   TLGLRYSHDRIGMKFASLFDALGTVNPRKAFSDVVVPLIDFNESKGFNDLSWRAALNYK
FT                   VDNALIYASFSKGYNSGGFAGGASTDAAQLTPFGSERLYAYEVGFKTDLFDRHLRFNAS
FT                   GFYYDYRDLQVFIFDLSGPVPVQRKLNAGNARIYGLEAEITAVPVRNLELFTAFTLMDS
FT                   KYKTFTALGGASLAGNRLVNAPEFAGAAGIRLTVPMANGSEVRAKVDGTYTSSFFLYPD
FT                   NLEANKVKGYGLLNARVGWAAPGGRYEIALWGKNLTKTEYITGIFPIITQDQLNYNEPR
FT                   TYGIELSAHF"
FT   sig_peptide     260029..260124
FT                   /locus_tag="Saro_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.730 at
FT                   residue 32"
FT   gene            262402..264123
FT                   /locus_tag="Saro_0251"
FT   CDS_pept        262402..264123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0251"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24699"
FT                   /db_xref="GOA:Q2GBS4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS4"
FT                   /protein_id="ABD24699.1"
FT                   /translation="MTDVTKWLASLEAALAGEDKAAVASLFLPTGLWRDFLAFDWTLAT
FT                   HEGGEAIAAFAAARGGATATHSWATSAAPSASEGFISFETAVGAGRGYVRLMDGKALSL
FT                   FTMLADLRGHEFPVRGRRASGVVHDAQGRNWQDLIAAERSAMGTSEQPYVLVVGAGQAG
FT                   LAIGATLRLLGVPHLLIDKHPRVGDQWRSRYKSLTLHDPVWYDHMPYLPFPDHWPVFTP
FT                   KDKMGDWLELYAEAMELNVWCDTELLAARHDPATGAWTARVRRGGTEIELRPTQLVMAL
FT                   GNAGFPRVPQIEGQDRFKGAQYHSSAHSGGEGLAGKRVVVIGANNSAHDICADLVEHGA
FT                   HATMVQRSSTHIVRQHTMTDVMLKQVYSQEAVDAGITTELADLINASVPIRLAEISARQ
FT                   AWAEIREAEAPFYARLEQAGFKLDFAEDGAGINGKYLRAASGYYIDVGASEMIADGRIA
FT                   LKSGTEISHLTETGVAFADGTHLEADIVVYATGFGSMEEWVARLIGEDVAMKIGKCWGY
FT                   GSGYKGDPGPWEGELRNMWKPTAQEGLWFMGGNLAQVRFYCKVLGLQLKARHAGLV"
FT   gene            complement(264168..265013)
FT                   /locus_tag="Saro_0252"
FT   CDS_pept        complement(264168..265013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0252"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24700"
FT                   /db_xref="GOA:Q2GBS3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS3"
FT                   /protein_id="ABD24700.1"
FT                   /translation="MTKGSNDGQAPVALVTGASSGIGRIMAAALAADGHVVFGTSRAPA
FT                   ATETDDGVRMIAMDVDSDASVDRAVAEVLGQAGRLDMVVCNAGFGVMGPIEDTPAELMI
FT                   AQFQTNVFGVHRVCRAVLPLLRQRPVAKLVVTGSMAGMVGLPMQGMYSASKFALEGYCE
FT                   TLRLELRDSPVRVALIEPGDFPTGFTASRRMIPDAEMSAANRAKLARVSAIVAEDESNG
FT                   GDLALLGEAIVRIAHDPSPPLRNIVASPEQMELVEAVRPTLSPDEWEGFMAEHFGIEAA
FT                   "
FT   sig_peptide     complement(264918..265013)
FT                   /locus_tag="Saro_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.860) with cleavage site probability 0.795 at
FT                   residue 32"
FT   gene            complement(265107..266273)
FT                   /locus_tag="Saro_0253"
FT   CDS_pept        complement(265107..266273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24701"
FT                   /db_xref="GOA:Q2GBS2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS2"
FT                   /protein_id="ABD24701.1"
FT                   /translation="MTVARDTARPVAAAVLPTILPAIALGAAGLLVLGVQPALYGAYVG
FT                   EGLVIEARLGTLAAAEISAIALGSVAGIALLGKTRSQVVGLIGIALMVFGNLLPLELPL
FT                   FLTRVIAGLGGGMVVALGAAQIARQANVNAASGWFLFLQATSQYALLQGLAVLVPAAPA
FT                   VTIQRALVVLALAAMPLLLLVPRQLGLSGAGHPGGDSSGRPPLSGWMGLVVSALFVGAA
FT                   IGVWAYLGVWLEHQGIPPRSVSPRLTAALAGQIAGALFAVMLGMRSRGSMQVAVSGAIM
FT                   IATVLLLLSQGPGGATGWALMIAFGFAWMSGTPALSGFLIECDPSRRSLPFSASAQLLG
FT                   AAIVPTAVGELLAPHGLGLVLAASASLAALAIVMVGPALATRRRVGAE"
FT   sig_peptide     complement(266193..266273)
FT                   /locus_tag="Saro_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.795) with cleavage site probability 0.631 at
FT                   residue 27"
FT   gene            complement(266331..267662)
FT                   /locus_tag="Saro_0254"
FT   CDS_pept        complement(266331..267662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0254"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24702"
FT                   /db_xref="GOA:Q2GBS1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS1"
FT                   /protein_id="ABD24702.1"
FT                   /translation="MPAPEFFEVSQWVERPAQTCPPLSGEIRADVVIVGGGFTGLSTAL
FT                   SLREAGVDVALVEKDFCGMGASGRNAGHLTPTIGKDFPSLVKSVGKERAVEFARFADRA
FT                   VHYTEAMIRKLGVDCEYRPTGNIVTGLHPRHRKPLEEGAELASRLGVGLAFLDEAEVRR
FT                   RNLPGHVRFGMIEKAGGHLHPGKYVMALRQAAIDAGVRIFEDSAVSRIEDAGSPVVVHT
FT                   ATGSVSADKLVIATNAYTPVTLGRMRSKVFPVRVTLFRTQVLTDEQWKRIGWEGGEALY
FT                   TAHEAMENYRPQADGRISGGSKFVQYGFGSKLTRGYLPEIFTRWREVFARRFPEIPDVK
FT                   IESFWGGWIGLTLDFLPIHQSNARGTVFHGIGYNGHGIAQGTYAGPMLADQVLGRANAE
FT                   VDLFRRYLLPLPPEPLRWLVIKGITATLDRIDRKVDADLDAGLA"
FT   gene            complement(268084..268150)
FT                   /pseudo
FT                   /locus_tag="Saro_R0004"
FT                   /note="tRNA-Pseudo1"
FT   tRNA            complement(268084..268150)
FT                   /pseudo
FT                   /locus_tag="Saro_R0004"
FT                   /product="tRNA-OTHER"
FT   gene            268306..269598
FT                   /locus_tag="Saro_0255"
FT   CDS_pept        268306..269598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0255"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24703"
FT                   /db_xref="GOA:Q2GBS0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBS0"
FT                   /protein_id="ABD24703.1"
FT                   /translation="MPTAKLTAAIVENARPSIKPYTIWDTELSGFGLRVYPSGKLSWIA
FT                   KYRVGGGGRNAPVRCPSLGDARKVSAKDARAAAKRELAAAQLGGDPMAVIKAQRCEMTV
FT                   EALISLYEKEGCFVQRGIRIGVPMKPLTKKYTLSRLRNHVVPLLGKKRISEVSSQDIES
FT                   LGRAITIGKTSKDEKVGVRNRVIVKGGEGAARKVIRDLSAVFSFAMRRGLVKANPVTLA
FT                   SVRKTDNVRVRHLSMDELKRLGEALDELEKAGVNPKAVNIARLWALTGCRRDEIAGLQW
FT                   SEVDFETGRLVLQDTKTGRSVRPLGGAAAILLAKLREGATADAVFVFPAERGEGFFQGT
FT                   KRVWAQAILKAKLPGVTPHILRHTVGSLGASAGEGMLLVGAVLGHSNARSTLQYMHVAS
FT                   DPARLAADRLTTPVADALGLPMPVSQEAAAA"
FT   gene            complement(269577..269876)
FT                   /locus_tag="Saro_0256"
FT   CDS_pept        complement(269577..269876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR9"
FT                   /protein_id="ABD24704.1"
FT                   /translation="MPFGQTSGAIRAVHRHELLQRAGRDERPASDLQKVQLPLSEKAID
FT                   RGPAQAEKLGGIIDRNEHMKTSPKNAPASPGESLGAVTTFRGQTVLENQAAAAS"
FT   gene            complement(270703..271512)
FT                   /locus_tag="Saro_0257"
FT   CDS_pept        complement(270703..271512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24705"
FT                   /db_xref="GOA:Q2GBR8"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR8"
FT                   /protein_id="ABD24705.1"
FT                   /translation="MRDRVDDAVSKVPAVTLTFWVIKILATTLGETGGDAVSMSWLGET
FT                   TPNAGASGINGYLVGTAIFGLLLLGLVWLQIRARRFNPWLYWATIIASTTAGTTLADFA
FT                   TRSIGLGYPGGSLLLFSLVLISLFSWHRALGTVDVNRIETARAETFYWITITFSQTLGT
FT                   ALGDWVADGSLGYSGAALLFGAALAVLAAFYWFTSLSRVLLFWAAFILTRPLGATVGDF
FT                   LDKPVAKGGLDLSRPLATAVLAGAIILLILVAPQRAGMHPRGSGEAR"
FT   gene            complement(271746..272366)
FT                   /locus_tag="Saro_0258"
FT   CDS_pept        complement(271746..272366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24706"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR7"
FT                   /protein_id="ABD24706.1"
FT                   /translation="MKRAAVGFYWTLPVPWDGFTELPDDIEDAAKASRTIRYQRELVTA
FT                   YAASQGYELIREVHFLELEPDRGTEFIFEPLRKVEEICQAKNAIMLFVEFAEVQGWRSH
FT                   APLHAWANQVSIDVMPISACPTMVDDTVFDPHRHFAEWRHRQRQWIESKSQRIALAAQR
FT                   AEELKGAGMSNTAAATTLNGEGIRSPTGRLWTSDTLRKFARSL"
FT   gene            272477..273949
FT                   /locus_tag="Saro_0259"
FT   CDS_pept        272477..273949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0259"
FT                   /product="ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /EC_number="3.2.2.24"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24707"
FT                   /db_xref="GOA:Q2GBR6"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR6"
FT                   /protein_id="ABD24707.1"
FT                   /translation="MRTSQSHPLLIASVEPFPGFGSIGITFCPGKFQPDAMSGSWARDL
FT                   ASDLDAVRDWGATAIVTLVTQRELQRLSVPMLGAEVVARHIDWHHLPIKDCGTPDPSFE
FT                   AEWETVGEELRNRLRNGFNVLLHCKGGLGRAGTVAARLLVELGWDANKAVSSIREVRPN
FT                   AIETLDQFNHVLSARHVPECQPDTSLDAMRDRAVGILLGLAVGDAVGTTLEFQPRNAYP
FT                   RLTDMVGGGPFALTPGEWTDDTSMALALGDSLLISNGLDEADLMRRFAAWRDQGEYSVN
FT                   GQCFDIGNTVSSALRSWKQSGNPIAGPTAPHTAGNGSLMRLGPIAVRFFRDREAMRDAA
FT                   ARQSRTTHGASDAVDACVAFAEMLANAINGWTRTEVLQSPDWLQYTGTINAIVAGSWRG
FT                   LPRSKVRASGYVAHSLEASLWSVGRSGTFEQAVLAAANLGEDADTTAAITGQLAGALHG
FT                   AAGIPRRWLARLAWSQRIREMANALFSQGLGL"
FT   gene            274181..276076
FT                   /locus_tag="Saro_0260"
FT   CDS_pept        274181..276076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0260"
FT                   /product="protein of unknown function DUF1524 RloF"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24708"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR5"
FT                   /protein_id="ABD24708.1"
FT                   /translation="MKPEKLSVQELFSRERRFIIPLFQRAYVWNQEEQWEPLWEDISRR
FT                   AHAHLQRLGLPAEGKVRTHFLGAVVLNVANVMGRGISRSDVIDGQQRLTTLQLFLAALR
FT                   DMSGELGADADDIRLFKRLTRNPDCEEGSEELFKVWPTNSDREVFSQVMSAGSPAALEA
FT                   RFPENTGGRPRMVQAYLFFARAIAEFIRSAEHASSAPDRFLSLVSALKESLQLIVIELE
FT                   EGDDPQVIFETLNARGQPLLPSDLIRNYVFMRIGDAEGNRLYQTYWSHFDTEQVMVPGS
FT                   DGESRFWHVEERQGRLVRPRIDLFIFHYLTMHTEDDIRIGHLFKEFRDWRDANSTSNED
FT                   FLKDLKTASHHFARLIAPKGNSRLEVFASRLRALDTSTVHPLLLFLASVEGQGIPVAEV
FT                   DQIIVDLESYMVRRFICWQTPKNYNRFFLSLLTKVKQAYAARAKADDTALADLPTVAEV
FT                   VRTELLRSQEASAFWPSDERFREGWLNNPVYVSSRADRSAMILRALGDAMTTSRNEQLD
FT                   LSGPVTVEHLLPQKGAIEDYPYLEISLPQNHDEASWRKVLVNTVGNLTLLTGANNTAAS
FT                   NHAFPVKRAKIVEHSDLRLNAWLRTDTRDSWNETDILARGEELFHFALKIWPRPA"
FT   gene            276073..278802
FT                   /locus_tag="Saro_0261"
FT   CDS_pept        276073..278802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0261"
FT                   /product="type II restriction enzyme, methylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24709"
FT                   /db_xref="GOA:Q2GBR4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR4"
FT                   /protein_id="ABD24709.1"
FT                   /translation="MNPVEIEEAVSDLARAPYDASEFPFQFLAAFGNKQTTLQRLRAGN
FT                   SNQSDLPGAVLQRNHIHIATCDAGNVDRTLAALRKSPKTASQKARFILATDGVAFQAED
FT                   MASGETVACNYAAFPDKFAFFLPLAGITTVQQIRESSFDIKATGRLNKLYVELLKDNPD
FT                   WASRSEDMNHFMARLIFCFFAEDTDIFVGEGLFSRTVETMSARDASDTHMVIAEIFRAM
FT                   DTRLADRAAAGIKSWADVFPYVNGQLFSGSTECPRFSKIARSYLLHIGSLDWQKINPDI
FT                   FGSMIQAVADDEERGALGMHYTSVPNILKVLNPLFLDDLRAKLEEAGDNSRKLLNLRNR
FT                   MAKIRVFDPACGSGNFLVIAYKQMRELEAEINRRRGEADRRSDIPLTNFRGIELRNFPA
FT                   EIARLALIIAEYQCDVLYRGQKEALAEFLPLDSQNWITCGNALRLDWLSICPPTGTAVK
FT                   LQANDLFEMPLDQAEIDFENEGGETYICGNPPYLGAKKKSSDQIEDMKRVGLDKAQLLD
FT                   YVSAFIVRGLPLVAQQRCDMALVSTSSICQGEQVSLIWPRILKSANVKFAYRPFRWSNS
FT                   AANNAGVYCTIIGLTGSEVSNKKLFGEGSVVECSSIAPYLVPGPEIICAPRQSSISGFA
FT                   RMVMGSNPVDGKRLIFEQDEKESVVAADPRSERFFKRYGGTQELVNGVDRWCLWINDDQ
FT                   VDDAKAIAEIAKVLESCRSYRQGAGRDAQKAANRPHSFCYRTFQENIGIHVGLTIGNGL
FT                   SHVPADLKSSGFVSSHTAYMIYGWHPVEFALLNSRLMLVWTETVGGRLGNGMRFSNTIV
FT                   YNTFPVPSLTDQNKADLTRCAEDILLARESHFPATIADLYDPETMPESLRAAHDRNDEV
FT                   LERIYIGRRFRNDTERLEKLFELYTKMTGGRSSEGGAA"
FT   gene            278799..279641
FT                   /locus_tag="Saro_0262"
FT   CDS_pept        278799..279641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR3"
FT                   /protein_id="ABD24710.1"
FT                   /translation="MTEVTKAAEARAASARSKTLLKVAVLVFAIELAACSSQEAPDNND
FT                   AATEAQVPAPEYAQRDGDQYIYVGALSDGERAQGKQAAVVTYRYLGSFGDTQKLEMLSD
FT                   AGARLAIVECSDPCRVAKHTDNFGVVTRVAVQPATIVAAAFRDAALGHMILAQMGEELS
FT                   DAKNPSLSPAKEPSISPPTITAGDQSDYRGKKGRCRLTVEGTSYMNGSCWVRLDNGGSF
FT                   QIMSLDQSYFAQLSRSGSQASGFWNAAPGAAHAQVELGPMDRVGACWTNATAEICAWR"
FT   gene            279989..281029
FT                   /locus_tag="Saro_0263"
FT   CDS_pept        279989..281029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24711"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR2"
FT                   /protein_id="ABD24711.1"
FT                   /translation="MLVEFVTIDGRAIPLHPLGGCSGKGGDSHGGTVRVADGQCIKTRC
FT                   PKCNEPVFFIRHNGGSVYIDPPLGPPWLRHPCMPDQARKHVPEINPKISSVSPEASHML
FT                   GRVRGLITGVVIKAELVSGGKQAVLTIAVAQPDPLVLLMRSPSFYFVGRMVILRPAKRA
FT                   LYSAEDPADVFLIDRALYVPSGLRSPEFPLLQEGASGTAGPDDAKTRLKLDGETRGVAK
FT                   AYRKFLMQGLSGPWQAQELASIIHLLDGRSQDDAVHLAAVLSLQKCIDHGDPNAALLLA
FT                   KNLHSERREKLASWFRMYSPLIIDLSRLDKKFWFVRDAEHKILPFNMEGARSNPVFRHG
FT                   RNAQRR"
FT   gene            281100..283169
FT                   /locus_tag="Saro_0264"
FT   CDS_pept        281100..283169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24712"
FT                   /db_xref="InterPro:IPR018975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR1"
FT                   /protein_id="ABD24712.1"
FT                   /translation="MTADKPIPAVTFQTAHNGVSAKANSLGMRPMQERAYNKRGEQYLL
FT                   IKSPPASGKSRALMFIALDKLHNQGLSQAIIVVPEKSIGGSFADEPLTMYGFWADWVVQ
FT                   PQWNLCNAPGPDEVKVDASKVKAVGQFLASDDKVLVCTHATFRFAVEALGIEAFDGRLI
FT                   AIDEFHHVSANPDNKLGSQLTAFIARDKVHIIAMTGSYFRGDTVAVLTPEDEAKFETVT
FT                   YTYYEQLNGYDHLKSLAIGYFFYTGRYLTAIEHCLDPARKTIVHIPSVNSKESTKDKIK
FT                   EVEEIMEYLGDWQGADPVTGFHLVKLADGRTLKIADLVDDSDPAKRAKVLSALKDPAHK
FT                   NDRDHVDIIIALGMAKEGFDWIWCEHALTVGYRSSLTEIIQIIGRATRDAPGKTVATFT
FT                   NLIAEPDASEAAVADAINDTLKAIAASLLMEQVLTPKFQFTPKNTGPLPDFNYGPGGYQ
FT                   EGKTNVGVNEERGEFHFEIAGLATPKSPEAARICQQDLNEVIASYVQNKDVIGPGLFNE
FT                   EAVPQDLTQVQMGKIVRDRYPDLTPEDQEAVRQHAIAALNLTQKAKAIAMGTDDGSGEV
FT                   KANTALIDGVKQFAMDVKELDIDLIDSINPFQAAYSILAKSMDEATLKQVKAAVAAKKT
FT                   KITPDEAKDLAGRAVRFKRERGRLPSIIAADAWEQRLAEGAAAFMRFKEEGRYV"
FT   gene            283162..284337
FT                   /locus_tag="Saro_0265"
FT   CDS_pept        283162..284337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24713"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBR0"
FT                   /protein_id="ABD24713.1"
FT                   /translation="MSDLDELANELADFAPSKKKQATYAPREERIIAGFEDIERFFEEN
FT                   GRLPAHGENRDIFERLYAVRLDRLREQEDCRVLLAAFDKHGLLAQDDDAEADEAADLDA
FT                   DALMAELAGADDGPDITQLRHVRSTEEKRAAEEVANREKCEDFDTYSSLFAQVQRELAD
FT                   GTRVTRPFELKAEIRPGAFFVVSGQIAYVATMGEMFTNPQGRTDARLRVVFDNGTESKM
FT                   LMRSLQRSLHKDDAGRRITDPVAGPLFADVADEGETETGTIYVLRSKSNHPVVAEHREV
FT                   IHKIGVTSGSVETRIAGAEKSSTYLLAGVDVVATYKVYGVNCQKLEALIHKVFAAGQID
FT                   LSIPDRFGHLVKPREWFLVPLHVIDEVVEKIRDRSILGCRYDPASGGLIAT"
FT   gene            complement(284600..284674)
FT                   /locus_tag="Saro_R0005"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(284600..284674)
FT                   /locus_tag="Saro_R0005"
FT                   /product="tRNA-Gly"
FT   gene            284887..285792
FT                   /locus_tag="Saro_0266"
FT   CDS_pept        284887..285792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0266"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24714"
FT                   /db_xref="GOA:Q2GBQ9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ9"
FT                   /protein_id="ABD24714.1"
FT                   /translation="MASMGLNLEEQKAVDRFRSAVVEPSMTKLVILDFWAEWCGPCKAL
FT                   TPVLEKVAAEYADKGVVLAKVNVDEEQFIAAQFQVRSIPTVYAMFQGQPVADLTPARTE
FT                   SQLRQYLDQILAKVPVQAGEPAQDVTPLLAMGEEVLAEGDGERAASIFAQIVEIAPDNA
FT                   QAHAGLVRALIAAGQKDEAQAVLDALDPAMAADPVFAQARSALALAEDAPEEGELATLR
FT                   AAAAERPADMDAQLAFANALYASGQRDEAAARLLAMVAADREWNEGAAKARLLQIFEAT
FT                   GLEDPWVSATRRKLSTVLFG"
FT   gene            285798..286427
FT                   /locus_tag="Saro_0267"
FT   CDS_pept        285798..286427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0267"
FT                   /product="peptidase S16, lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24715"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ8"
FT                   /protein_id="ABD24715.1"
FT                   /translation="MGANANATRLSIFPLTGAVLYPGLQLPLHIFEPRYRAMVSDSLAR
FT                   DRRIAMIQPQSPVEGAPLFRVGCVGRIADVEALEDGRYNIVLEGLSRFRIVRELDVTTP
FT                   FRQVEAELIVDDMDEALSAVERASFEREARSFADAQGYAVDWDSVGRLDDMSLINGVSQ
FT                   IAPFDAAAKQALLEADTLAARCELLVQLMQFFGKHDGDDGGRVTLQ"
FT   gene            complement(286443..287063)
FT                   /locus_tag="Saro_0268"
FT   CDS_pept        complement(286443..287063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0268"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24716"
FT                   /db_xref="GOA:Q2GBQ7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ7"
FT                   /protein_id="ABD24716.1"
FT                   /translation="MWQLFLSAFVTLFVVIDPPGCAPIYAGLTANATARQAFSMALRAC
FT                   LIATGILLVFALFGEDLLGALHIELDSFRIAGGIMLFLIALDMVFEKRTERREERAEKV
FT                   RTAQPQVEDVSVFPMAMPMLAGPGSIASVMLLTARANGTQETAIILGALAVVMILSFAA
FT                   LVAARPLIRALGSQVEAVITRLLGVLLAALAAQFVIDGIQAQF"
FT   gene            complement(287068..287892)
FT                   /locus_tag="Saro_0269"
FT   CDS_pept        complement(287068..287892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24717"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ6"
FT                   /protein_id="ABD24717.1"
FT                   /translation="MTRLIPTAIVAVLAMTTPLAARSGPPPGDMGQGPEQGPGRPQRAY
FT                   ANPSALIAADIAFSRLAREKGQWTAFRETADETAEMFEGKRQGAHALLKDRKDPAAPVQ
FT                   WAPQAAWISCDGSAGFTFGGWREPASGGTGAAGEYVTVWQRQFKGKLDWKWVLDDGQPL
FT                   AQPLRDVDWAEGKVADCPARRRPDGEAPPQPGSKRERREQDKLPPLRPLAGPVPAPDAP
FT                   PGADSKDGQSRDGSLAWRSTVMPDGSRRFTAWIWKDGRMQEAFARTFAGGGA"
FT   sig_peptide     complement(287821..287892)
FT                   /locus_tag="Saro_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.669 at
FT                   residue 24"
FT   gene            complement(287952..288215)
FT                   /locus_tag="Saro_0270"
FT   CDS_pept        complement(287952..288215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ5"
FT                   /protein_id="ABD24718.1"
FT                   /translation="MEFDDQMRRYFGTEDLASATPAALEAGIERMLVDFGLEKDRSRRF
FT                   GMWSILYMLSSAPDLDVAFKDEADREAARNFMDLIDRAAGTD"
FT   gene            complement(288402..289457)
FT                   /locus_tag="Saro_0271"
FT   CDS_pept        complement(288402..289457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0271"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24719"
FT                   /db_xref="GOA:Q2GBQ4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ4"
FT                   /protein_id="ABD24719.1"
FT                   /translation="MPLLEARNTYKPFEYPWAYEFWKRQQQIHWMPEEVPLGEDCRDWA
FT                   QKISEHERNLLTQIFRFFTQADVEVQNCYHEQYGRVFKPTEVKMMLAAFSNMETVHIAA
FT                   YSHLLDTIGMPESEYGMFLEYEELKAKHDYLQTFGVETDEDIARTLAMFGGFTEGLQLF
FT                   ASFAMLMNFPRFNKMKGMGQIVSWSVRDESLHCEGITRLFHAFVKERGCLTKAVKEDII
FT                   DCCQKTVRLEDAFIDLAFEQGPVPGMSAKEIKRYIRYIADWRLSQLGLPAIYMIEDHPL
FT                   PWLAPLLNGVEHANFFETRATEYSKAATKGDWNTVWSSFDKRRKAKTVANEEVAVEADI
FT                   DMFGAAGIAAE"
FT   gene            289903..290175
FT                   /locus_tag="Saro_0272"
FT   CDS_pept        289903..290175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24720"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ3"
FT                   /protein_id="ABD24720.1"
FT                   /translation="MGGSADAGTASRIREHMEVIGADGVHVGTVDAVEGHRIKLTKRDS
FT                   DAGYEGGTHSGHHHYLSCGLVAEIEGDKVRLSANGDVAYGMLEEE"
FT   gene            complement(290466..290843)
FT                   /locus_tag="Saro_0273"
FT   CDS_pept        complement(290466..290843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0273"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24721"
FT                   /db_xref="GOA:Q2GBQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ2"
FT                   /protein_id="ABD24721.1"
FT                   /translation="MRKWHRWITVFFGVFMIWMAFTGVASHVTALWPAGEQAGPPPVPQ
FT                   GFVCPETMMCRPKAPPGGMKSLVGWFHHLHSGEEFGPLGTAISLMTGFALMFFSISGLW
FT                   MYFSMWKNRKDRSLKPGWFWK"
FT   sig_peptide     complement(290751..290843)
FT                   /locus_tag="Saro_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.577 at
FT                   residue 31"
FT   gene            complement(291083..293086)
FT                   /locus_tag="Saro_0274"
FT   CDS_pept        complement(291083..293086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0274"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24722"
FT                   /db_xref="GOA:Q2GBQ1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ1"
FT                   /protein_id="ABD24722.1"
FT                   /translation="MDFRTGDGSVAAQDELALAGAPAAAGEAKAMDMNARDTGSDALVA
FT                   GMAATVAAAAVAAAPVSDSKKVNPRRFTIVTDDSRDVNLTDFGKDTLDDRYLLPGEKYQ
FT                   DLFARVADAYADDQEHAQRLYDYISKLWFMPATPVLSNGGTGRGLPISCYLNSVDDSLE
FT                   GIVATWNENVWLASRGGGIGTYWGKVRGIGESVGLNGKTSGIIPFVRVMDSLTLAISQG
FT                   SLRRGSAACYLDVSHPEIEEFLEIRKPSGDFNRKALNLHHGVLLTDEFMEAVRDGAEFH
FT                   LRSPKDGSVRSTVDARSLFQKLVETRLATGEPYIVFNDTVNRMMPKHHRDLGLKVSTSN
FT                   LCSEITLPTGRDHLGNDRTAVCCLSSLNLETWDEWNGDKRFVEDVLRFLDNVLQDYIDR
FT                   APDEMARAKYSAARERSVGMGVMGFHSFLQKKGIAFESAMAKAWNLKMFKHVAAKADEA
FT                   SILLAQERGACPDAAEMGVMQRFSCKMAIAPTASISIICGGTSACIEPIPANIYTHKTL
FT                   SGSFVVKNPYLQKLLADKSKDSTNVWNSILEHGGSVQHLDFLSVEEKAVYKTSFEIDQR
FT                   WLLEFAADRTPYIDQAQSLNLYIPADVDKWDLMMLHFQAWEKGIKSLYYLRSKSVQRAG
FT                   FAGGVEADNTAEAPKIELATAETDYEECLACQ"
FT   gene            293585..293833
FT                   /locus_tag="Saro_0275"
FT   CDS_pept        293585..293833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0275"
FT                   /product="conserved hypothetical protein-transmembrane
FT                   region and signal peptide prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24723"
FT                   /db_xref="GOA:Q2GBQ0"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBQ0"
FT                   /protein_id="ABD24723.1"
FT                   /translation="MLNLLSIIFTGLVVGVLARFFYPGDVDIGMLKTVLLGVGGALVAG
FT                   LLASWRSGSTFGEGVNRAGCLASVLGAMLLIFLGRNL"
FT   gene            complement(293861..295369)
FT                   /locus_tag="Saro_0276"
FT   CDS_pept        complement(293861..295369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0276"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24724"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP9"
FT                   /protein_id="ABD24724.1"
FT                   /translation="MVALVSTVAYLGLEARGVEVQCQVAPGLPAFRVVGLPDKAVGESR
FT                   ERVSSALSALGLALPPKRITVNLSPADLPKEGSHYDLPIALALLAAMGVIDLEQIADYV
FT                   AVGELALDGRVLPSPGVLLAALHASGEDKGLICPAAQGPEARWASGIDVIAAPDLIGLL
FT                   NHLKGLHRLPQPSQGVAEPPRRMADLRQVKGQETAKRALEIAAAGGHNLLMIGPPGAGK
FT                   SLMASCLPGILPELTPAEALEVSMVASVAGTLEEGRISRARPFRSPHHSASMAALTGGG
FT                   LKVRPGEVSLAHLGVLFLDELPEYQRAVLDSLRQPLETGEVTVARANAHVTFPARVQLV
FT                   AAMNPCRCGHLGDPALGCSRAPRCAGDYQSKVSGPLLDRIDLHVEVDPVSAADLALPPP
FT                   AEGSDQVAARVARARAVQTERLGGTGLRSNAELNGDLLDAHATPDEPGRKLLAQAAEAM
FT                   RLSARGYTRMLRVARTIADLAGAETVGRIHVAEALSYRRIAPRA"
FT   gene            295554..296258
FT                   /locus_tag="Saro_0277"
FT   CDS_pept        295554..296258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP8"
FT                   /protein_id="ABD24725.1"
FT                   /translation="MFRRIALPAICALLAFQPVAAASREVTTRTWTENGVTWTETTVVE
FT                   VEEPGSERLVGLPRADVRGVASFGPFEVLDAARAALVAETDSHSPADFQTMLRAFPGIR
FT                   VLEMPDCPGTVDDFANLRLGRMIRARGIATHVPEHGSVRSGAVELFLAGASRSAAADAS
FT                   FVVHSWIDEDGREPDDFAAGDPVNRAYLDYYREMGLAAEQAAAFYALTNSVPNEQVLML
FT                   GTGDLARYAALN"
FT   sig_peptide     295554..295619
FT                   /locus_tag="Saro_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.783 at
FT                   residue 22"
FT   gene            complement(296295..299132)
FT                   /locus_tag="Saro_0278"
FT   CDS_pept        complement(296295..299132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0278"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24726"
FT                   /db_xref="GOA:Q2GBP7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP7"
FT                   /protein_id="ABD24726.1"
FT                   /translation="MDEKQHLYLVDGSAYIFRAYHRLPPLTNPRGVPVGAVYGYTTMLW
FT                   KLAEDLHKADGPTHLAVILDKAGTSFRNDLYDQYKANRPPPPEDLVPQFPLIRDATRAF
FT                   SLACIEEDALEADDLIASYARAATLRGWDVTIVSSDKDLMQLVGKCATGGGCIDMLDTM
FT                   KNQRIDIPEVVEKFGVPPEKVGDVLALMGDSVDNVPGIRGIGPKTATKLIQEHGDLESA
FT                   LAAAPTMKAGKLRESLIEQAEMARLSRVLVALKEDCPLPVPIEDFKLGQIPRDPLAAFL
FT                   EEHGFTSLLRRLDDGKGSPGPKTQLNPAKPDNKAAPAAPEGNRQALPSWPAPDLSAYAC
FT                   VQSMGELQQWIARAFEARVVAIDTETSALDAMRADLVGVSLALGPNDACYIPLGHGGSD
FT                   MFAEKPLQVDRAEALAALKPLLESDAVLKVGQNIKYDLNILARQGIMVSPIDDTMVMSF
FT                   CLDAGRSETGLAGHGMDELSERHLLHTTMKFKELCGTGKKAISFAEVPLADATRYAAED
FT                   ADVTWRLHRLFQPRLAGEGGTRIYQKVDRPLIPVVAMMERNGIKVDRERLSGLSTEFAA
FT                   QIARLEGVIHEKCGMSFTIGSPKQLGEVLFDKLGYKGGKKGKTGQYSTDQSVLEGLAAQ
FT                   GAEVATLVLEWRQLSKLKSTYTDALQAAINPHTGRVHTSYSLVGAQTGRLSSNEPNLQN
FT                   IPIRTEIGRQIRDAFVAEPGNVLLAADYSQIELRLAAHMADVPALKEAFAAGEDIHART
FT                   AMEMFGTVDRDTRGRAKTINFAILYGISRWGLGGRLGVSADEAQAMIDRYFERFPGIQR
FT                   YIHETLESVRERGYSETLFGRKTWFPRISSKNQAERQGSERAAINAPIQGTSADIIKRA
FT                   MARMMPALTEAGLGHVRMLLQVHDELVFELPQGDVEAAKPVIERVMATAAEPAVKLSVP
FT                   LGVEIGTGLSWGAAH"
FT   gene            299427..299615
FT                   /locus_tag="Saro_0279"
FT   CDS_pept        299427..299615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP6"
FT                   /protein_id="ABD24727.1"
FT                   /translation="MRKLILAAVAGTAFALAGCSEKPAEEATEAAVEATDAATDVAADA
FT                   SGAASEAAADASEAASM"
FT   sig_peptide     299427..299480
FT                   /locus_tag="Saro_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.308 at
FT                   residue 18"
FT   gene            complement(299871..300932)
FT                   /locus_tag="Saro_0280"
FT   CDS_pept        complement(299871..300932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0280"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24728"
FT                   /db_xref="GOA:Q2GBP5"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP5"
FT                   /protein_id="ABD24728.1"
FT                   /translation="MRQGVCKGTLLRNRNALLMLKTRKPGSGYQGRMKFRTARIIAALM
FT                   VAAPALVATVPAVQSRATVSLQDQRDQAIQQQVAAIAAEGRGRIGVAAMDLDGGGQIFV
FT                   NGDMPFPMASTAKVAVAATFLEQVEKGNFRLDQQFPMMVRVAETGRVSAEAPLRAGTVM
FT                   TAQSLMELMITRSHNEATDGLIHAVGGYENVNRWLTRNGITGQRLDHTMATLVRDDGRI
FT                   DPAKVIDTRTSSTPRAMIALLAAIDRGGVLSPESRAVLLDTMTRTSTGKTRIRAGLPVG
FT                   TLVAHKTGTLSGVTDDVGIIRLPDGRHLAVAFFVTGPEGHAAHAALIARMTRVIYNGYS
FT                   TPVAKSTQDLVRR"
FT   sig_peptide     complement(300774..300932)
FT                   /locus_tag="Saro_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.922) with cleavage site probability 0.457 at
FT                   residue 53"
FT   gene            301057..302388
FT                   /locus_tag="Saro_0281"
FT   CDS_pept        301057..302388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0281"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24729"
FT                   /db_xref="GOA:Q2GBP4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP4"
FT                   /protein_id="ABD24729.1"
FT                   /translation="MEGALAKVMARAGFAAPVSGLQRLSGGANMESWLFACGDDRFVLR
FT                   RAPSAEWIAARPLDMAGEAELIRRAHAGGVAAPEVVAELTPQDAFGIGFIMRCLPGTAD
FT                   PAVALASPPEPAADLAADLAGAMARIHALDPASVPFLPRLEPAEGVEGLARQFADAGGD
FT                   RPIIALGLAWLRAHLPPPAAPVVVHGDFRIGNLMVHEGRLSGVLDWELAHLGDGHEDLA
FT                   YGCMTVWRFGQLDREGFGLTDVATLARAYEAAGGERFDPARFRFWLVYRTVWWALGCLS
FT                   MGQSWRSGTDRSLERVVVARRCTEQELDLLLLLESEAPEAERARPLPTDCPPANAGTGE
FT                   PSAAEILTAVSEWLAATVKGKLDGRERWELAVAQNALGIVRRELAGRPAISDKALADSL
FT                   LAGHEDLSTPGLLAALRRRALSTLSADMPKYPALARARTLWEHR"
FT   gene            302388..303689
FT                   /locus_tag="Saro_0282"
FT   CDS_pept        302388..303689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0282"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24730"
FT                   /db_xref="GOA:Q2GBP3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP3"
FT                   /protein_id="ABD24730.1"
FT                   /translation="MDFDIPADLAAYVAELDAFIEAEIKPLEEADDNIRFFDHRREWAR
FT                   TDFENGGLPRHEWEALLVEATRRADAAGHWRFSAPKKYGGKDGTNLWMAVIRDHFAARG
FT                   LGLHNDLQNEHSIVGNFPFVNMFEHFGTPEQQDEFINGGFARTRRTAFGLTEPRHGSDA
FT                   THMETRAVPETRDGVPGWRIDGEKMWTTGMHVATHCATFARTSGADGDARGITCFLVPN
FT                   PTEGLVIEEYLWTFNMPTDHPRVSFTNVWVPDSAILGPVGGGLAIAQSFVHQNRIRQAA
FT                   SSLGAATFCVEESVRYARERKPFGEELARNQAIQFPLVELATQCEMLRLLIRKTAWDMD
FT                   RLEAEEGGHKRIERELSDKVSMCNYWANRLVCEAADRAMQVHGGIGYSRHKPFEHIYRH
FT                   HRRYRITEGAEEIQMRKVGAFLFGYLGPRRGMFG"
FT   gene            complement(303724..304314)
FT                   /locus_tag="Saro_0283"
FT   CDS_pept        complement(303724..304314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24731"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP2"
FT                   /protein_id="ABD24731.1"
FT                   /translation="MRELTPRIALELIAHEGIVTEAYKDSVGVWTWSVGITDASGHKVF
FT                   PRYKDKPQPLEHCIGVYLWLLRERYLPPVLAAFGRHDPSEAELGAALSFHWNTGAIARA
FT                   SWIGRFVKGDVDGARKSMLDWARPAALLPRRRKEQALFFDGKWSEDGTALVYGVARPSY
FT                   QPARGRRVEVRGLVEGLFADTTARKTWFDRLFD"
FT   gene            complement(304519..305724)
FT                   /locus_tag="Saro_0284"
FT   CDS_pept        complement(304519..305724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0284"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24732"
FT                   /db_xref="GOA:Q2GBP1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBP1"
FT                   /protein_id="ABD24732.1"
FT                   /translation="MRTDYLFTSESVSEGHPDKVSDQISDAIVDLFLSKDPEARIACET
FT                   LTTTQLVVLAGEIRCKGVYENGEWAPGAQDEIEKTVRDTVKRIGYEQDGFHWERLEFIN
FT                   RLHGQSAHIAQGVDAADNKDEGAGDQGIMFGYATDETPDLMPATLYYSHKILERMAADR
FT                   HSGAAPFLEPDAKSQVTLRYEGSLPVAATAVVVSTQHAPGYDEGGKEAELHEYVKRVVA
FT                   EVIPPVLLRETKYYINPTGSFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPT
FT                   KVDRSAAYITRYLAKNVVAAGLATRCTIQIAYAIGVSEPLSLYVDTHETGTVGDDKIEQ
FT                   AILGIAKLGGLTPRAIRTHLGLNKPIYRPTAAYGHFGRKADGDFFPWERLDLVDDLKAA
FT                   FA"
FT   gene            complement(305765..307333)
FT                   /locus_tag="Saro_0285"
FT   CDS_pept        complement(305765..307333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0285"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24733"
FT                   /db_xref="GOA:Q2GBP0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBP0"
FT                   /protein_id="ABD24733.1"
FT                   /translation="MVRLGPIPRPHLYTILAGALAACGFQPLGLWPFTLAALGFLVHRI
FT                   DVTRTWRQALLAGWLFGVGHFTVGNGWIATAFTYQAEMPAWLGWIAVFLLALYLALYPA
FT                   LATLGGWWLARTRRAALLPAFAACWIVAEWLRSWIFTGFAWNPLAMVTLGGFERPGLAL
FT                   SAQWLGTYALSGLVVLLGGWWLFGLRAWGKGNRWGAAAYALGPAILMVLPLHGERREGT
FT                   LPFTLVQPDVRQELLNDPANYENQFRDTAALSLHRAPGERRLVLWPESGVPDFLRPGYA
FT                   RFWYEETTYAADPALARERIGRVIGPGSLLFTGTTDLEQRRGRVVGAWNVVTALDSNGA
FT                   IRGGYAKAHLVPYGEYLPMRTILEPLGLSRLVAGSIDFLSGPGPRTVDFGPHGKAGFQI
FT                   CYEIIFSGQVVDRANRPDYLFNPSNDGWFGSWGPPQHLAQARMRAIEEGLPVLRATTTG
FT                   ISAVIDADGVVRQFLPQHRAGRIDGKVPPAHAPTPFARTGNALALGWAAILLLIALVAT
FT                   RARKR"
FT   gene            complement(307416..308438)
FT                   /locus_tag="Saro_0286"
FT   CDS_pept        complement(307416..308438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24734"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN9"
FT                   /protein_id="ABD24734.1"
FT                   /translation="MLGTPIRMTRAGGGGLRGIRVAQALREAAPFKEVPELNNNRGNNR
FT                   RRGRGNNRPQNGGQQLNRIDSRARGNAPQLLEKYRKLAQDAHLNGDRVQAEYYLQFADH
FT                   YFRVIADTRVRQEEQRARQSGGERWQDQDVEDDGADFSVEGDFPAFDRPVSHRHDREQR
FT                   EDRQPRDDRQDRGEGRRDRDERPREDRPREDRPREDRQRDDRGDGRRENRRFDRKRDRD
FT                   AETEVAAAEETLPGEGVPAIEGEPIVDASENPFVRDNRVARGLRPRGERRQRRDRNEDE
FT                   APATLDASSLPPSIGVRSEPAQDVEAAPAPVAEEAAPAPKKRGRPRKTPAPEATEPVEG
FT                   "
FT   gene            complement(308535..309410)
FT                   /locus_tag="Saro_0287"
FT   CDS_pept        complement(308535..309410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0287"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24735"
FT                   /db_xref="GOA:Q2GBN8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN8"
FT                   /protein_id="ABD24735.1"
FT                   /translation="MRGMTVADAIRAATQRLSATSDTARLDAEVLMAHALGCSRTDLLL
FT                   RHMTGAAPEGFAALVERRLGHEPVAYIIGSAEFYGLDLAVTPAVLIPRGDTETLVEAAR
FT                   EAFAWRAAPRRILDLGTGSGALLLAALSLWPQAEGVAIERSPEALAVARANGARHAPAA
FT                   RFLPGDWTQPDWSADLGTFDLILSNPPYVEDEADLALSVRAHEPSAALFSGPEGLDDYR
FT                   VLVPQLPGLLTDQGIAIVEIGWQQGQAVSAIARASGMTARIHRDLANRDRAVEMAKIGN
FT                   IPLGKGPADH"
FT   gene            complement(309482..310546)
FT                   /locus_tag="Saro_0288"
FT   CDS_pept        complement(309482..310546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0288"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24736"
FT                   /db_xref="GOA:Q2GBN7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBN7"
FT                   /protein_id="ABD24736.1"
FT                   /translation="MSVSDARLAQIAARFAELEARLASGTLEGADFIAASRDYAELEPV
FT                   ARVAEEVREMRGELVSLAALDDPDMRELADEELARIRAELPEAEHRLAVAMLPRDSADA
FT                   RPAMLEIRAGTGGDEAALFAADLFRMYERYAAEQGWRVETISVNANDLGGYKEVVANVA
FT                   GQGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPDEVDVAIEDKDLKIDIY
FT                   RASGAGGQHVNTTDSAVRITHLPSGLVVTCQDERSQHKNKAKAMQVLRTRLYDMRREAA
FT                   QGAEAEARKAMVGSGDRSERIRTYNFPQGRVTDHRINLTLHRLPEILEGPGLAELIDAL
FT                   IAEDQSKRLAAMDG"
FT   gene            complement(310668..311927)
FT                   /locus_tag="Saro_0289"
FT   CDS_pept        complement(310668..311927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0289"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24737"
FT                   /db_xref="GOA:Q2GBN6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBN6"
FT                   /protein_id="ABD24737.1"
FT                   /translation="MSTQTPQPIRGTQDIFGPDAEAFAFVVETFERVRKLYRFRRVEMP
FT                   VFEKTAVFSRSLGETTDVVSKEMYSFEDRGGESLTLRPEFTAGIARAYLTDGWQQYAPL
FT                   KVATHGPLFRYERPQKGRYRQFHQIDAEIIGAGEPQADVELLVMADQLLKELGIGANDP
FT                   GAVTLQLNTLGDGASREAWRAALVEYFRAHKAELSEDSQDRLERNPLRILDSKDPRDKP
FT                   FTADAPRIDDFLSAEAQDFFGKVTSGLDAAGVEWTRAPALVRGLDYYRHTAFEFVTDRL
FT                   GAQGTVLGGGRYDGLMEALGGAATPAVGWAAGIERLAMLVGEKGEARTDVIVVVEDDAL
FT                   LTSGIEQVSRLRREGVSAELVASGSARKRFDKAVKMGAKAILALAMRDGQPAARFRVED
FT                   DAATALRGQLEAAVAKYGAQ"
FT   gene            312028..313980
FT                   /locus_tag="Saro_0290"
FT   CDS_pept        312028..313980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0290"
FT                   /product="glycyl aminopeptidase, Metallo peptidase, MEROPS
FT                   family M61"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24738"
FT                   /db_xref="GOA:Q2GBN5"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN5"
FT                   /protein_id="ABD24738.1"
FT                   /translation="MFKTLAAAPLLLALSVSTQALAANSAPMAVPIAQTVPDAQDVAYP
FT                   GTMTLDIDASDVVRGAYRVTQTIPVVAGAKELILLYPQWLPGNHGPRGPLAELVGVQFF
FT                   VDGKPVEWKRDRVEVYAFHVTLPAGAKEVVAKLIHTSPLQSSEGRITMTPEMLNLQWEK
FT                   MSLYPAGHYVRRIRVKPTVTLPQGWTPATALDGMSMSGNRATWAETDYETLVDSPIFAG
FT                   KNFRKWDLGQNVTLNVVSDKPEQLEAKPEHIAAHKALVEEARIAFGANHFDHYEFLLAL
FT                   SDKIGGIGLEHHRSSENQLEPEAFTEWAKQEWDRNLLPHEYSHSWSGKFRRPSRLWTPD
FT                   YRQPMQGDLLWTYEGQDQFWGAVLASRSGMQGKDMVLGMLAAWAGGFTQQPGREWRSVE
FT                   DTGFDPVFASRKPKPYSSLARNEDYYTEGALVWLEIDQILREGTGGKKSIDDFAKSFFG
FT                   MNPGDWGQIPFEVDEIVTKLNALYPYDWAKLIDTRINQPGQPAPLNGIEKGGYKLVWKE
FT                   EPNPYMKAAIDFGKGLSLSNSIGISLDKDGKVTGTRWDSPAFNAGIVTGTQIMAVNGTA
FT                   YSADDLKKAITAAKGDKGQPLELLVKRGSRFETVKLDYRDGLRYPWLERVAPGKAPTGL
FT                   DLLLEPRRPGAAKKK"
FT   sig_peptide     312028..312096
FT                   /locus_tag="Saro_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            313985..314635
FT                   /locus_tag="Saro_0291"
FT   CDS_pept        313985..314635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0291"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24739"
FT                   /db_xref="GOA:Q2GBN4"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN4"
FT                   /protein_id="ABD24739.1"
FT                   /translation="MARGGAKLGNRLAPARFVLFLVLLVAAFAGDRLLLEPGSLADSLA
FT                   MSFDIAALVFLVSLIPLLRGAGTARMRRHAAENDANRVLVLMVTTIVTMVVLAAISGEL
FT                   PPASAGDRLAMVKLIGTLLLAWLFTNMVYALHYAHLYYSSHDGTDRGGIEFPGTRTPDY
FT                   LDFAYFSFTLGMTFQTSDTQITARTIRRIATMHSFVAFVFNIGVVAFTINALG"
FT   sig_peptide     313985..314074
FT                   /locus_tag="Saro_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.779) with cleavage site probability 0.773 at
FT                   residue 30"
FT   gene            314790..315329
FT                   /locus_tag="Saro_0292"
FT   CDS_pept        314790..315329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0292"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24740"
FT                   /db_xref="GOA:Q2GBN3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN3"
FT                   /protein_id="ABD24740.1"
FT                   /translation="MRIDMIPTGDNPPESLNVIIEVPVGGEPVKYEFDKASGALFVDRI
FT                   LHTPMRYPANYGFVPHTLSPDGDPLDALVIARSPFVAGSVVRARPIAVLNLEDEHGGDE
FT                   KLVCVPVDSTFPYYSDVKERDDLPEIVMQQIEHFFTHYKDLEKDKWVRVGTWGDAEDAK
FT                   RITIEAIERAKAAKAA"
FT   gene            complement(315351..316694)
FT                   /locus_tag="Saro_0293"
FT   CDS_pept        complement(315351..316694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0293"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24741"
FT                   /db_xref="GOA:Q2GBN2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN2"
FT                   /protein_id="ABD24741.1"
FT                   /translation="MMLPPFLLGALLAAAPLGAQAALPKLPKPAPSASASTPAPVISAQ
FT                   PAPDEDARLAARIRAIFDEIPALRGTGVRVAAGVVTLTGIVPDDKTIAQAEGIASRLSG
FT                   VVTVQNRLERDLGVERNLNPALSGVTGRLNEFARAVPLIAIAMLVAFLVGALGYAIAAR
FT                   KAVWQRVAPNPFLAELIATAIRFAFVVGGVVLALDIVGATALLGAVLGGAGVLGLAVGL
FT                   AVRDSIDNYVSSLMLSVRQPFRANDNVRIDQHEGRVVRLTSRATVLLTPDGNHLRVPNA
FT                   TVFKAVITNFTTNPERRFQFDYSIDHAGDPCRAQAIALDVLKKLDWVLGDPRPTAEIAD
FT                   LSGSVQVLRFAGWIDQTRADFGKGRTRAMEAVRRALRDAGYAAEGPEYRVHLDSEAHPP
FT                   PPQSAEPRAGDADVDDVAPDRHMERMVREERSGDEGGKDLLDSRRPVE"
FT   sig_peptide     complement(316629..316694)
FT                   /locus_tag="Saro_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(316744..318090)
FT                   /locus_tag="Saro_0294"
FT   CDS_pept        complement(316744..318090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0294"
FT                   /product="microcin-processing peptidase 1, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24742"
FT                   /db_xref="GOA:Q2GBN1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN1"
FT                   /protein_id="ABD24742.1"
FT                   /translation="MLSPAEARERCEALVERARRAGADAGDAVYIASGSESVQVRLGAL
FT                   EDVERSESEHIGLRVFVGGASASIGSTDLGDAALDELASRAVAMARLAPADKFAGLAPE
FT                   DMLFRGPVPDLDLDDATERSPQDLRRLAEEAEDAARAIAGVTNSEGGSASAGRGLFALA
FT                   TSHGFSGAYAASSHSISASVVAGEGSAMQRDYSWRSTRHAADLLPPARIGAEAGERAVR
FT                   RLNPGRVKSGQVPVVFDPRVANSLVGHLLGAMSGASIARRASFLLDRDGAQLFDSAITI
FT                   SDDPLSIRGMRSRPFDGEGLPTAPRKLVDAGKLTGWLMDTAAARQLGSRPTGHASRGAS
FT                   GAPHVTASNVVLEPGTVTPAELMADIADGVYVTELIGQGVNAVTGDYSRGASGFRIVNG
FT                   EIAEAIAEFTVAGNLIDMFAALTAANDLEVYRGIDTPTLRVDGMSIAGD"
FT   gene            complement(318152..318571)
FT                   /locus_tag="Saro_0295"
FT   CDS_pept        complement(318152..318571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24743"
FT                   /db_xref="GOA:Q2GBN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBN0"
FT                   /protein_id="ABD24743.1"
FT                   /translation="MACVFYSLKAGKNRGSAMNKALHNGDAKARRQVDWRKKMSDNVAY
FT                   GLLVYTGLQIFVTMHELQGASASILPVFVLVMLVAAIIPLFRQFERRWEHLGDEQAHDM
FT                   AFRAAFRRDQVKVWLLAAVLPFVITGAFKLLSALF"
FT   gene            318701..319504
FT                   /locus_tag="Saro_0296"
FT   CDS_pept        318701..319504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0296"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24744"
FT                   /db_xref="GOA:Q2GBM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM9"
FT                   /protein_id="ABD24744.1"
FT                   /translation="MLENDRAPPMTLTEEAPAAVNAAPPIPQGGLEVVSIAKSYDKRAV
FT                   LTDISLSVGKGEVLGLLGPNGAGKTTCFYSIMGLVRPDSGRILLDGVDITKLPMYRRAI
FT                   LGLGYLPQETSIFRGMTVEQNISTVLELIEPDKATREAELERLLDEFGLARLRSSPAMA
FT                   LSGGERRRCEIARALAARPSIILLDEPFAGIDPLSISDIRHLVKDLKGRGIGVLITDHN
FT                   VRETLDIVDRACIIYGGQVLFAGSPEALVADANVRRLYLGEGFTL"
FT   gene            319545..321041
FT                   /locus_tag="Saro_0297"
FT   CDS_pept        319545..321041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0297"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24745"
FT                   /db_xref="GOA:Q2GBM8"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM8"
FT                   /protein_id="ABD24745.1"
FT                   /translation="MALGPRLDIRQTQSLVMTPQLQQAIKLLALSNLEVEAFIGEALEA
FT                   NPLLEIGETAPAEAVDAGPEDLRRTHLESSPVDQLVAEGRVEEDRPLDIDVTALDRDRD
FT                   TGDGDFGGGTLELSSTRESGGGEGPDIDERGRIEETLAEHLHAQIGATTSDAQLLFVAR
FT                   WLIDQLDEAGYLAMPIGEVAEALGLSPLVVERALALVQSLDPTGVGARNLAECIALQAR
FT                   EADRYDPCMARLIDNLELVARGEIARLKRLCQVDDEDFADMLAELRGYDPRPGLRFGGG
FT                   AAEPVVPDILVRAAKGGWDIALNQATLPRLVVNRSYYVEMRGACVGKEAKAWLGEKLAD
FT                   ANWLLKALDQRQKTILKVAAEIVKQQDGFFRHGVAHLRPLTLKTVAEAISMHESTVSRV
FT                   TSNKYLHCDRGTFELKYFFTSGVGSSDGEGASAAAVKAAIRQLIDAEDPKAILSDDALV
FT                   DLLKARGFDLARRTVAKYREAIGLGSSVQRRRQKTLAGVR"
FT   gene            complement(321137..322000)
FT                   /locus_tag="Saro_0298"
FT   CDS_pept        complement(321137..322000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0298"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24746"
FT                   /db_xref="GOA:Q2GBM7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM7"
FT                   /protein_id="ABD24746.1"
FT                   /translation="MLIAQVTDIHLGFEPDSPDEFNRQRLDRVLAELAAMDPRPDLLLA
FT                   TGDLIDRGDRESYERLRDAFSNLPFPVHYALGNHDERETFSAVFPEAAFTDGFLQYIVD
FT                   AGPLRIIVLDTLEEGRHGGAFCDVRARWLKARLDEAPDTRTLIVQHHPPVEVGIAWMNT
FT                   DPAEPWVERLGQCLRGRTNVVGVVCGHIHRAITTAWEGTVVATCPSTAPQVALDLRPID
FT                   PDVPDQRNLIIADPPGYALHWFNGRELITHWDTAEDHQVLARYDANLQGMIQHMLAERP
FT                   GAQAAE"
FT   gene            complement(322022..323905)
FT                   /locus_tag="Saro_0299"
FT   CDS_pept        complement(322022..323905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24747"
FT                   /db_xref="GOA:Q2GBM6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM6"
FT                   /protein_id="ABD24747.1"
FT                   /translation="MSFLVRQIALKSSGEEIVRPSTVEGDELTIGRDASCGIHLPDLAV
FT                   DPRHAKVVASTDGGLAIASIGDQPFEVNGRSTTQASLDPAVGAELTFGGHRIAVSRDGE
FT                   TGLPTFTVRRVEAVSDSAEEKDIATVYTLKGLLPGKRMSAWTFAILVLVAFLAFPIFSY
FT                   VTYKPLAMHEKARRPDGFHADQAWSSGPLSLAHKNLKGDCQACHTEAFVAVTDKACLTC
FT                   HTKDAHDHISDKARLLRARGEPTGMAAFQRAVANAFNRPAGRCVDCHTEHEGAGAMPAT
FT                   QQKFCADCHSGMKGRLPDTKIADAADFGTAHPQFKPTIIGGMDGGKPLFQRAAWTPGLQ
FT                   EDNGLKFTHGQHLSKTNGIAQMVRRMPGRFAADDALQCKDCHKADATGTRFKPVVMEDS
FT                   CQSCHSLSFDQVGGTFRTLRHGRPDQVVAELRSFYRGGAPARPANLSGLARRVPGDAAL
FT                   RATAADYARAVRFYPTRAEQAVAQVFSQGGMCYDCHTVTRGGSAATGGFMVRAVAQNDR
FT                   YYHKGWFDHKAHDKSDCADCHTEAARSNRASDLLVPGIDGKGGCRTCHVGGEGAKLATV
FT                   SVKDPVDSSCAMCHSYHMDTGAPWAPKKDRKKDVAQTVALAERPRFPANLR"
FT   gene            complement(323913..324809)
FT                   /locus_tag="Saro_0300"
FT   CDS_pept        complement(323913..324809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24748"
FT                   /db_xref="GOA:Q2GBM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM5"
FT                   /protein_id="ABD24748.1"
FT                   /translation="MASIAPKKRTGATRERTSTHEGFLSHHNMFWGKLSAALALALVAL
FT                   YIFVPLPGTHFGSSWLGYALGTVGALLILWLTMLGVRKRAITPGRWSLKAWTSAHVYLG
FT                   LCLTVIGTLHSGFHFGWNVHTLAWALMLLVIGSGVFGIWVYATLPRALSANRYDEEGAI
FT                   TEKQMIEALRSLDRQIHDAAQPLDPQSAALVNQSLDEDPFAGNFWNRLTGNYPKCATRH
FT                   AAAELRRMRAYRPRVADDPIDKVDALLTRKEAMLGRMRRHLKLKSWLQAWLYVHVPVTF
FT                   ALIAALSAHIVSVFFYW"
FT   gene            complement(324814..327390)
FT                   /locus_tag="Saro_0301"
FT   CDS_pept        complement(324814..327390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0301"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24749"
FT                   /db_xref="GOA:Q2GBM4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM4"
FT                   /protein_id="ABD24749.1"
FT                   /translation="MGEVFKVAIIGSGPAGMSAASRAAQLGLSHVLLEKTDHLSDTIYK
FT                   YQKGKHVMATPSQLILRSDQEFDAGKKEDILGRWNERTAELGVNVKYNAEVKAIRGTGP
FT                   AIPGSVQKIVSRARDGSTTTTELQRHAPPYAIELTNGETVMAQNVVLAIGTQGNPNLMR
FT                   CPGGDLPHVTYQLDDPYAVLDQHIVVVGTGDAGIENARGLVEDPAQGNVVTVLNRSPKS
FT                   TNVRESFATAKEPNAKALIEDDAAGKLTIRYETETKAVEPGWITLSTRDGEERIRCDRI
FT                   IARIGSAPPRAFVEGCGIEFASADRLAFPTLSPQFESTAPGIFVIGALAGYPLIKHCMN
FT                   QGYDVVEFINGNTDLKPADEPLLEAKFAGLPGNRSVNEWLEFLRSNVSILEGMTTLQLR
FT                   EFMLDSEARAYRKGDVVFEKNDPGSSLFAIASGSVHVRLDPKDPSKVIPIPAGTIFGEV
FT                   GLISGRRRGATIVAAEDAVCVEISRNAALKLQSQVPTAKRTIERISTERQILQMFGSGL
FT                   TSADIAEVVETSKIVQVRAGDAIIKEGDEDKDIYVIRVGSMIVEKEVGGKPVFLSYLPA
FT                   GSYVGEMALIDGGRRTATVRAAIKSEVIRIDGDAFGRVLAAKPALLDRARKDMEVRRAT
FT                   NAFIESKKDSFSGVVDLYSEQAKFLVAQGLGEATDVLLIDERLCVGCDNCEKACADSHD
FT                   GLSRLDREAGKSFAHLHVPTSCRHCEHPHCMADCPPNAIHRGPDGEVFINDTCIGCGNC
FT                   QRNCPYGVIRMDKVPPKKPSLLSWLFFGRGPGPGEPPYKWSKKNTKYTGDPAVDELLDR
FT                   KKAIKCDMCAGIEGGPSCVRACPTGAAIRVSPDEFLTVARLENEGA"
FT   sig_peptide     complement(327319..327390)
FT                   /locus_tag="Saro_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.947 at
FT                   residue 24"
FT   gene            327631..328644
FT                   /locus_tag="Saro_0302"
FT   CDS_pept        327631..328644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0302"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24750"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM3"
FT                   /protein_id="ABD24750.1"
FT                   /translation="MTEPQSSPDPKPNPEASAEAQGASRLGRAALIAAGVIALGAGGYA
FT                   MIGRHDSPPPPVEPPPAAPSQQPSVDDVIAKLEKKLAENPDDAEGWRMLGWSYFQTERY
FT                   AEAATALKKATKLDPEHAETWSFLGEALVLASKEEGRMPRDAKAAFDKAIKLDPKDARA
FT                   RYFQAVALDLSGRHRQAINAWFKLLEDTPADAPYAEDIREVIRNVGERRKIDVEKRLAE
FT                   AHFAAPANGVITDGPHKAAAAIPGPTSAEMKAAAGLPKGQQEAMIRGMVDGLEAKLEKN
FT                   PANVDGWIMLMRSRMQLGEPRKAAESLQKALAAFRNDGAASRKLREAASSIGISGA"
FT   gene            328963..329664
FT                   /locus_tag="Saro_0303"
FT   CDS_pept        328963..329664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0303"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24751"
FT                   /db_xref="GOA:Q2GBM2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM2"
FT                   /protein_id="ABD24751.1"
FT                   /translation="MRVLLIEDEPTTAKAIELMLTTEGFNVYSTDLGEEGLDLGKLYDY
FT                   DIILLDLNLPDMHGYDVLKKLRVAKVQTPVLILSGISEMDSKVRSFGFGADDYVTKPFH
FT                   REELIARIHAVVRRSKGHSQSVIRTGKLSVNLDAKTVEVDGARVHLTGKEYAMLELLSL
FT                   RKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAHACGGENYIETVWGRGYVLR
FT                   DPDDMSAIEAA"
FT   gene            complement(329740..330588)
FT                   /locus_tag="Saro_0304"
FT   CDS_pept        complement(329740..330588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0304"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24752"
FT                   /db_xref="GOA:Q2GBM1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBM1"
FT                   /protein_id="ABD24752.1"
FT                   /translation="MRACCGDQRAMSATDHGLPAIAELTDKELEVLRLLTAGHTIKSIA
FT                   ALLDRSEASINERLRDARRKTGVGSSRELARLVAGQENWPRKTDLSTPAVSGDADGQPA
FT                   LAARHWPKGTIAMFTLLPLAAGLMLVSAASQQADGPQSSHAAAAIASPLVGKWSLDTSR
FT                   IPADERPRSVMIAFSVSPDQQWSTQVDIVAPDGSKMTATSTARADGVAVPISGNIPIFD
FT                   TASLRQPAPNTLVMTLGKSGTPVATRVYTVARDGNSMTETIVWADKTMPKMETTYFNRV
FT                   G"
FT   gene            330670..331386
FT                   /locus_tag="Saro_0305"
FT   CDS_pept        330670..331386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0305"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24753"
FT                   /db_xref="GOA:Q2GBM0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBM0"
FT                   /protein_id="ABD24753.1"
FT                   /translation="MTAYKSGDPTTINRLYGRAKGKPLRQGQQALVDELLPQISMPAEG
FT                   PITAEALFGEPRPLHFEIGFGGGEHMAFRADMLPDHGFIGAEPFLNGVAQALTHVSGDN
FT                   GQHPPIPNVRIHHGDALEVLRRIPDGSLSFLYLLHPDPWPKARHAKRRMMNDGPVDLFA
FT                   AKLRPGGEFRFGTDHAVYLRHALMVMRRHKHQFEWLAKDARDFQVRPGGWPETRYEHKA
FT                   RTVYGHEVWYFRFRRR"
FT   gene            331516..332769
FT                   /locus_tag="Saro_0306"
FT   CDS_pept        331516..332769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0306"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24754"
FT                   /db_xref="GOA:Q2GBL9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL9"
FT                   /protein_id="ABD24754.1"
FT                   /translation="MATGKISKRSIDALRPNASNQFLWDTDLKGFGAKITPAGAISYVL
FT                   QFRMGGREASTRRYTIGAHGSPWTPTTARAEAERLLLLIGQGVDPVDADKQRRREAVDL
FT                   AFANYAERFARSCKGDGWRRLVERAIRLYLTPVLGKKALPAINRTDVVSVFDNMPADQV
FT                   ANRRNVFAVLRRLFRWAVSRGDLDRSPMEGMETPPPVKARERWLSDDELRLIWNAAPEC
FT                   HRCFGPIVRLLIATGQRREEVSGMRWSELSRTDKLWTLPGDRTKNGEPNTIPLNDLAVA
FT                   ELDAAAGGDKWPRKGRVFATSTGAGFTGYAKGKDKLDRLIELAEGEPLPPWRLHDLRRT
FT                   LATNFQRLGVRFEVTEAVLNHVGGSRSGVAGIYQRHDWKEEKRQALDDWNSHLEQILMR
FT                   PSPGNRQAASQAAADLDK"
FT   gene            333031..333927
FT                   /locus_tag="Saro_0307"
FT   CDS_pept        333031..333927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0307"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24755"
FT                   /db_xref="GOA:Q2GBL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL8"
FT                   /protein_id="ABD24755.1"
FT                   /translation="MTIEIRQLRYALMSADLRSFSGAASRLNVKQATLSRSVLQLEDRL
FT                   GIKLFERTTRGAEPTETGKVFLETARRIITDLENLQTTARAVSYGEQGRFAVGYCSSLM
FT                   AGHLKAAFSDYLTRFPDVQFDGVEGDPDKLCSDLRAGTIDVAIAPLGSEEQGIASRPVW
FT                   SERLVAALYPEHPLLEASRIYWGDLRREIFVVPRKGIGQMIRNMITARLTGQGYRPNII
FT                   TQETSLESVLSMVPVGRFITIATEASMGVAWPELQFRDIYDNGGTARIDFALYWREDNE
FT                   NPALQRFFTMINERYPA"
FT   gene            complement(333915..334139)
FT                   /locus_tag="Saro_0308"
FT   CDS_pept        complement(333915..334139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24756"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL7"
FT                   /protein_id="ABD24756.1"
FT                   /translation="MTRLKLSDIADEKPVRLTIELPARLHRELLAYAAAVNGGDAAGAP
FT                   TVERLIPPMLERFITSDRAFAKAKRGQAG"
FT   gene            complement(334136..335332)
FT                   /locus_tag="Saro_0309"
FT   CDS_pept        complement(334136..335332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0309"
FT                   /product="conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24757"
FT                   /db_xref="GOA:Q2GBL6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL6"
FT                   /protein_id="ABD24757.1"
FT                   /translation="MTGAVDTESREQPLVDPESAVKLRGDPPRVMRLSRKAIGLASAAA
FT                   CALVGGALIYALQPEGRKGAEELYNTDGVAVADNLAGAPKDYGQVPKLGPPLPGDLGKP
FT                   ILDARQRGDVAALPPAGTGPATNPAADAAAAARQRAEQEREAARGSRLFFGGGSAGSAA
FT                   GSLASLPAGDEAPAVAPGAAPSSDAARRQAFLERTSDRRTVSGERLVGLAAPAILQAGS
FT                   VIPAALITGIRSDLPGLVTAQVTQNVYDSPTGRILLIPQGSRLIGDYDTDVAFGQNRVL
FT                   LAWNRLILPDGRSIVLERQPASDTQGFAGLQDGTDYHWGGVLKAALVSTLLGAGAELGS
FT                   GDDGNLARAFRRGTQDSINRAGEQIVSRELNVRPTLTIRPGFPVRVLVTRDLVLGAGQ"
FT   gene            complement(335329..336360)
FT                   /locus_tag="Saro_0310"
FT   CDS_pept        complement(335329..336360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0310"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24758"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL5"
FT                   /protein_id="ABD24758.1"
FT                   /translation="MINRTRCAPRTLTLAIASSSLVLAIPLQAREPAVNPPAAPAAVNE
FT                   TPQAPSSRSSVVAIPVPLPFPGQLKSLPQAEPPAAGRSHPSRSHPAPRDRVGAANEAAR
FT                   VQPDRTGFINAIQLYPFTKGALYQVYARPGQVTDIALQPGERLVGAGPVASGDTVRWMI
FT                   GDTVSGTGAAEQVHILVKPTRPDIATNLVINTDRRTYHLELRANPSVYMASVSWTYPED
FT                   ELIALRRAHAEAERAAPIAAGMDLASLDFRYRIEGDKPAWRPLRAFDDGTRVFIEFPES
FT                   VAQGELPPLFVLGARGEAELVNYRVSGRYMIVDRLFAAAELRLGGRKGQDKVRIVTARR
FT                   GRS"
FT   sig_peptide     complement(336271..336360)
FT                   /locus_tag="Saro_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.807 at
FT                   residue 30"
FT   gene            complement(336357..337040)
FT                   /locus_tag="Saro_0311"
FT   CDS_pept        complement(336357..337040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0311"
FT                   /product="Conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24759"
FT                   /db_xref="GOA:Q2GBL4"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL4"
FT                   /protein_id="ABD24759.1"
FT                   /translation="MFRRPTIRYGRTPEPETPYQRAAQVWDDRIGSARVQARSWRLAFF
FT                   GALGLSTCLTAGIIWQGARGSIVPWVVEVDKLGEAQALAPADAGFAPSDPQIAFHLARF
FT                   IEQVRSIPDDPIVVRQNWLRAYDFATDKGALALNDYARTNDPFALIGREQVGVDVTSVI
FT                   RASPTSFRVAWVERRYRDGSLAETSRWTAILTTVVQPPRTPDALRKNPLGIFVNAINWS
FT                   KELGS"
FT   gene            complement(337044..338354)
FT                   /locus_tag="Saro_0312"
FT   CDS_pept        complement(337044..338354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0312"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24760"
FT                   /db_xref="GOA:Q2GBL3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL3"
FT                   /protein_id="ABD24760.1"
FT                   /translation="MGGTGVVDRFLDIFSRYIDSGFGLLSGEVAFIATTLIVIDVTLAA
FT                   LFWTWGEQDDVIARLVKKTLFVGIFAYIIGNWNNLARIVFESFAGLGLKASGTGFSAGE
FT                   LLQPGRVAQVGLDAARPLIEAISDLMGFVSFFENFLQIVILLVAWALVVIAFFILSIQL
FT                   FVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVLAVIVGIGSTIFS
FT                   EFTSAIPAEPTIEDALSIVLASLTLLGLGIFGPGIANGIVAGGPQLGAGAAAGTALMAG
FT                   GAAAGAVAGAKLAGGAVASAASSVAHGTSRAAGGATTAYAMGSAGKSGAAAIGSGAAAV
FT                   GDAALGATVSPLRKAGEGLQQSFREGGRSAITNTGGTITPGPDTPAPPTAEAGQPAWAR
FT                   TMKNRQTLAQGATIAAHTLKAGDSSGAGASIDTSEKD"
FT   gene            complement(338356..338676)
FT                   /locus_tag="Saro_0313"
FT   CDS_pept        complement(338356..338676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24761"
FT                   /db_xref="GOA:Q2GBL2"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL2"
FT                   /protein_id="ABD24761.1"
FT                   /translation="MDTKLFARIAAGAFVAVALTMTVLTLREEREVPLPEMVTVWEPDG
FT                   DPLPTQLKACAAMGELALSSPDCRAAWAEKRRRFLGIEDGEQSTATQAEPPHLHQPPAQ
FT                   DQ"
FT   sig_peptide     complement(338620..338676)
FT                   /locus_tag="Saro_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.399 at
FT                   residue 19"
FT   gene            complement(338682..339458)
FT                   /locus_tag="Saro_0314"
FT   CDS_pept        complement(338682..339458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0314"
FT                   /product="putative conjugal transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24762"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL1"
FT                   /protein_id="ABD24762.1"
FT                   /translation="MKSPLKPPGLRPILAAGAAVLSLGAAVIAPAPAHAQFGFGGIVYD
FT                   PTNYAQNVLTAARTLEQINNQIRSLQNQATSLINEARNLQSLPLTVLEPIQQQIRQTQQ
FT                   LLSKAQGIAYDVQAIEREFARNYSPASLTGSQRDMVRGAEDRWRTSVGAFEDALKVQAG
FT                   AVQNIEGSRTAVQSLVTASQSATGALQAAQAGNQLLALQSQQLADLIATMAAMNRAQAL
FT                   DAANEAAAKAQAREQLRRFMAPGRGYVPVSTKLYRD"
FT   sig_peptide     complement(339351..339458)
FT                   /locus_tag="Saro_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(339464..341929)
FT                   /locus_tag="Saro_0315"
FT   CDS_pept        complement(339464..341929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0315"
FT                   /product="CagE, TrbE, VirB component of type IV transporter
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24763"
FT                   /db_xref="GOA:Q2GBL0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBL0"
FT                   /protein_id="ABD24763.1"
FT                   /translation="MFSLREYRNKADRLADFLPWAALVAPGVVLNKDGSFQRSARFRGP
FT                   DLDSATPAELIATTARLNSALRRLGSGWAIFVEAVRRPAHDYPESDFPDAASALVERER
FT                   AAQFAEEGAHFESAYYLTLVWMPPAEDAARAESWLYEGKAHQGVQARELLELFSDRTDR
FT                   LLRLIEGFVPEAAWLDDSETLTYLHSCISTRNHRVRVPETPMHLDALLADEPLTGGLEP
FT                   RLGRAHLRTLTVVGFPSATFPGILDELNSQGFAYRWSTRAIMLDKTDAAKLLGKIRRQW
FT                   FAKRKSVAAILKEVMTNEASALLDSDASNKAADADAALQELGSDLQGMAYVTATVTVWD
FT                   EDAAMAAEKLRLVEKVIQGRDFTVIVEGMNALEAWLGSLPGHVYANVRQPPISTLNLAH
FT                   MIPLSAVWAGPEWDAHFRAPPLFYARTEGSTPFRFALHVGDVGHTLIVGPTGAGKSVLL
FT                   ALMALQFRRYDRAQIFAFDFGGSIRAAALACGGDWQDLGTSLAGDGAGAVMLQPLARID
FT                   EPAERNWAAEWLQAVLTGEGVTVDPATKEHLWSALTSLSTALVAERTLTGLAVLLQSQA
FT                   LKQALAPYCIGGPFGRLLDAEAEQLGAGKFQAFETEGLTGSAAAPAVLSYLFHRIEGRL
FT                   DGSPTLIIIDEGWLVLDSPAFAAQLREWLKTLRKKNASVVFATQSLADIETSAIAPAII
FT                   ESCPTRIFLPNERAIEPQILSVYRRFGLNDRQIEIIARAAPKRDYYCQSARGNRLFELG
FT                   LGEVALAFAAASSKTDQLAISELTETHGTGGFARAWLRHRGLAWAADMLPPDPVPPTRS
FT                   DQAAGQPKE"
FT   gene            complement(341936..342211)
FT                   /locus_tag="Saro_0316"
FT   CDS_pept        complement(341936..342211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0316"
FT                   /product="conjugal transfer protein TrbD"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24764"
FT                   /db_xref="GOA:Q2GBK9"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK9"
FT                   /protein_id="ABD24764.1"
FT                   /translation="MEGAPSGLPLGYAVPVHRALTEHILLGGAPRGLAIANATLAGAIG
FT                   LGLRLWIAGLVLFTLGHMVAVWAARRDPQFVDVARRHLRFPNYLRV"
FT   gene            complement(342211..342543)
FT                   /locus_tag="Saro_0317"
FT   CDS_pept        complement(342211..342543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0317"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24765"
FT                   /db_xref="GOA:Q2GBK8"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK8"
FT                   /protein_id="ABD24765.1"
FT                   /translation="MTQTLARARNGASALVLAAVAALVTVMPAHAAGSSMPWEAPLQSI
FT                   LESIQGPVAKIVAVIIIIATGLALAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSF
FT                   GGGALV"
FT   sig_peptide     complement(342448..342543)
FT                   /locus_tag="Saro_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(342540..343523)
FT                   /locus_tag="Saro_0318"
FT   CDS_pept        complement(342540..343523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0318"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24766"
FT                   /db_xref="GOA:Q2GBK7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK7"
FT                   /protein_id="ABD24766.1"
FT                   /translation="MSVIPIRSEAATRGARMLRTALGPEIGAWLEDQAVIEVMLNPDGR
FT                   LWVDRLGLGIADTGAVLSAADGERIIRLVAHHVGAEVHSGAPRVSAELPGTGERFEGLL
FT                   PPVVAAPSFAIRKPAGAVFTLADYVAAGIMPAASADALAAAVAARANILVAGGTSTGKT
FT                   TLTNALLAEVARTGDRVVLIEDTRELQCAAPNLVALRTKDGVASLADLVRSALRLRPDR
FT                   IPIGEVRGAEALDLLKAWGTGHPGGVGTIHAGSALGTLRRLEQLIQESVVTVPRALIAE
FT                   TIDVIAVLVRDGTGRRLSELVRIEGLDAAGDYRLVPLVPATEGECP"
FT   gene            complement(343777..344160)
FT                   /locus_tag="Saro_0319"
FT   CDS_pept        complement(343777..344160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24767"
FT                   /db_xref="GOA:Q2GBK6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK6"
FT                   /protein_id="ABD24767.1"
FT                   /translation="MKRTRHTFRLPPELADQLADYASRKRVSQAAVVEAALTSFLSPDS
FT                   SERMEAAFSRRLDRISRQLDKLDYHVEVGNEAIALFVRTWLISNPALPDSQLPAAQAQA
FT                   QERFTAFVSALARRMESEQRLAR"
FT   gene            complement(344157..346142)
FT                   /locus_tag="Saro_0320"
FT   CDS_pept        complement(344157..346142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0320"
FT                   /product="TRAG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24768"
FT                   /db_xref="GOA:Q2GBK5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK5"
FT                   /protein_id="ABD24768.1"
FT                   /translation="MSATRILWGQIAVVLFIVVLGVWGATQWTAAALGYQPELGEPIGY
FT                   AFGRPVYPPPAIFWWWFSFEAYAPQIFETGGLIAAASGLVAVAAAIAMSVWRARELKRT
FT                   ETFGSARWADRAEVAAAGLLGDHGAVLGHYEHSYLRHDGPEHVLCFAPTRSGKGVGLVI
FT                   PTLLTWPASAIIHDIKGENWNLTAGFRSTFSRVLLFDPTNANSAAYNPLLEVRRGVAEV
FT                   RDVQNIADVLVDPEGSLERRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVAAFLSDPRR
FT                   TIEATLTAMMATPHLGKAGVHPVVASAARELLNKSENERSGVLSTAMSFLGLYRDPVIA
FT                   EVTRQCDWRIMDLVSGKQPATLYLVVPPSDISRTKPLIRLILNQVGRRLTEELEADSKR
FT                   HRVLLMLDEFPALGRLDFFESALAFMAGYGLKAFLIAQSLNQIEKAYGQNNAILDNCHV
FT                   RVCFATNDERTAKRVSDSLGTATELRAMKNYAGHRLSPWLGHLMVSRSETARALLTPGE
FT                   IMQLPPDDEIVMLAGLHPIRAKKARYFKDRRLSARILPPPECRKAQPNIANAGAWADMI
FT                   VQSPTAQRHRSPTDDDDCDADNGGIRREPELPEHEEIVLPPRLVSEFEFEEPMIEEDLA
FT                   QSRQQADRIWTVARQAALDPGDGIEL"
FT   sig_peptide     complement(346068..346142)
FT                   /locus_tag="Saro_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.772) with cleavage site probability 0.633 at
FT                   residue 25"
FT   gene            346387..346593
FT                   /locus_tag="Saro_0321"
FT   CDS_pept        346387..346593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24769"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK4"
FT                   /protein_id="ABD24769.1"
FT                   /translation="MSIIATIMNTTTGRPIQKMKFTRMPKPWISFNLETGELVTAERID
FT                   VGKPAPGKFVAPVDIWVTLKPKG"
FT   gene            complement(347120..347647)
FT                   /locus_tag="Saro_0322"
FT   CDS_pept        complement(347120..347647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0322"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24770"
FT                   /db_xref="GOA:Q2GBK3"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK3"
FT                   /protein_id="ABD24770.1"
FT                   /translation="MSSALSHLLVLGGARSGKSRYAQGRAEALAGELIYLASAQAFDDE
FT                   MRERIALHRADRGPRWSTVEAPLELAEAITVYSTPETVVLVDCLTLWASNLMLAERDTA
FT                   AATEGLTRSLSAARGPVILVANEVGLGIVPDNALARRFRDVAGRINQEIAALVEEAVIM
FT                   FAGLPLTLKPKG"
FT   gene            complement(347644..349119)
FT                   /locus_tag="Saro_0323"
FT   CDS_pept        complement(347644..349119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0323"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24771"
FT                   /db_xref="GOA:Q2GBK2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBK2"
FT                   /protein_id="ABD24771.1"
FT                   /translation="MLQGTGSDVGKSVLVAGLCRALVQRGLRVLPFKPQNMSNNAAVTS
FT                   DGGEIGRAQALQAIACKVEPHTDMNPVLLKPQADRTSQLIVHGRVRGTLGAGNFRQARG
FT                   ALLGEVLASYNRLRRACDIVVVEGAGSPAEINLRAGDIANMGFARAAGVPVVLVGDIDR
FT                   GGVIAAIVGTRTIIDPADTAMIQGFIINKFRGDPALFADGYAQIESLSGWRGFGVVPWL
FT                   SAAARLPSEDAVVLESGKARAESRKLIACPILPRISNFDDLDPLKLEHGVDLHMVPPGQ
FT                   PIPAEAALIILPGSKSTIADLAALRAEGWDIDIFAHHRRGGLILGLCGGYQMLGKSIAD
FT                   PDGFEGSASAASGLGLLDVETTLHAHKALRPVSGLAMGAPFQGYEMHMGQTNGPDTEQP
FT                   FAVFADGRRDGAINAGGTVFGSYVHGLLADAELRRALLSRMDVEAGGVDYGASVEAALD
FT                   EIAAALEEHLDIDALVALAMAERPASVPAGDSA"
FT   gene            complement(349119..350069)
FT                   /locus_tag="Saro_0324"
FT   CDS_pept        complement(349119..350069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0324"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24772"
FT                   /db_xref="GOA:Q2GBK1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK1"
FT                   /protein_id="ABD24772.1"
FT                   /translation="MIDLTAFLALVLDAAVGWPQPLYRRIGHPVGIFARIIAALERRWN
FT                   VPSRSDGQRRMAGAVTVLILLGMAGGAGWVLQSLLVAIAGPWAWPLIAVLAWPGLAQRS
FT                   LYDHVRLVADALERQDLPAARATVGMIVGRDTAALDDAGVARAAIESLAESFCDGVVAP
FT                   LFWLLVLGLPGIWAYKAINTADSMIGHREERWRAYGWAAARTDDAMNLIPARLSGLLIC
FT                   LCGGGGWRILWRDASRHASPNAGWPEAAMAGALGLRLAGPIAYDGILSDKLWIGEGDRP
FT                   ARTEDIWRGLGIYARACLCLWFMAAGIAGGAAWAL"
FT   gene            complement(350062..351045)
FT                   /locus_tag="Saro_0325"
FT   CDS_pept        complement(350062..351045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0325"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24773"
FT                   /db_xref="GOA:Q2GBK0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBK0"
FT                   /protein_id="ABD24773.1"
FT                   /translation="MNSFSFHGGRLADAMAQFGMGKAPWIDLSTGINPHGWPGADNLAV
FT                   DWQALPDTGALNDLEAAAAACFGTDPAHVCAVPGTEIGLRMLGDILPGAAIHAQPSYRT
FT                   HGEMIPRSRPVALTELTGTEEATIILANPNNPDGRIMSPATLLGWLAARRDSAAWLVVD
FT                   EAFADAAPHSSLAAHVQDGQRLIIFRSFGKFFGLAGVRLGFVLGPRALIAQYRQRLGSW
FT                   PLSAAALAIGTAAYQDVDWTAAMRMALREQADALDAVLARRGYSAIGACPLFRLIETDD
FT                   AAALFERLARHSILTRPFDYDPRWLRLGLPADRQALDRLDAALADD"
FT   gene            complement(351042..351782)
FT                   /locus_tag="Saro_0326"
FT   CDS_pept        complement(351042..351782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0326"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24774"
FT                   /db_xref="GOA:Q2GBJ9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBJ9"
FT                   /protein_id="ABD24774.1"
FT                   /translation="MRGFIIALQFLTRLPMPAPLRTIVVDDAAFARSMRWFPAVGLVIG
FT                   AAVAGAAWAGALVDHRLGALAALIVWVGVTGALHLDGLADLADASGAAHKDRERLLAVL
FT                   ADPHVGSFGVVAIVLQLLSKLVLLDMLVDARAFGALVLVPFAARIGPLVWTWWLMPLHQ
FT                   GLAARFRSAIGPIDLAGWAAALAAAAWFTPALLVTPLLVLWWGWHVRRALGGISGDGHG
FT                   AGIELIETGLLLSVAITGLWIHTT"
FT   gene            complement(351779..352348)
FT                   /locus_tag="Saro_0327"
FT   CDS_pept        complement(351779..352348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0327"
FT                   /product="phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24775"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ8"
FT                   /protein_id="ABD24775.1"
FT                   /translation="MSSFPLYLLRHGEPEGAGRLIGLTDAPPIAAGIAACADQARNLAA
FT                   EVLIASDLSRARLAGEAIALATGVPLSIDPRWRELDFGAWDGMAPGDVEGAALARFWDD
FT                   PDGHAPPGGERWSALVERVSSALGDLAARPTLIVTHGGAMRAALAVLCGFDMHQTWAVD
FT                   LPYNCLLTLRVWPGATPTAQIAGLYP"
FT   gene            complement(352345..353361)
FT                   /locus_tag="Saro_0328"
FT   CDS_pept        complement(352345..353361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0328"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24776"
FT                   /db_xref="GOA:Q2GBJ7"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBJ7"
FT                   /protein_id="ABD24776.1"
FT                   /translation="MSRFASLAAFEAALERLPVADADAITAARARQASLTKPAGSLGRL
FT                   EDIAVFMAGWQGTAQPVIEQGRAAIFAGNHGFVVHGVSAFPASVTAAMVGNFAAGGAAI
FT                   NALAGAAGLDLRVIALDLDRPTADFTIAAAMDETECLAALAAGAAVVEPGLHLLVVGEM
FT                   GIGNSTAAAALCARSYGGSPAQWAGPGTGVDAGGIARKVAVVERALAFHADAPDTPFEI
FT                   LRRLGGREIAGVAGAVLEARRLRIPVVLDGFISCAALAPLAAAVPAITDHCLAGHCSAE
FT                   PGHIRLLEHLGLDPLLSLGMRLGEGSGAALAVSVIRAALATHNGMATFAQAGVADGL"
FT   gene            complement(353358..353765)
FT                   /locus_tag="Saro_0329"
FT   CDS_pept        complement(353358..353765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0329"
FT                   /product="protein of unknown function DUF1636"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24777"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ6"
FT                   /protein_id="ABD24777.1"
FT                   /translation="MLIPVEDGPAIVACNTCRHSADAREDSAGTRGGAQLVAALRQVQE
FT                   SDARYAGVAVQEMPCLFACTDFCTIHLRAPGKVGYVLGRFTPDEDAATAILDYAVHYAA
FT                   SEHGRVPFKQWPQGVKGHFITRTPPQGFVAE"
FT   gene            complement(353791..354390)
FT                   /locus_tag="Saro_0330"
FT   CDS_pept        complement(353791..354390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0330"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24778"
FT                   /db_xref="GOA:Q2GBJ5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ5"
FT                   /protein_id="ABD24778.1"
FT                   /translation="MQLLRWRRDVRHFDRRAVGEADMRALLACASLAPSVGNAQPWRFV
FT                   RVRTPDIREALAAHADGQSAQAAERYAGQARHDHYLSLKLHGLREAPELMAVFCDELPE
FT                   AGHGLGIATMPEMLRYSCVLAIHNLWLAARLRGIGLGWVSIVDPPLVQAMLDVPAHWSL
FT                   IALLCIGYPADTSDTPELERHGWQPREPWSDRVFER"
FT   gene            complement(354453..355079)
FT                   /locus_tag="Saro_0331"
FT   CDS_pept        complement(354453..355079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0331"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24779"
FT                   /db_xref="GOA:Q2GBJ4"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ4"
FT                   /protein_id="ABD24779.1"
FT                   /translation="MEPENQVEVAGGDARHAEKMRKKQTAQAKIMASKTREQGLLIVHT
FT                   GKGKGKTSAALGMVVRAIGHGMKVGVVQFVKGAMKTGEKAVFDAFPDNVEFKPMGEGFT
FT                   WDTQDRTRDIAAARAGWDEVKRMIADPSYHMVLADELNIVLRYDYLPVDEVVAVLTARD
FT                   MMKHVIVTGRNAPEALIEAADLVTEMTMVKHPFRSGVKAQAGIEF"
FT   gene            complement(355069..355833)
FT                   /locus_tag="Saro_0332"
FT   CDS_pept        complement(355069..355833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0332"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24780"
FT                   /db_xref="GOA:Q2GBJ3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ3"
FT                   /protein_id="ABD24780.1"
FT                   /translation="MIDLHLIGIGTGNPDHLTAQAVAAMNRADLILLPRKGQAKSDLID
FT                   LRREICAQVLTGPTRIVEFDLPVRGNGATYLDDVNAWHDAIADAWRVQIAEHLPGGGKL
FT                   ALLVWGDPSLYDSTLRIADRLRSAGVEIAVRVVPGITSIQALTAAHAMPLNPLAGPVTI
FT                   TTGRLLRAHGWPAGADTIVVMLDSGCAFEGLQPQGITIWWGAYLGMAHEALEQGPLAQA
FT                   GPRIALRRAELRARHGWIMDVYLMRRELADGT"
FT   gene            complement(355830..357164)
FT                   /locus_tag="Saro_0333"
FT   CDS_pept        complement(355830..357164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0333"
FT                   /product="hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing) / cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.9"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24781"
FT                   /db_xref="GOA:Q2GBJ2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ2"
FT                   /protein_id="ABD24781.1"
FT                   /translation="MSARHQTPGLMIAAPASGTGKTTVMLGLLRALTEDGLAVQPFKSG
FT                   PDYIDPAFHRAASGRPSFNLDSWAMEDDLIAAIAAQAGGADMVLAEGSMGLFDGVASKG
FT                   ASGNGASADMARRMGWPIVLVLDVSGQAQSAAATALGFSSLDPGLPFAGVILNRVASPR
FT                   HERLVRKGMEAVGIPVLGALPRRGDLTLPERHLGLVQAVEHPDLDRAIAEFAAFLRAHV
FT                   DLDVIRLAAGAAPQADGGNLPAPPAQRIAMARDAAFSFVYPHLIEGWRRAGAEILPFSP
FT                   LADEAPAAHADLVWLPGGYPELHAGTIAAAATFLSGLRCHAQTRPVHGECGGYMVLGQG
FT                   LIDKSGERHRMAGLLGLVTSHAQRKMHLGYRHAELLVPVSRLAAGTRLRGHEFHYSTIA
FT                   EQSDAPLALVTDAEGAAVAESGSHRGHVTGSYFHMIAPASCRDAQ"
FT   gene            complement(357161..357946)
FT                   /locus_tag="Saro_0334"
FT   CDS_pept        complement(357161..357946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0334"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24782"
FT                   /db_xref="GOA:Q2GBJ1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ1"
FT                   /protein_id="ABD24782.1"
FT                   /translation="MTVHFIGAGPGAPDLLTLRGRDLIAGSPVCLYAGSLIPVAVLDHC
FT                   PPGARIVNTAPLELDQIMAEIAAAHAAGHDVARLHSGDLSVWSAMGEQLRRLRALDIPF
FT                   TITPGVPAFAAAAAALEAELTLPALAQSLVLTRTPGRASTMPPAESLANFAVTGATLAI
FT                   HLSVHNLAQVVADLTPAYGADCPVAVVWRASWPDQRIVRATLDTIEQAIAGSMERTALI
FT                   LVGRVLAAQDFAESSLYAPGYDRRFRPQDATSRFGGAAE"
FT   gene            complement(357943..358323)
FT                   /locus_tag="Saro_0335"
FT   CDS_pept        complement(357943..358323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0335"
FT                   /product="precorrin methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24783"
FT                   /db_xref="GOA:Q2GBJ0"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBJ0"
FT                   /protein_id="ABD24783.1"
FT                   /translation="MIIAGFGFRSGVGLPSLRAAFALAEQGQPPVTHLATAQDKLAALL
FT                   PLAEALGLPLMGVASDALAAVSTPTRSIASLNARHVGSVAEASALAAAGAGARLLSPRH
FT                   ISPDRMATCAIAASVNLQGTPT"
FT   gene            complement(358320..359519)
FT                   /locus_tag="Saro_0336"
FT   CDS_pept        complement(358320..359519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0336"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24784"
FT                   /db_xref="GOA:Q2GBI9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI9"
FT                   /protein_id="ABD24784.1"
FT                   /translation="MAPEAWLTIIGIGEDGPDGLSAAARTALAQAGLVMGPARHLSLLP
FT                   AITCTMIEWPVPFADGIALLMQHRGQRVVMLASGDPFWFGAGSSVARLLDPGEWVAIPA
FT                   PSTFTLAVARLGWPVQDVACLGLHAAPLDRLKPHLAPGRRVIALLRDGAAVAALADYLT
FT                   GQGFGASALHVMEALGGPRERVRTARAEGLSFTDIAHPVAAGIECAGHGPSLPLTAGRP
FT                   DHWFASDGQLTKRPVRALTLSALAPCAGELLWDIGAGSGSIGIEWLLAHLANRACAIEA
FT                   DPVRADRVRANAAALGVDRLKVVVGIAPDALPPGPLPDAVFIGGGLSEALLDTLWARLP
FT                   AGTRLVTNAVTLESEALLARWHGQKGGSLLRIELADAAPLGNRHGWRARYPVVQWSVTL
FT                   "
FT   gene            359527..360288
FT                   /locus_tag="Saro_0337"
FT   CDS_pept        359527..360288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0337"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24785"
FT                   /db_xref="GOA:Q2GBI8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI8"
FT                   /protein_id="ABD24785.1"
FT                   /translation="MPNVLLLGGTTEASALARLLGARGIATTLSYAGRTENPRAQPVPV
FT                   RVGGFGGVAGLADYLRHHRVTHLVDATHPFAATMSSHAVEAARLAGVPHVALTRRAWQP
FT                   VAGDRWTRVASIDGAVAALAGHSRRVMLALGRMHVAAFAAQPQHHYLLRFVDAPDQPPG
FT                   LPHHTLIVDRGPFTATGDSALMEAHAIDLVVCKNAGGQGAEAKLIAARDLGLPVLMIDR
FT                   PAVPGRAECYRPEDVLVWLGHDAEPKAERDV"
FT   gene            complement(360252..361040)
FT                   /locus_tag="Saro_0338"
FT   CDS_pept        complement(360252..361040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0338"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24786"
FT                   /db_xref="GOA:Q2GBI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI7"
FT                   /protein_id="ABD24786.1"
FT                   /translation="MSAGAMSGWLAIAGLGPGDEALITPEVTAALAGASDVIGYIPYVA
FT                   RIAPRAGLTLHPSDNRVELDRAAHALELAAQGRRVVVVSSGDPGVFAMAAAVFEALEAG
FT                   PAHWRDLDIRVLPGITAMLAASARAGAPLGHDFCAINLSDNLKPWNLIEKRLRLAAEAD
FT                   FAMAFYNPRSKARPEGFERVLELLREVCGPDRPILFARAVSTPDEQLRIVPLGQARADM
FT                   ADMRTMVIVGSSLTRIIERTSGRKLGPILYTSRSALGSAS"
FT   gene            complement(361037..361774)
FT                   /locus_tag="Saro_0339"
FT   CDS_pept        complement(361037..361774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0339"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24787"
FT                   /db_xref="GOA:Q2GBI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI6"
FT                   /protein_id="ABD24787.1"
FT                   /translation="MSAALSCGTIHGVGLGPGAPDLLSVRSDRLVRGARHVAYFRKAGR
FT                   PGQARRIVEGMLRPDVIEIPMEYPVTTEIPLSDPRYNDCLSAFYAECTQRLVMLAQAGE
FT                   DVVVLCEGDPFFYGSFMHLHTRLAGTVPVAVVPGITGMAGAWNATGIPITWGDDVLTIA
FT                   MATLPEDELVRRIRDTDALVVMKIGRNLPKLRRAVAAAGREDAAWLVEHAAMPGQRVTR
FT                   LIEAETVTPYFSILLIHGQGRRP"
FT   gene            complement(361771..362400)
FT                   /locus_tag="Saro_0340"
FT   CDS_pept        complement(361771..362400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0340"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24788"
FT                   /db_xref="GOA:Q2GBI5"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI5"
FT                   /protein_id="ABD24788.1"
FT                   /translation="MPHIYETDGAAIYRQSFAMIRAEADLAPFFADEEPVAVRMIHAAG
FT                   MVDLAAHIRFSPGFASAARAALAAGAPVLCDARMVSEGITRARLPADNQIICTLNAPQV
FT                   PDMARAMGNTRSAAALELWRPHLAGAVVAIGNAPTALFHLLNMLEDPDCPRPAAVIGCP
FT                   VGFVGAAESKAALWAAPPVPCCIVEGRLGGSAITVAAINALASGTE"
FT   gene            complement(362400..363545)
FT                   /locus_tag="Saro_0341"
FT   CDS_pept        complement(362400..363545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0341"
FT                   /product="Precorrin-3B synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24789"
FT                   /db_xref="GOA:Q2GBI4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI4"
FT                   /protein_id="ABD24789.1"
FT                   /translation="MSSFAVKGWCPDAWHPMMAGDGLLVRVKPRLGRLTRAQVLGLCDA
FT                   AVVHGNGLIDMTARANLQLRGVPETGWQALLDRLLVLDLVDPDPVIEQRRNILVAPDWR
FT                   VGDDSHRIAGALLTRLDELPDLLGKVGFAIDAGQTCILGGEAGDFRIERGGDGGLILRA
FT                   DGRATGMAVAAGREVDALIALAHWFAASGGAKAGRMARHRLVLPEWACGDILPAPSAAC
FT                   IVPGLHDLGLRDGSWAYGLPFGRIEARILAGMVEASPAAAVRITPWRVLLVEGAPAVCA
FT                   GGLIDNPADPLLHVDACPGAPCCPQASVETRDLARRLAPHVAGRLHVSGCAKGCARQRA
FT                   ADVTLTGRDGLFDLSLNAPAGALPVRSALSPAELLAHFGAA"
FT   gene            complement(363542..366826)
FT                   /locus_tag="Saro_0342"
FT   CDS_pept        complement(363542..366826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0342"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24790"
FT                   /db_xref="GOA:Q2GBI3"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI3"
FT                   /protein_id="ABD24790.1"
FT                   /translation="MHVIFRETHGMEETAVPQDLGQEPADLVVLSFSDSDLGAFAAAWH
FT                   QARADDATFPSLRLANLAALMHPLSVDTYAERTLSGAKAILIRLIGGTPYWSYGLQQVE
FT                   ALARSRGIVLAVLPGDGFEDARLDAASTVPVTALRELAQWCDAGGARAAQAALAALSQL
FT                   AGLIDAPARTFDPLLMAGGWHPGRGVIDLEAFARDPARPLVLIVFYRSYLTAHDLDPFA
FT                   ALHTAFEQRGFDALSIFVPSLKAPQVREQVDRWVRGLGPAAIINATAFSARGDDGATPL
FT                   DGAGVPVFQLALATSGRAGWAAASRGLSPADLAMHVVLPEIDGRVFAGVASFKEAGTRD
FT                   PALGFARTIHRADAGRVGAITARVAGWIALAQTPVAERRVALVLSTYPGKTYQMAHAVG
FT                   LDALASAEAILADLAEAGYATDAQAGLAALLQCTHQHWPMAEYRKALAALPDTLRAELF
FT                   AAWGEPEADAAAADGAFRFAALPIGNALVALQPERGERAHRDGDYHDLSRCPRHGYVAF
FT                   YLWLRQRSVDALVHIGAHGTLEWLPGKSVALSDACWPEALTGAMPVIYPFIVNDPGEAA
FT                   QAKRRISAVTIGHVPPPLVQTQSGAGLARIEALLDEFSNAGGLDPARRDRLQVNIRDEA
FT                   RVLGLEAELGLDDAATLVEAITRIDRFVCDVKDSQFGDGLHVFGRGDQGAAERAGLLAA
FT                   LDGRRVPPGPSGSPFRGRSDVLPTGRNLYAIDPRAVPSRAAHAQGVTLAEELIRRHLQD
FT                   HGDYPRGLVVDLWGSATMRTAGEEFAMALHLLGAKPLWDTASERVTGIEILPLALLDRP
FT                   RIDVTLRISGLFRDAFPALPILFGQAVRALCLRDEPADWNPFAGQAAAPRVYGPAPGSY
FT                   GLGLGDAAEVYTEAARRAAGEAWLAASDHAFDAASDAIGTFADPAGLRQRVEGADAFVH
FT                   LQDLPETDLLLAADYAAHEAGFAAAKALIGGSAALYHLDNRDPGRTVARTLTEEIARVV
FT                   RARAAHPGWVAGMMRHGFRGGAELAATLDHMGAFAHLSGSVPPHLFDLYHDATLGQTDV
FT                   RAFLERENPAALAAMEARFAALHAAGLWQTRRNSILASLPRLEDRA"
FT   gene            complement(366837..367889)
FT                   /locus_tag="Saro_0343"
FT   CDS_pept        complement(366837..367889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0343"
FT                   /product="Cobalamin biosynthesis CobW"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24791"
FT                   /db_xref="GOA:Q2GBI2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI2"
FT                   /protein_id="ABD24791.1"
FT                   /translation="MPDLSKASLSKVPVTIITGFLGAGKTTLISHLIHNAGGRRLAVVV
FT                   NEFGSLGVDGEILQSCAIPDCPAENIVELANGCICCTVADDFIPTVEKLLALDPRPDHI
FT                   LIETSGLALPKPLLKAFDWPAIRSRITVDGVLALADAEAVAAGRFAPDVAALDAQRAAD
FT                   PSIDHETPLSEVFEDQLACADMILLTKVDLAGPQGVAAARAIIAAELSRPVPVIELTEG
FT                   VVDPRVILGLDAAAEDDIAARPSHHDGEDDHEHDDFDSTVIEWGEIADPAALVARIETL
FT                   ARDHHILRVKGYAAVAGKPMRLLVQAVGARVRHQYDRPWRPDEPRRTTLVAIAEHDHVD
FT                   ADAIRAVLLA"
FT   gene            complement(368386..369501)
FT                   /locus_tag="Saro_0344"
FT   CDS_pept        complement(368386..369501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0344"
FT                   /product="high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24792"
FT                   /db_xref="GOA:Q2GBI1"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI1"
FT                   /protein_id="ABD24792.1"
FT                   /translation="MGGAAARLRRHPSFVYSSIAEPIMHLTKSLPSLSLRRRIGALFAG
FT                   LIAANIGVWVWAFSLFHAQPLMLGTAVLAWGLGLRHAVDADHIAAIDNVTRKLMQDGQR
FT                   PVSVGFWFAIGHSGIIAIASIIIAVTASALSQFGAFKEIGGVIATVISALFLFTIAGMN
FT                   LVILRSVWRTFAHVRAGGSYAEDDLDLLLGGRGLLSRLFRPMFRLVNKSWHMAPLGFLF
FT                   GLGFDTATEVAILGMSASQAADGLSIGTILVLPALFAVGMALIDTADGVVMLGAYEWAF
FT                   VKPIRKLYYNITITLISAIVAIVIGGIETLALIGDKLALTGAPWRIAIELGENFNGLGF
FT                   AIIGLFVFCWLASYAIYRWKRFDEIEVSVGA"
FT   gene            complement(369514..371550)
FT                   /locus_tag="Saro_0345"
FT   CDS_pept        complement(369514..371550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0345"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24793"
FT                   /db_xref="GOA:Q2GBI0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBI0"
FT                   /protein_id="ABD24793.1"
FT                   /translation="MIKTITTSSALALICIGKPAFAETSEKASQTSADAVVAGNDIVVF
FT                   GRGEAMIGTAKSASEGSVGGADLLVRPLLRVAELLEAVPGLVAAQHSGSGKANQYFLRG
FT                   FNLDHGSDFSTYIDDVQMNFRTHGHGHGYLDLNGLIPEIVGREDFRKGPYRADGGDFAL
FT                   AGAAYMTTIKGYDRPWASAETGSYGWRRVAAGGTLHDLGGGDLTLVAQAKAYDGPWQEP
FT                   ERLRHYSGFAKYSMPTGAGTLEASLHAYRATWHPTEQIPERIIGTALCADVFCSPDPSA
FT                   RGETTRLVANIAVKQPTWRANVYAQFYDWSMFSNPTYTDPDGTSAQIKQFDRRWVLGLS
FT                   AQKHWEIADSLAVSLGTENRYDAVGNVGVDRTAARAFLESLGHFRVGELSSALYGEVAW
FT                   KPLAGLRVTGGLRGDYYHYSVRARDSVAASLGEGSGSASILSPKASIAYQVTPHLELYA
FT                   NWGRGFHSNDVRGAVNRDTPVPVLVRGIGKELGGRIQFSGVTLTATYWWLHVGSELRFI
FT                   GDSNAVEPSGASGRHGYEIVAFWRPFPWLALDGNYTASHARFDNGDHIPNAFENAASAG
FT                   AAIILDPWEASIRVRHLGPSPLVEDNSVRDRGSTVMNARAAWKGKKVEIFGEVLNIFDS
FT                   RDKDIAYYYESYIPAFDAGAPVEGRLSRVVEPRTVRIGAKVNF"
FT   sig_peptide     complement(371482..371550)
FT                   /locus_tag="Saro_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            372308..373762
FT                   /locus_tag="Saro_0346"
FT   CDS_pept        372308..373762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24794"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH9"
FT                   /protein_id="ABD24794.1"
FT                   /translation="MSEPEDASDPQTNQNEPQSERDVDESLPARDILKIGSMVKALGAQ
FT                   QSKFDAVTRLAQVGAHAQLSTSAQMLALSDKVSALTNIGATSRLARMLEETNRHSRHLQ
FT                   DMTSTARLLAQSGKLAQYSKLAALASGYPGSTLPNWAILNDHSNIDQLMRSQRWADHFS
FT                   ADSFGYATGRAGRFATGGLVSEQLRLVAERAAGIRVAAGIGALQVSPGVKAMLARNVRI
FT                   GETLSKLSAFAGAIDTIGAFSPASSAAVDSLLGEWQTRPDLPEEFWHRRSVRQRYYEEA
FT                   EVDRGLIDTRNTEIVEVLVESGLVEGYVRGKRVTAVLEAGPLSVEVSASRTRIGTYRAI
FT                   TGFEIAMRGLVRRVLVQAQIDAGENPDAWFKQRVPGDILQRAKERKADAERVGEQAADL
FT                   IAFVDLGDLIPIVTLKKNWPVFQPIFGNAEDFRVDMRRLNAIRRPAMHSRSIDPVQFTE
FT                   MVIVIDRISSMIRGSFGWMAEWDEEG"
FT   gene            complement(373704..374039)
FT                   /locus_tag="Saro_0347"
FT   CDS_pept        complement(373704..374039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24795"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH8"
FT                   /protein_id="ABD24795.1"
FT                   /translation="MSCRLCIAFPQPDEPAVWHGCPAATRVLLYKALMAALPDKSRRPG
FT                   VGDYAVASVGFPKDDMWFIDYLKAIFPAIETQREDLNLIRRPAGRPTVSPLRPTRPSSQ
FT                   SCPVSWS"
FT   gene            374343..375047
FT                   /locus_tag="Saro_0348"
FT   CDS_pept        374343..375047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24796"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH7"
FT                   /protein_id="ABD24796.1"
FT                   /translation="MMPVKDPLHPDRLKNKQRALRDGFALPLTLRVHRALSWLLRAQRE
FT                   EDDFDTRFIMLWIGFNAAYAGDLERALDDEGDGRRPGAASERERFDGFFRDLVRLDTDG
FT                   RLYKALWTRFPQEIRILLDNRFVFAPFWKHHAGLPGGAGWEITFEAAKRAANAALAAGN
FT                   TPVVLSILFDRLYVLRNQLLHGGATWNSAANRAQVRDGAAILGHLLPLFIDLMMDNPDE
FT                   DWAMPLYPVIEE"
FT   gene            375088..376569
FT                   /locus_tag="Saro_0349"
FT   CDS_pept        375088..376569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24797"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH6"
FT                   /protein_id="ABD24797.1"
FT                   /translation="MTQIRTATRRFGLSKSKITAFEQCPKKLWLATHRPELAEQDDGAE
FT                   ARFATGNAVGEIACALHPDGVMVDPPSLSEALAKTSSLISEGHPGPIFEATFEHDGVLV
FT                   RVDVLERLDSGGWSAAEVKSSGRVKDYHRGDLATQVWVMREAGINLQRAAIRHIDTSFV
FT                   LSREGDYAGLFTDADLLADLEDAIATRPSLVAEARATLSGDEPQREMGDHCGAPFSCEF
FT                   TAYCGRDLPQGPEWPVTLLPYGGGRRWLERGVEDLLDLAETDLNDRHARILAATRDGIP
FT                   FHDAAGARKVMAGWGWPRAWLDFETVAPAIPRWVGTRPFQQIPFQFSLHLERRGGRMTH
FT                   HEFLSCDGSDPRRACAEALVSNIPEGATIIAYNAAFERSVLRELAASFPDLSSRLEAMA
FT                   EATVDLLPVARNHWYHRDQRGSWSIKAVLPTIAAELDYGVLEVKDGGDAQAAWFEAADP
FT                   ACDPLRREALEEALKAYCARDTWAMVAVARALAGS"
FT   gene            376858..378921
FT                   /locus_tag="Saro_0350"
FT   CDS_pept        376858..378921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0350"
FT                   /product="McrBC 5-methylcytosine restriction system
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24798"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH5"
FT                   /protein_id="ABD24798.1"
FT                   /translation="MLAEMAYSRADEAAGASNPSAIDLSGSFYANLSACRAAARAYFRF
FT                   CNSEARPQGRFGELDREAVLEAVAACDAVGDVAQYVADLDLGQPTRYWLVLDGKRYPSK
FT                   AVVRDALARRGSDWLPGGGECKTALERLGFVVIDWPELNRARDAFLRQMPDFSDFRAAA
FT                   GAYWDVERAYKNGLIEQAKAIIARQDDDRAVGESLYRLLSVGGSGLPLSWRTLSEVQNA
FT                   DPELRDRFYTSLGVLARSDGPLEEAVPAAARELEALREAGIAGLRRGEVLSIPITVWAT
FT                   LHPDQASWFKIAKIDEMGRRLFGRRLFPQTEFRDADLAEWLQLMRALLGLLDKEFGWHP
FT                   HDLFDVQGFIWVVGNPDSPRELDPVPVWMVTSLWGQEDGLPRFVERAEWSLLTDTGSAN
FT                   NRRVREMQVGDRIFLKDFVPRARDLPFDAGTGIMAAATVFLARHTRSLATRRTLDELRH
FT                   ALADIPLMPITRLPWQAVRIDRTNRRWEALFRLARLLLQRDWQATHHHAKAPDGLTLLF
FT                   PMNDLFEKYIAVLLRRALAGSGIEVIDQGGHRACLGSFTGGHLETGEVFRTKPDIMLRR
FT                   GREIVAIIDTKWKKLSLDPLDRKHGVSQADVYQLMAYARLYQTAELMLLYPARPGQVCA
FT                   ERAQFGMAGGSERLRIAMADVSLDEKALAEALGVLVMAPAVTKASPLPQAVG"
FT   gene            378931..379908
FT                   /locus_tag="Saro_0351"
FT   CDS_pept        378931..379908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24799"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH4"
FT                   /protein_id="ABD24799.1"
FT                   /translation="MARNAKLDRLLTLVKALGESAEGLTLDEMAEVIGANRRTAERLRD
FT                   LILVHFDLEEGVDDRHKRFRIPGTLPSPFIQPNVAEIAALKSLADTAHKAGSAQAPLLE
FT                   SLVGKVQAGLRREVKSRMAPDLEPLVRLQRHHVPAGPMIEHAPETVAQVQGAMMAGMCL
FT                   EFDYLADGAAEPKWRRVIPVGLIHGPATYLIGKIPGRDLEPAPYRLDRIIAARVSNQPG
FT                   AAGEDWDLDQWMSASFGIWREEGYEIVLRVAHESAERARKWRFHPQQMIEQDGEELIVR
FT                   FHSGGLREIAEHLFTWGGEVRIEGPEELREMMRERLSAAGRAVV"
FT   gene            379978..385092
FT                   /locus_tag="Saro_0352"
FT   CDS_pept        379978..385092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0352"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24800"
FT                   /db_xref="GOA:Q2GBH3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH3"
FT                   /protein_id="ABD24800.1"
FT                   /translation="MNVFELDADLIARYEKFARSFTSIRAEDLRGQIDAVYEGGKFWPE
FT                   PLIGLNPEFKRGRSVADLARQGVVDPDLETVFALGTPRTPISLHLHQEQALMKALQSRN
FT                   YIVTTGTGSGKSLCFFVPIINRILAARRAGEPRRTRAIVIYPMNALANSQREELEKFIE
FT                   HCGLDSSLKPTFARYTGQEQDSERKAVAANAPDIILTNFMMLELLMTRQDEVDRQVIEN
FT                   MKGLEFLVLDELHTYRGRQGADVAMLVRRVRERMGSEKMLCVGTSATMASGEEDAGRDA
FT                   VSKVGSILFGSPVLSEDVITESLVRRTEGTPSDAALRAAVLEPSKPATFEEFALDPLAC
FT                   WIEMNIGLDGGEVLKRATPRTLTEAADSLAQATQLEPAECRSALADRLIAMNECRNDRD
FT                   QAFMAFKLHRFLSGAGTAHTTLAPSGSRRVSLVGEKFDREETEARLYPVYFCRDCGQEV
FT                   HSVSIDNWGSVIARPIDVAPRPDGTDGDIEHGFLVPDSSGDLNFAGDVEDYPDSWQETS
FT                   ATGQLRLKNSHRGKHDGRRMYLGRDGRHDPEGLLCWFFPGQFRFCPHCKSQPAPQARDI
FT                   NKLAGLSAEGRSSATTLITTAALDWMERAGQPVEIHRRKLLGFTDNRQDAALQSGHFND
FT                   FIFVTLLRGAMLQAVRSAGEDGLSHEEFGNALRKALGFDPDLRERRTEWMLDPEPVSFS
FT                   AIDEAKKSINRVLAHRLWNDLRRGWRFTNPNLDQLDLIKIVYPGIRMLAGDQATCSGAH
FT                   RERMSETEERGFSILSQVPADKREKMFRQLFDHMRQGLAIAVDALDPNELEAVSIKSRQ
FT                   FLKDPWAISQEEQNHDLSAQTALVVGTQGSKNDRIVRVSARGGLARAIVAEVGDLPLAD
FT                   REPLIEAMLLAAARHQMAREFAAGPLLGWRLAPGALRIVPGDGRPKKGQDNRFFAELYS
FT                   DVAVRLAAPGGLPLAFEAREHTAQVDSLLREMRECRFRFGNSDKQRMAEIANDAKVIAE
FT                   KRDFLPLLYCSPTMELGVDISQLNVVYLRNAPPTPANYAQRAGRAGRSGQAALVVTYCA
FT                   AQSPHDQYYFERRTDLVAGIVKAPAIDLVNPDLLASHVNAEWLAAAQEGLGKSIPENLD
FT                   MDDEALPVCSRLIAAFETATSDIEARERAVRIVGSALPAEGSPVIGSPEVFVTARWDNA
FT                   GHAIDLAFKRWRTLYRSANEERREASAIADRPGLSAQERKDARSRYVAADKQVELLAKG
FT                   VSSASSDFYAYRYLATEGFLPGYNFPRLPLYAFVDSDRGSAVLQRPRFLAIAEFGPNSL
FT                   VYHEGKAFSCNRAKLPAGTRGNDNKLVTTTMRCCHACGAAHSSETIERCVVCHEPLTEE
FT                   GRLSKLYRIENVDASPRSRITANDEDRQRRGFDLRTIFEWDPARQESLLLKTSDGPLVA
FT                   LRYGPQTKLSRVNLGLRRRAHKEHTGFDIDTISGRWLKNEAQGEDEGHVDNSAKRQSIV
FT                   PVVEDTKNALLLKFDPLIELDNSQMATLQHALVRAIETEHVLEAGELLGEPLPTKDDRR
FT                   AILFYEASEGGAGVLKRLMDGPERWRRLAEVALDLMHYRLEDGRLVEKEDACVAGCYRC
FT                   VLSYYNQPDHEMIDRRDDAVLDALVGLAACERDWPAAGPAGADPQSDPWLAAFASWGFP
FT                   APSSETIAGLEYAMVWPGHMVMAVAQSPSEALRDRCAELGRELIALPDEPGTNPPSDLA
FT                   NALGVSA"
FT   gene            385089..387890
FT                   /locus_tag="Saro_0353"
FT   CDS_pept        385089..387890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0353"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24801"
FT                   /db_xref="GOA:Q2GBH2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH2"
FT                   /protein_id="ABD24801.1"
FT                   /translation="MTSVSVAPGQLQIGDLVHARGREWIVLAKPSDGLLRVRPLSGSED
FT                   DAILIAPKLERQPVHEASFALPNSDQLDTQDAARLLTDALRLSLRRGAGPFRSAAHLGV
FT                   EPRAYQLVPLLMALRLEVKRMLIADDVGIGKTIEAGMILREMLDRGEIDSFTVLCPPHL
FT                   VDQWVGELAQKFDIDSVAVTSARARSLEQGIALGDTIFGVHPFTVVSLDYIKADSRREG
FT                   FAQACPKFVIVDEAHSCVGGSEKGTQQRFSLLQRLVEDEARHMLLLTATPHSGNQDAYA
FT                   RLLSLLHPDLLRAPDTLDANALERYRRRLAQHFVQRRRPDIADQWGEGRSFAEPMKADA
FT                   PYSLTGDFQAFQEDVLEYCLGVATRADGAQARRLAFWGTLALMRCVGSSPAAALSALRN
FT                   RLSGMAEEALLGPILFDDDDDEFADTDIEPATAGDSEEIAELRQLISKAEGLNSRFADD
FT                   PKFRELVAQVKDLTGKKEARPVIFCRFIATAEAVGEALRSRFKSHTVEVVTGRLTPEER
FT                   RERVEALEDHPNRILVATDCLSEGINLQSLFNAVVHYDLNWNPTRHQQRDGRVDRFGQQ
FT                   AERVWSVMMFGANSIIDGAVIKVITEKMKRIQKETGVVVPVPEDSSSVSNALMQAMLLH
FT                   SSKPRAQGMFDFGDAEAKLETQWRNAQENAHKSQTRYAQTALKPEEVLPEWHKLRDLLG
FT                   GPDEVERFTRRALARLDVPLGQQGLHWRVRYDDMPQQLREKLAARGLRGTRIIGFRDKL
FT                   PPDVAQVGRTHPLVATLAGTMAEGALDPNGVEGKATLGRTGVWMTRGVDKLTVLLALRL
FT                   RFKLVTSGRRTLLAEEATGIAFGPQSNQPIAMGAEALALLEHEATRSIEPPANQRQIDL
FT                   ALARHADFQPAIAAYAAQRAAALSHDHERVKAATRGEGITTTVEPVLPADIIGLYVLVP
FT                   EAN"
FT   gene            387890..391849
FT                   /locus_tag="Saro_0354"
FT   CDS_pept        387890..391849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0354"
FT                   /product="putative type II DNA modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24802"
FT                   /db_xref="GOA:Q2GBH1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH1"
FT                   /protein_id="ABD24802.1"
FT                   /translation="MARRSSSTELGLVALTIEGGLIAPEQVQKVIAADRTPKTADSYSC
FT                   PKGTSLGDEIARFFRIGQAIWRDYDQADAKTIARTAAFARDLLTQCLGFTDIAGPVEHR
FT                   EGTRRYRIAWESKGGRVPVVVAAPVEGSDAFAKSQPEFGDGEGGRPRRSPAALLQDWLN
FT                   GTDHALWGLVFAGDRVRIMRDNASLTRPAWIEADLGAMFRDEMFADFTAFWLLAHATRF
FT                   GAEGAATSDCPLEQWREAGLKQGVEARKDLYANVATALEELGQGIVTANPDLRDQLASG
FT                   ALSMQALFEELLRTVYRLIFLAVAEDRDLLHPRRTPREARQLYAQGYSFTFWRERSRRR
FT                   VARDSHHDAWEAMKVTLAALEHGEDMLGLPALGGLFAASSTPHLGAATIPNRAFLAALF
FT                   CLGFIRKDGITHRINWRDLKTEELGSVYEGLLEIRPSLTASGDFQLGTGAKGNDRKTSG
FT                   SYYTPDSLVECLLDSALNPVLERAEASGVTPEEKVAAILDLKVIDPACGSGHFLLGAAR
FT                   RMADRVARLRNEDAGKEETQAALRDVVSRCIHGVDRNPMAVELAKVALWIESVSPGQPL
FT                   GFLDANIRCGDALLGVFDLAVLEEGIPDEAYKPLTGDSKDAAKFYLKLNRDAKKGQGAF
FT                   DFAGGGGVLPAKPIAAGLGRIKSMPEDTVGQVEKKRQAFEAWKADPARYGTEVACDLYM
FT                   AAFLMPKTEVPLNYQRAMVPTTGDVRQKLAGGNVYGPLEGAAREVAGAASVLHWPLEFP
FT                   DVMVGKGGFDVVLGNPPWEVVQLGEEEYFQSRAPEIAELKGATRKKAIAALEQERPELF
FT                   AEFARDKRMFEGMNEFARAGGRFDLTARGKVNTYGLFAEHFLSLTRDGGGAGLIVPTGI
FT                   ATDATTAPFFAYLVSGQRLAGLIDFENSAPLFAGVHRSFKFSLLTIGSGVAKADFSFFL
FT                   TDPAQLEQAERRFTLSPAQIARINPNTKTAPAFRSRSDAELTAAIYDRVPVLIDETRGD
FT                   NGNLWDIEFRQGLFNMTSDSGLFRTAAQLEADEFDREGTDWVSRPTLTGRDERYVPLYE
FT                   AKMAHFYDHRSSGYGTRDGERGHRVLPETTPEEHSDPCFEIEPHYWVPAAAVDEALLGR
FT                   DAKWLFGFKNVTSPTNERTMICSPIPRVGVGHSMPLISKKNGWGRQGAAFVSCLSSLVF
FT                   DYVARQKVGGVNFTYFFLKQIPVIPPTAYDEAALAFIVPRVLELTYTSHSMAPFARDLG
FT                   YEGPPFAWDEDRRAHLRAELDAWYALAYGLTRDELRYVLDPKDVMGEDYPSETFRVLQN
FT                   NEMKKYGEYRTRRLVLAAYDELLGQGLRPKVEGYR"
FT   gene            391849..392592
FT                   /locus_tag="Saro_0355"
FT   CDS_pept        391849..392592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24803"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBH0"
FT                   /protein_id="ABD24803.1"
FT                   /translation="MAADWRALSGRQSASIDQRWFEVVNRSRAGAIEAIRSGIPDVRPR
FT                   PWHEDRSGLETIFGLTAATHCFDEPPHSWAHLLEPQITRAFVHFLNEGDGQRRSARCLS
FT                   FVRAALACSPRSRPIPQGWQPTGAVAEAEENRIDILVELTDGHRRFGAAIEAKFGHKLT
FT                   SGQLEKAEDHVTDRKGRHWDAARSAFLVIAPLTQRIDRKLLARRPNWRAASWWAFLNRL
FT                   EREIGQSDDCRDYRRFRRTVWYRSY"
FT   gene            392607..393173
FT                   /locus_tag="Saro_0356"
FT   CDS_pept        392607..393173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG9"
FT                   /protein_id="ABD24804.1"
FT                   /translation="MVDIPAGLLAYFSDSKTEAAVDLLLAKQRPDVPDDVSWSDVPAYF
FT                   RALRAARQIEVDYAILLHEIWSAVWKALPKPWVAKEPHEQVDDALLEPRRILGQNYALR
FT                   AFERDKLRCELLVYGHKESGIQIGFNVFQGRASKLPRAVADWENDDGTYWSPANLVKLK
FT                   RTIDLNPLRTYARDATNVIKSLDRD"
FT   gene            393322..394233
FT                   /locus_tag="Saro_0357"
FT   CDS_pept        393322..394233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0357"
FT                   /product="Abi-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24805"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG8"
FT                   /protein_id="ABD24805.1"
FT                   /translation="MTDSFAKPALTIDQQIAHLRGKGMAIEDEARARYWLTHVSYYRLS
FT                   AYWLYFEHPKGQNGPRFRSGTSFDSVTALYDFDRVLRRLVMRGTEHVEVALRGNWAYQL
FT                   ALLGDGHSYLDASLYSDRKEFHANLAKLAGEVGWSSETYIKHYRENYHDPALPPVWMVA
FT                   EMMSFGQLSRWYSNLAERALRNRIAQPLGLPETVLVPLVRHIVDVRNICAHHGRLWNRG
FT                   FRMPPKLAQKPDPLMRTLDQKATQAPARLYNGLCMIAHVVRTVAPASTWMLDLGAHLRT
FT                   HPTNDLAAMGFPADWQTRPLWQ"
FT   gene            394230..395027
FT                   /locus_tag="Saro_0358"
FT   CDS_pept        394230..395027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0358"
FT                   /product="putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24806"
FT                   /db_xref="GOA:Q2GBG7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG7"
FT                   /protein_id="ABD24806.1"
FT                   /translation="MTGLLSLRHTTAHPIFRVELDQAAYNHGFRKANGVADGWLWFKSD
FT                   EGVPGEVALASGINPDGSPWFLAVEHAGVAAKLGVELAEAVVNPPAHFKGAFAFATQAQ
FT                   LRAALSRAFHLARSLPTFPLAQYEAEVAELGNTEVERIVKERVGQGYFRRALLDYWTGR
FT                   CPITGISDEPLLRASHIVPWSECRSDSERLDVFNGLLLAAHWDAAFDRGLVSFDNEGRA
FT                   LIKPTLSEEALNLLAPDRARLLPLDDAHRRQLAWHRERFGFSE"
FT   gene            complement(395159..396898)
FT                   /locus_tag="Saro_0359"
FT   CDS_pept        complement(395159..396898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24807"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG6"
FT                   /protein_id="ABD24807.1"
FT                   /translation="MDDDFEIRPGRSRDQGMPASRKATSLVGQVLKASRRSGATPLARR
FT                   SGKPAGTGRYGRGRAAALRARRSPYQRRVVIKARVVRHKGARFRAAPLAMHVSYLERDG
FT                   VTRDQERGQLFDAGVDNADGEAFAQRCADDRHHFRFIVSPEDATELADLRTFTRELMDD
FT                   MARDLGTRLVWVAVDHWNTDNPHVHVLVRGRAADGADLVIDRDYIREGMRSRAEERVTI
FT                   ELGPRSERDIQRAMAREVSAERWTGLDRQLRTLQDHDQVIDLRPAADQDRRRHALLVGR
FT                   VNSLARMGLASETQPGRWTMRADAEKTLRDLEIRGDVIKTIHRSMAENGWRSDLSRLAI
FT                   HDQQPSDPIIGRLASRGLHDELSGKAYAVVDGMDGRTHHLRFNDLEATSDARPGAIVEL
FT                   RHWTDRKGQGHAALTVRSDLGLAEQVTAKGATWLDQQLVAKEPTAHGPGFGREVEEALQ
FT                   QRSEHLADDGLATRQGRRFLFARGLLETLRQGEMAEAANRLSRQTGLELQASGPGEHVA
FT                   GIYRQRVDLASGRFAMIDNGLGFQLVPWQPVLERKLGQAVAGAVDQRGGVDWSFARSRS
FT                   ISL"
FT   gene            complement(397143..397844)
FT                   /locus_tag="Saro_0360"
FT   CDS_pept        complement(397143..397844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0360"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24808"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG5"
FT                   /protein_id="ABD24808.1"
FT                   /translation="MSLRRPFRALCCALALLAAEPALPQPVAQQAEQQRVDIAAHITEA
FT                   SQRFGIPDHWIYAVMRVESAGRIGAVSSAGAMGLMQLMPGTWARQRVRFGLGADPFDPR
FT                   DNIMAGTSYLREMYDSYGAPGFLAAYNAGPGRFEDWRDKGRPLPAETRAYVARIAPMLQ
FT                   IGSTPAVMAAASSVQPVRPSWTQAALFAARANAVEETPGSATRAVASDPLLASPRPLST
FT                   LFAPVVGRRSQ"
FT   sig_peptide     complement(397788..397844)
FT                   /locus_tag="Saro_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.369 at
FT                   residue 19"
FT   gene            complement(397848..398180)
FT                   /locus_tag="Saro_0361"
FT   CDS_pept        complement(397848..398180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0361"
FT                   /product="protein of unknown function DUF736"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24809"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG4"
FT                   /protein_id="ABD24809.1"
FT                   /translation="MMRIGTFVAADGGFAGHLHTLTLDIDLVLVPADPSDSENAPDYRV
FT                   IAGKDDEAREIGAAWKHVGEKAGAYVAIQIDDPAFVQPLRANLFQGDGNEHVLVWSRPA
FT                   RREKAD"
FT   gene            complement(398177..398755)
FT                   /locus_tag="Saro_0362"
FT   CDS_pept        complement(398177..398755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0362"
FT                   /product="conjugal transfer protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24810"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG3"
FT                   /protein_id="ABD24810.1"
FT                   /translation="MRRRTIIVAALAAGLAMASLALPARRPLVWNVTHSVPTGLYWIGD
FT                   KDALAVGDRVAIEPPAAVRQLLADRGYLPIGVPLLKRVAAVSGQRVCRFRHGITIDSQL
FT                   VALALASDRLGRPLPAWNGCNVLGPGEIFTLNPGEPASFDGRYFGSLPVNAVIGRAIPV
FT                   WTDERGDGRREWFADARTPLCPPPTKENE"
FT   sig_peptide     complement(398690..398755)
FT                   /locus_tag="Saro_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.871 at
FT                   residue 22"
FT   gene            complement(398752..399291)
FT                   /locus_tag="Saro_0363"
FT   CDS_pept        complement(398752..399291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24811"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG2"
FT                   /protein_id="ABD24811.1"
FT                   /translation="MLTPEACGQPHRKSLGATGRQARPGHGRLTEVELYWQEGVREHWL
FT                   RFGKPVASRICDRRRRVECYAPGQVFGLVRWASNDYGTVLSRLDVLLAVTEGEPVTRFP
FT                   QVTPGADVLLSVTGWRKVRRVFGLIDAIEELGIDPCDVAPDHWRHIHNRLIVAETPRSY
FT                   STERHRAWLARKALQS"
FT   gene            complement(399438..400316)
FT                   /locus_tag="Saro_0364"
FT   CDS_pept        complement(399438..400316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0364"
FT                   /product="putative replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24812"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG1"
FT                   /protein_id="ABD24812.1"
FT                   /translation="MRRSSVFAGSDGQLDLFVGAGSNIAARDAQDLMAWPFFSLAKTKR
FT                   VRPIDFRMGEVSILVEATAEHGMATIWDADVLIWVASQIVEARDCGRSTSRLIAATPHE
FT                   ILSFTRRGTGKASYERLKAGLDRLQSTTVATSIRQPHQRRRHRFSWINEWRECLDSSGR
FT                   ALGIEMIVPDWFYEGVLDAALVLTIDRAYFGLTGGLERWLYRIVRKHGGKQKGGWSFDV
FT                   AHLHLKSGALSPLKRFAFELRDIVRRQPLPGYRLELEHALGRERLSFVCIPEDSFDAAM
FT                   RRLGYSGVDNP"
FT   gene            complement(400326..400598)
FT                   /locus_tag="Saro_0365"
FT   CDS_pept        complement(400326..400598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24813"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBG0"
FT                   /protein_id="ABD24813.1"
FT                   /translation="MDAIPTPVVPRFLRTPDAAVHLGLSARTLEKHRCFGTGPIYRKLG
FT                   GRIVYAIADLDAWAEQGLRRSTSDPGKGVVHPAKRVDGYMPPVRR"
FT   gene            complement(400725..401129)
FT                   /locus_tag="Saro_0366"
FT   CDS_pept        complement(400725..401129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24814"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF9"
FT                   /protein_id="ABD24814.1"
FT                   /translation="MDVARVRHRVLLRRNPACRAPAFSVPVLSGASLRLKATQSYAALL
FT                   GFAASEKARAPYQLTAYRQRRLIQLLALLDAQAAGLFLRQIAFTVVFPRNQPLVGAVWK
FT                   GSGERRHAHRLLGEAQRMCRHGYRTLLEKG"
FT   gene            complement(401654..401917)
FT                   /locus_tag="Saro_0367"
FT   CDS_pept        complement(401654..401917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24815"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF8"
FT                   /protein_id="ABD24815.1"
FT                   /translation="MTMPPFEAEPPASDTLTEYDERHLVTYLRLLDAAAEGADWREAVR
FT                   IIFEVDPDEDVDFARRLHDSHLARARWMTQAGYRDLLARKTP"
FT   gene            402133..402363
FT                   /locus_tag="Saro_0368"
FT   CDS_pept        402133..402363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0368"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24816"
FT                   /db_xref="GOA:Q2GBF7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF7"
FT                   /protein_id="ABD24816.1"
FT                   /translation="MDIRKLFGTNVKRYREAAGLSQAEIAARMGVDRAYVSAIERGLQN
FT                   ATLLSIWEIAQALEVRPVALLEEPDLSAPTQ"
FT   gene            complement(402413..402736)
FT                   /locus_tag="Saro_0369"
FT   CDS_pept        complement(402413..402736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0369"
FT                   /product="protein of unknown function DUF736"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24817"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF6"
FT                   /protein_id="ABD24817.1"
FT                   /translation="MANIGSFKKVGNDYQGEIVTMSVQTKNVRIVAEEGTANENAPSHR
FT                   VFVGRAEIGAAWTKRSGEGRDYLSLKLDDPSFTAPIFANLFDDEDGKTYNLIWSRARKS
FT                   NND"
FT   gene            complement(402822..403274)
FT                   /locus_tag="Saro_0370"
FT   CDS_pept        complement(402822..403274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24818"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF5"
FT                   /protein_id="ABD24818.1"
FT                   /translation="MMARVQVLVGRPIPRAVDWKRWQRIAALLWVSYSYTEQVRQRIAL
FT                   VPLQTGRGVQWRTQPPIDPERSAPRGASPESSATLSDRLTASLRSGAILAPNAVFSMAL
FT                   AGRNGVASSDLAAMAACQLSSPAAARHSSRRQERLAHCHPPLALRP"
FT   gene            complement(403323..403727)
FT                   /locus_tag="Saro_0371"
FT   CDS_pept        complement(403323..403727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24819"
FT                   /db_xref="GOA:Q2GBF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF4"
FT                   /protein_id="ABD24819.1"
FT                   /translation="MILAFFVSVTAIVLLTRLFASMIVFALPLYCAGLSAMYVWQHGLG
FT                   IPAAVLAAAASAFALLVAAKLLVGSTSIPARIMVSLAFALPAGLAGYHAVQGIWGAFAP
FT                   VGIASIIVGAGAALYFGLAAQKQLLSAPQG"
FT   sig_peptide     complement(403647..403727)
FT                   /locus_tag="Saro_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.933 at
FT                   residue 27"
FT   gene            complement(403872..404030)
FT                   /locus_tag="Saro_0372"
FT   CDS_pept        complement(403872..404030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24820"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF3"
FT                   /protein_id="ABD24820.1"
FT                   /translation="MPLPLAQRHAWNLARTLMVCVTLFRAGPAYGVMPSAEYDGDASQI
FT                   LHEYDPF"
FT   gene            404582..405697
FT                   /locus_tag="Saro_0373"
FT   CDS_pept        404582..405697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0373"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24821"
FT                   /db_xref="GOA:Q2GBF2"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF2"
FT                   /protein_id="ABD24821.1"
FT                   /translation="MPVAYHEGRFPPATLDLGALFPLVGPANAAIARYEGVLSGIPNPD
FT                   ILLSPLTAREAVLSSKIEGTQVTLGEVLEFEAQGHLFDESTPKKADAREVLNYRAALRE
FT                   ADSLMAELPLSQRLIKATHRVLMDGVRGRHKDPGEYRRIPNWIGPDGCTIEQARFVPPG
FT                   ADRIEAAMVGWEAYIHADAPDRLVQLAIVHAEFESIHPFLDGNGRIGRLIIPLFLYAHG
FT                   LLSRPNFYLSEYLEANRDEYYDRMLAVSRDDDWSGWVAFFLRGIIAQAEANTLKAQAIL
FT                   ALHQDKRDWVVEITHSQYAVRALDWIFQRPIFQTPDFIASAQIPPATARKIIRDLRDNG
FT                   LLRELVPASGRAPATFVFSELLNIAEGREAF"
FT   gene            406050..407546
FT                   /locus_tag="Saro_0374"
FT   CDS_pept        406050..407546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0374"
FT                   /product="sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24822"
FT                   /db_xref="GOA:Q2GBF1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF1"
FT                   /protein_id="ABD24822.1"
FT                   /translation="MSLNFNNYRRQWFTDGSTARRDILAGIVVALALIPEAIGFSIIAG
FT                   VDPRVGLYASVAIAITIALIGGRPGMISAATAAVAVLVVPLVRDHGVEYLFAATILMGV
FT                   IQIVAGLLRLNLVMQFVSRSVITGFVNALAILIFMAQLPQLTNVGWETYAMVAAGLAII
FT                   YLLPRITTAVPSPLVAILVLTAVAIGMGIDVNTVGDMGKLPEGLPSLALPQVPLTLETL
FT                   RIILPYSLTMAAVGLLESLLTAQIVDDMTDTDSDKRQECAGQGGANIVAALFGGMGGCA
FT                   MIGQSVINVTSGGRTRLSTFVAGAFLLFLLAVLGPYVGRVPMPALVAVMIMVSIGTFSW
FT                   NSIPNLRRHPPTSSIVMLTTVIVVVATHDLSLGVLAGVLLSGIFFAGKVQRMFTVEREG
FT                   SADGVLATYRVTGEIFFASVERFTRVFQAEDQAERVVIDVTRAHFWDISGVGALDKVVA
FT                   RLRRDGRQVEVIGYNQASADIIDRFALHDKTGVELGVVPH"
FT   gene            complement(407653..408582)
FT                   /locus_tag="Saro_0375"
FT   CDS_pept        complement(407653..408582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24823"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBF0"
FT                   /protein_id="ABD24823.1"
FT                   /translation="MHDYDDHEPEHASSPTAHLLEELSLYGYRPFSDEADPRPLPEERI
FT                   ASGAIADMFDALIATMLDTRLEPDLEELCWSTVNIFHRATGRVQRELDDNEDAQRRSQG
FT                   EQDGSEVRSVELERLLREGLSLIERRNALEFMREAAGDQYERHFRKPWTPRTGSLVHHK
FT                   TLTAAMIDSRDFLAAKRKAEIEPLLPTGTRVAFTAGPDYTDHKRIWDVLDRVHAKYPDM
FT                   VLFHGGNPTGGEHIAMLWARNRKVQHVAFRPEWERYRKAAPFRRNDAMLEAMPKAVIAC
FT                   PGNGINANLVDKARKLGLKVWKVGTSGS"
FT   gene            complement(408916..409953)
FT                   /locus_tag="Saro_0376"
FT   CDS_pept        complement(408916..409953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24824"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE9"
FT                   /protein_id="ABD24824.1"
FT                   /translation="MNATELSRRLGQQAEAVCRCYLSNGCKEGRYWLVGNVDNAPGRSL
FT                   YVRLIDGEKGPAGKWTDAATGDHGDLLDIIAHSVRTAGMRETLSEARRFLSLPETPAPA
FT                   ARPRPSGLSGTNSGHRDAALRLWSGSRPIAGTLAQAYLQSRGLEAGAELTALRFHPGCH
FT                   YRPSRDDPPGTPTRWPALIAAVTDNACGTTGVHRTWLDPSGMDKAPVAHPRKTMGAILG
FT                   HAVRFGVPTDCMIIGEGIETILSLRACLPTMPLAACTSSAHLAAFLFPAGVNRLYVARD
FT                   RDKAGEAAFAAIAERCATSGIEVIPLMPILGDFNDDLRQCSREAMVANLARQLGSGDEA
FT                   LLRKA"
FT   gene            complement(410029..414408)
FT                   /locus_tag="Saro_0377"
FT   CDS_pept        complement(410029..414408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0377"
FT                   /product="putative methylase/helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24825"
FT                   /db_xref="GOA:Q2GBE8"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE8"
FT                   /protein_id="ABD24825.1"
FT                   /translation="MSLPPVSASVLPRAAHAKPPAAADCEASRLITAATALLPLLARGE
FT                   RITTQRLRRVMEEALGGSDAEGRWSWKLAYEACEAAQVLFLRRYGAALLRRPGGAQALL
FT                   AAIQRLADLLPTQTRRSEDGQAFQQFSTPLPLGLVAAVATRITPGDMLLEPSAGTGMLA
FT                   ILAEIMGARLHLNELADGRADLLSGLFPTLPVTRHDAAQIDDYLEPGLSPSLVLMNPPF
FT                   SAAVHVKGQVRDAALRHMRSALARLAPGGRLVAITGANCSPHDPAWQGAFAELQHAGTL
FT                   VFTAAIAGKVFAPHGTAITTRLTVIDKQPAADPHAFPEPRGMAPDVASLLDWILADLPP
FT                   RPDCTPSVPVPIVGRQDGRATGMQPGRPAVVADPLKGGVPSLEGIELEYETLDSTPADA
FT                   VQLGEAIYEPYALQSLRIPGAVPHPTPLVQSAAMASVAPPQPSYRPHVPARLVADGLLS
FT                   DAQLESVIYAGEAHAGFLSGAWTMDATFDVLSAASEEQEGAVRFRRGWFLGDGTGAGKG
FT                   RQVAGIILDNWLKGRRRALWISVSDRLLEDAQRDWAALGQERLQVTPLSRFRQGSPIRL
FT                   AEGILFTTYATLRSQEREGKASRLAQIVEWLGSDFDGVIVFDEAHAMANAAGGKGSRGE
FT                   QTPSQQGRAGLRLQHALPSARVVYVSATGATTVQNLAYAQRLGLWSGEDFPFATRGEFV
FT                   AAIENGGVAAMEVLARDLKALGLYASRSLSFDGVEYDMLEHALTGEQVRIYDAYAAAFQ
FT                   VIHNHLDAALAAANVTAATGTLNAQARSVARSAFESAKQRFFNHLITAMQCPSFIAAIE
FT                   QDLDAGHAAVVQIVSTGEALMERRLADIPTEEWNDVRVDITPREYVLSYLEHSFPVQLF
FT                   EPYSDEEGNLSSRPVWKDGQPVLCREAVARRQQMIEHLAALPPVPAALDQILHHFGTDV
FT                   VAEVTGRARRIVARRDGSGQVRFAVETRPASANLAETQAFMDDAKRILVFSDAGGTGRS
FT                   YHADLGVRNRRLRVHYLLEAGWKADNAIQGFGRTNRTNQAQPPRFRPVTTDVKAQKRFI
FT                   STIARRLDSLGAITRGQRQTGGQNMFRPEDNLESHYARDALRQLYALIAAGKVEGCSLQ
FT                   QFEQATGLSIIDAEGGGLRDELPPITTFLNRMLALTIALQDILFTAFEDLLTRRIEGAM
FT                   ASGTYEIGLETLRAESFALTSRRTIYTHPGTGAVTDLLTIARKDRTRIVTLDEALELAG
FT                   RSQGRLLCNQRSGRAAVEMPARSMMRDDGSVEAHIRLVRPGEASTVPVDAMAASHWEPA
FT                   DETAFRAAWTAELATIPEFETSTLHMVSGLLLPIWKQLPDESTRVYRFQTDDGQRFVGR
FT                   KVSPAWVASIIEEDAPALAPDVAFAMLMSGQATLQLREGQTLQQVRAMGTPRIELTGFS
FT                   DLALDRLKAIGLISEIVSWKLRLFVPTGSEGPAILARLLERYPLERILPRRESARVA"
FT   sig_peptide     complement(414355..414408)
FT                   /locus_tag="Saro_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.960 at
FT                   residue 18"
FT   gene            complement(414602..415432)
FT                   /locus_tag="Saro_0378"
FT   CDS_pept        complement(414602..415432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24826"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE7"
FT                   /protein_id="ABD24826.1"
FT                   /translation="MMTIVTNPAPVFGRTAGGLLAARLEDHSWIAVPARTGLRIADAWR
FT                   LKKAMADWTEEDFWGSCGIVADEAAFRAHVAEIAEHHRELLGLSRPTTTPRRSTPWGPA
FT                   QQSCRYGEGISCHSTAGHGGFHLDDLRNAAVHPLLRHADGWYEEDCDWAKVAFTFPGLF
FT                   TTRERRIAAESLIAYYPDAWEAIHGIELAPGQSRVKDERRFREVHAADWIVISAVRSDS
FT                   HPGMADCVATMGGARGAVPARHYRVPVGEYSPGAFGFVIDPGRHEQVEPSALSA"
FT   gene            complement(415429..415902)
FT                   /locus_tag="Saro_0379"
FT   CDS_pept        complement(415429..415902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24827"
FT                   /db_xref="InterPro:IPR017042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE6"
FT                   /protein_id="ABD24827.1"
FT                   /translation="MNAHDLFDTAPLGSLVSFANDQPRPPERFRRKLAAWRTWNGTGRL
FT                   VAIYPRRLLGSSFQSAGFVLKIGEYGSEGVTILTVSRHFELTCPLDFGILERPRPGMVR
FT                   VLTEWNGKVELQHLADDLPTAHEWLARHRYSNPFLSIVEPDETGGLGAMRRAA"
FT   gene            complement(416008..418149)
FT                   /locus_tag="Saro_0380"
FT   CDS_pept        complement(416008..418149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0380"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24828"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE5"
FT                   /protein_id="ABD24828.1"
FT                   /translation="MAIAASKIILSQSRDIPFNQLVLSQANVRRIKTGVSIEALAEDIA
FT                   RRTLLQSLNVRPQLDDDGKETGRFEVPAGGRRFRALELLVKQKRMAKTQPVPCVVREGS
FT                   DISAEEDSLAENTHREQLHPLDQFRAMQVLSDQGLGLEDIAAHFMVTPAVVRQRLKLAS
FT                   VSPQLHAVYADDGMTLDQLMAFSVCEDHERQEQVWEMLVHSFNRSPAYIRSRLTEDSVR
FT                   ASDKRVRFVTLVAYVAAGGNVMRDLFEDDHGGWLQDVHLLDKLVADRLQSEAARLEAEG
FT                   WKWAAAAVDFPWGYRDGMRVMTGTAAELTDEEQARVEALQAEAAAIENDYERASEIPDE
FT                   IEQRLTAIDEELALLLERPPVFAPEDMAMAGVFISVDVDGSLHVERGFVRAEDEPKPDS
FT                   DMPDDGGYAGGEDGHHAGSVDTDRPYGSEPSQGSEPSGEPGEDESSIKPLPDKLVCELT
FT                   AERTLALQDAVANRPDVAFAVVLHAMVLQTFYHGARESCLGVAVHRTGFPHQAPGMADS
FT                   VSARAIISRHDQWKARLPEHDIDLWAALLSMTGADQASLFAHCAAFGINAQWEPASRYD
FT                   GRVSAHTVARRIEHAHVLARAVDLDMVAAGWKPGVENYLGRVTKPHILAAVAEARGEET
FT                   AALIDHLKKGDMAREAARLLEDSAWLPEPLRTPGIADLVDLGAVSTAASDDLPAFLTGD
FT                   GEPEHGEDGSFDAWAIAAE"
FT   gene            complement(418306..419244)
FT                   /locus_tag="Saro_0381"
FT   CDS_pept        complement(418306..419244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0381"
FT                   /product="putative ArdC antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24829"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE4"
FT                   /protein_id="ABD24829.1"
FT                   /translation="MASFRARRASAPERTDLYQDITDRIIAQLEQGRLPWVQPWDSAAA
FT                   ALDLPVNASTRARYSGINILILWSAMIERGFTTNRFLTFRQALELGGNVRKGERGMTVV
FT                   YAHRYTPQRERERAREEDRTPGTIPFLKRYTVFSTDQCEGLPEDLSAPVAPVDRSLMLP
FT                   EAEALIRATSADIRIVGGEAFYVPSRDYIQIPRPEAFPDPINWHRTAFHELGHWTGHPS
FT                   RLSRDQAGRFGSPEYGREELCAEMTSAFVCAALGIEPSVRHADYLGSWLAILREDNRAI
FT                   VRAASAASKAADFLLAFARAEEDAVDLARAA"
FT   gene            complement(419819..420133)
FT                   /locus_tag="Saro_0382"
FT   CDS_pept        complement(419819..420133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0382"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24830"
FT                   /db_xref="GOA:Q2GBE3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE3"
FT                   /protein_id="ABD24830.1"
FT                   /translation="MAHKARLEAQMAELQARLERIEQDLAEPLNADSSEQAVEVEDDAS
FT                   LESQALLLRRQIASVDRALERIAAGTYGECIRCGGEIAPARLEARPEAALCIDCARQEQ
FT                   "
FT   gene            420278..421420
FT                   /locus_tag="Saro_0383"
FT   CDS_pept        420278..421420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24831"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE2"
FT                   /protein_id="ABD24831.1"
FT                   /translation="MMRSALALALAVVTTAPALLPASARAQARPPLPAAVLTHMNGLDA
FT                   RCTAAGGKPGSGHYVIAQDFTGDGLLDYLLSEGDYDCTGRPGLFRAEGQARVDIFVTDR
FT                   AGAARRIYSDRLIAYRVLAGRPARVQIARKGALCGAGTPPQSQCAAQLAWNGTSFGEAA
FT                   SVSRGGSGASSGPVAMPEAAPGPTSEAGFLVSCRADLIRRDASAARWADDECRTNWQKI
FT                   LASGPAANMLLAVLPATASGKPTLAETKQRAAAVRWATRANPPALATGTLGQLSAAIEG
FT                   RGSPATVSVNWAKVGAEIPYDIVGALRVRGLAITEMACEKVGVGAGTRTYAGTSAERVP
FT                   FTLTIDQQTAPLGHMQSYYTATISLEARHPPRGSTTGCDF"
FT   sig_peptide     420278..420358
FT                   /locus_tag="Saro_0383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.793 at
FT                   residue 27"
FT   gene            421508..422518
FT                   /locus_tag="Saro_0384"
FT   CDS_pept        421508..422518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0384"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24832"
FT                   /db_xref="GOA:Q2GBE1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE1"
FT                   /protein_id="ABD24832.1"
FT                   /translation="MIDPALPWLKLALCSALIAFAGPALVRNGDRIAQLTGLSRSWIGL
FT                   ILLATATSLPELFTGVSAVTIADAPNIAVGDALGSCVFNLLMLVLLDELSRRDPVYRRI
FT                   DQGHILTAGFGVILIGTVGALILLRGSGLDASVRHVSVYTPFLVLLYLIAMRAAFDFQR
FT                   RVTGTLPVHETDAGMTLRQAIGRYLLAASIVVAAGIWLPFVGVDIAEQMGWQTTFVGTL
FT                   LIAATTSVPELVVSISALRMGAVDMAISNLLGSNLFDVLIIAIDDIAYTNGPLLSSVST
FT                   AHAVTAFTAVIMSGIFIVALLFKPESRIRGTISWISLSLLMAYLFSAYASFLLGH"
FT   sig_peptide     421508..421588
FT                   /locus_tag="Saro_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.922 at
FT                   residue 27"
FT   gene            422876..423853
FT                   /locus_tag="Saro_0385"
FT   CDS_pept        422876..423853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24833"
FT                   /db_xref="GOA:Q2GBE0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBE0"
FT                   /protein_id="ABD24833.1"
FT                   /translation="MRYLLTLLKTRLSRQPAGGRSALVWVITLMGLALAVVAHSVLGST
FT                   SQVLPARKTAMEQVVGESRAAEAGAPQGLQAELEQLAERMPGRNAVLVRSVSDGWVAGF
FT                   RGATSFPQGSLRRIWLGAVLLEAVDQGELSLDQRVPLQTRARGPERHEQVSALLRKAVA
FT                   QDDRSAQDEILAGLMGPSGMAAWLERRGFGEVAFGPSNRDLVRLPQGKAAEGGPPDGAT
FT                   PDGMAFALGELFAGRVLKEDSTAHLLQLLEQDGSSAERAGWLVSRLTGASPLTGPAASA
FT                   GAVAFLRARTGQRYVVVVSTSGAGNPRSISDRLLTDVIAALRRY"
FT   sig_peptide     422876..422992
FT                   /locus_tag="Saro_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.414 at
FT                   residue 39"
FT   gene            complement(423854..424543)
FT                   /locus_tag="Saro_0386"
FT   CDS_pept        complement(423854..424543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0386"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24834"
FT                   /db_xref="GOA:Q2GBD9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD9"
FT                   /protein_id="ABD24834.1"
FT                   /translation="MQGHVLLVDDEPALITVLQPVLKAAGCTVTVATDGNAAISGVIAH
FT                   DPDVVLLDLGLPDMDGKEVIRVIRESSQVPIIVISARHQEAEKIAALDEGADDYVNKPF
FT                   EIGELMARIRVAVRRATSQPANAAIFEGGPLRIDFAKREVELMGEPIKLSPKEYMLLHA
FT                   LARNVGQVVTHKRLLAAGWGNSTADLQYLRVYMGLLRQKLEENPSEPELIVTEPGLGYR
FT                   LIVRDAG"
FT   gene            complement(424543..426051)
FT                   /locus_tag="Saro_0387"
FT   CDS_pept        complement(424543..426051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0387"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24835"
FT                   /db_xref="GOA:Q2GBD8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD8"
FT                   /protein_id="ABD24835.1"
FT                   /translation="MDLFAETSLRDELRRTMISKASAWRAPAVIFAVTAVLVIVLKPIL
FT                   DGEVSSGMLFMLGITLVGARSGLTPALISALLASAIFNFFLADPVLTFRMSSGEDLAPP
FT                   LIFTACALVSGLLAGRLKDKTFQLGRTNLQLESLLETSRLLQAAPDVAAIEAALATTVP
FT                   GRLGFRLSLYGLKDGTTEALPASDRRPEALALARQAIEGDGIVRHRDSIAFRLDGSRSC
FT                   VGALVVENVSGAQVDPAFLEALASLVGLALERARFASVIAEAEANVRTEELKSALLSSV
FT                   SHDLRTPLTAISASASSLIEFGSRFDRETSKALLQGIVDECDRLNRFTANLLELSRLQA
FT                   GGPSIAGQVLSVNDVVRAVVQRLRTRFAGREISVSSTDPEILVTADTALFELAVTNVIQ
FT                   NALIYSEPDMPVLVQSSCDRNQCVLTVTDQGCGVPEAEQTRVFERFYRVKRSEPSPQGS
FT                   GLGLAIAKGFVEAFEGTVKLMSPVIGGKGTTVTITLPVVSEVKA"
FT   gene            426165..426689
FT                   /locus_tag="Saro_0388"
FT   CDS_pept        426165..426689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0388"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24836"
FT                   /db_xref="GOA:Q2GBD7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD7"
FT                   /protein_id="ABD24836.1"
FT                   /translation="MKRTLALALLASGALALSACGQKRAPESLPPEPGPQAPVAANNGD
FT                   YDANGNYIGPGSQADLRRTAGSDRVFFDFDSYGLDDTDRATLTRQASWLAQYPNVNVTI
FT                   EGHADERGTRDYNLALGERRANAAKNFLASLGVATTRMSVVSYGKERPEALGSDEQSWA
FT                   QNRRAVTMVIR"
FT   sig_peptide     426165..426224
FT                   /locus_tag="Saro_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.663 at
FT                   residue 20"
FT   gene            426706..426993
FT                   /locus_tag="Saro_0389"
FT   CDS_pept        426706..426993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24837"
FT                   /db_xref="GOA:Q2GBD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD6"
FT                   /protein_id="ABD24837.1"
FT                   /translation="MATAMNSSTERAFRRAREILRKEGALNSAECEELKELFDEVNGTQ
FT                   FMALTQDPDHTRALREFDRYVRRPALPILVTMVTLLIISIIMGVSVSMRQ"
FT   gene            427167..427850
FT                   /locus_tag="Saro_0390"
FT   CDS_pept        427167..427850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0390"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24838"
FT                   /db_xref="GOA:Q2GBD5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD5"
FT                   /protein_id="ABD24838.1"
FT                   /translation="MTTDAVTDFSPIALFAQADIVVKVIMLGLLAASIWTWAIIVAQIL
FT                   KNRRAHATSDLFEAEIREAGFTGESSKHLARDASPAAALFKAAMAEWSKSVRARASLDK
FT                   DAARERIADVLEGAIEGEVDRLSERLNYLATIGSIAPFVGLFGTVWGIMRSFTSIAASQ
FT                   NTSLSVVAPGIAEALLATAIGLFAAIPAVIAYNRFGHSLNRFEARLVRFARYLRGNLSR
FT                   ELDAL"
FT   gene            427850..428329
FT                   /locus_tag="Saro_0391"
FT   CDS_pept        427850..428329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0391"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24839"
FT                   /db_xref="GOA:Q2GBD4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD4"
FT                   /protein_id="ABD24839.1"
FT                   /translation="MAVNLSGGSGRGRRGFGGRSPMSEINVTPLVDVMLVLLIIFMVTA
FT                   PLLRAGVPVNLPESKAKALGEDKDQVTLSLSRDGRVYLDDVEVPPGALPDQLAGLPRSA
FT                   GGEPPLVTLRADRSLDYGRIMEVMGELNQAGFNSISLITLAAGEAGSQDREKPAP"
FT   gene            428326..429432
FT                   /locus_tag="Saro_0392"
FT   CDS_pept        428326..429432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0392"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24840"
FT                   /db_xref="GOA:Q2GBD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD3"
FT                   /protein_id="ABD24840.1"
FT                   /translation="MNATVGSLLPTSRDERVGLVLAAGLHALLLAALAWKPVSVALPPP
FT                   PERMTVTLTDSVGLTSTSPAPAAEAAADVAPSLGEPAPPAASSPPIETRAAPESPPAPL
FT                   PAKPAPPAPKAAPPPKPQPAPKPTASAVAKPSPAPIPAPRPTPQPAPRPSLAPAPPPVA
FT                   KAAAKPAPKPAPALPQRALTPAPAARPSPAAASAPARPPAATSRIGDDFLKGVPASRSG
FT                   SQAARPAAAPGGSRLGDDFLKGVSGAQTSGTARTPPAAAIGPAVQSALAGSISRQLKPH
FT                   WVVPQGVETEALVTVLSWSLNRDGSLAGSPQVVRQEGITDANRAQAARHAEQAIRAVQL
FT                   AAPFNLPAEYHDAWKRVASFRFDRKLSQ"
FT   gene            429429..430784
FT                   /locus_tag="Saro_0393"
FT   CDS_pept        429429..430784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0393"
FT                   /product="TolB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24841"
FT                   /db_xref="GOA:Q2GBD2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBD2"
FT                   /protein_id="ABD24841.1"
FT                   /translation="MTLRMLFAFALLAAAPAQAQQTEPQPAEEGGLSGTVSDDSEWQDL
FT                   GIAIPAFATNADVPTPTSAGSTSALGQALAQVISANLRNNGLFKPVGPESLPRPGFEQV
FT                   QAPDFAVWSARSAEMLVQGYVRANGDGQLTVGCYLYDVALKQQLEKAGWTVAPADWRRA
FT                   AHKCADMIYARLSGESPFFDSRVAYIAESGPKDRRMKRLAIMDSDGANHRYLTSGQATA
FT                   LTPRFSPDYKSILYLSYLNGRPRIYVYDLAANTQRLVTETPGPTFAPRWSPDGKWILYS
FT                   MATAGNTDIYKVPASGGASQRLTDTPGIDVGGSFSPDGSRIVFESDRSGSQQIYVMNAD
FT                   GSDHRRISFFGGRAATPEWSPRGDQIAFTHIVGNLRIAVVSPGGGDLRYLTDSWQDEAP
FT                   TWSPNGRIIQFFRTEKGSGKASVWQVDLTGRNERRLSTPGDASDPAWGPLLP"
FT   sig_peptide     429429..429488
FT                   /locus_tag="Saro_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            431251..431793
FT                   /locus_tag="Saro_0394"
FT   CDS_pept        431251..431793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24842"
FT                   /db_xref="GOA:Q2GBD1"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD1"
FT                   /protein_id="ABD24842.1"
FT                   /translation="MRKWFKRISPDREVLLANRWLRPIAHRLSHPEIWHFNRRNVARGV
FT                   ALGLFVGFVLPLGQIVVAALLAATARGNLLVAAAATLVTNPLTFPPIYYAAYRTGSFLI
FT                   GSAGESPQANRAHTGAMMEALTSASLPTLVGLLLFAIVSAAAGFALVHLGWRFSLARQW
FT                   RRRMQSGAVDSYQDGKD"
FT   gene            431793..433526
FT                   /locus_tag="Saro_0395"
FT   CDS_pept        431793..433526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0395"
FT                   /product="Kef-type potassium/proton antiporter, CPA2
FT                   family"
FT                   /note="TC 2.A.37.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24843"
FT                   /db_xref="GOA:Q2GBD0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBD0"
FT                   /protein_id="ABD24843.1"
FT                   /translation="MEPHPGIPFLREALVLLAAAGLAVPLLNRIRVNPILGYLLIGGVI
FT                   GPYGLGLLAADYPFLSHAVISDIAGVRGLAEIGVVFLLFMIGLELSLERLWSGRALVFG
FT                   MGSLQILLTAGLIAWIATGLGVEEPTALIVGAALSLSSTAIVMQLLIHGRRQFSAVGKT
FT                   GFAILLMQDLAVVPILFMVGVIATPGSGGLAAGLAGALGKATLAIVLIYLAGRLLLRPV
FT                   LRQVAQTRSPEMFTAAVLLTVIGVSALTARFGLSMALGAFLAGLLLAETEYRHQIEVDI
FT                   EPFKGLLLGLFFMSVGMGIDWRQVLASPLEIAGMVTGLWLLKAVVITGLAIAFGRPRHV
FT                   AAEAGMLLGQGGEFAFVIVGVAAGLGVVGGVLEQQILIVTGISMLLTPVVAHLARQLSA
FT                   AMERKRLAAAADTDESFADCEGHIIIAGFGRVGQTLARALDAENVAFVALDADAAMTAG
FT                   LKDRHLPVFYGDASRSEILAKAGIDHAAAVVVTMNDPEAASRIVHQIHQRWPSMPIHAR
FT                   ARDPEHARRLLELGASFCTPETVEASLQLAANVLVGAGVDAEVTRRRITEQRAYETGDS
FT                   P"
FT   gene            433539..434387
FT                   /locus_tag="Saro_0396"
FT   CDS_pept        433539..434387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0396"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24844"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC9"
FT                   /protein_id="ABD24844.1"
FT                   /translation="MTTHGKPVLVATDLSARTDRAVDRATQLAGEWGVRLIVLHAIEPD
FT                   SRLHARPELANQAMREVLADPEADVDILPALDLAPTAIVEAAKSADCGLIVTGVARFNH
FT                   VGDYFIGTAVDHVVRHATVPVLVVKQRPHNAYRTIVVATDYSSCSRLALLTAAEFFPDA
FT                   AIHLVHAYHVPYEAWLRSDEVREDVTREAQRELDAFVLDPAIPANVRQRISAKLVYGET
FT                   HTVLSSTAYELGADLLVLGTHGSGGYFAAVMGRMAESLLRCADIDTLVVREIGSTGSEH
FT                   R"
FT   gene            434462..435793
FT                   /locus_tag="Saro_0397"
FT   CDS_pept        434462..435793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0397"
FT                   /product="cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24845"
FT                   /db_xref="GOA:Q2GBC8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC8"
FT                   /protein_id="ABD24845.1"
FT                   /translation="MPLRLTHPARLVPLVFSAAIVLGTVILMLPIARAGAGSAPFLTAL
FT                   FTSTSAICVTGLIVQDTPVYWSSFGQWVILLLFQVGGFGIMSAATLLGLLVGRGFRLSD
FT                   RLRTRVERSHFDLHDARSVLRLILLVTIVVEGTLALLLTLRLHFGHGYDWADAAWHGIF
FT                   HAVSAFNNAGFSTFSDSLMGFQNDWLFLVPVMLAIVLSSLGFPVLHEIRNRRDGPGPWT
FT                   LHSKITVLGTGMLLIVGFLAVLMAEWSNPATLGAMPLGDKILNGAFQSVTTRTTGFNAL
FT                   DIGALQEETLLVTYILMFIGGGSAGTAGGIKVTTFFLLGIVVWSEARGERDAAIFGRRI
FT                   GPAIERQALTVVLLSTALIGVGTLIILSATHLPLQAVLFETISAFATVGLSTGITAQLG
FT                   PIGQVVLIILMFIGRVGTITISTALAMGMGRTAFRYPEERPIVG"
FT   sig_peptide     434462..434566
FT                   /locus_tag="Saro_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.494 at
FT                   residue 35"
FT   gene            435786..436460
FT                   /locus_tag="Saro_0398"
FT   CDS_pept        435786..436460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0398"
FT                   /product="TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24846"
FT                   /db_xref="GOA:Q2GBC7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC7"
FT                   /protein_id="ABD24846.1"
FT                   /translation="MARNPNRNRAETVLVIGLGRFGTAVASSLIRMGHEVLGVDEDLSR
FT                   VQETADRLTHVLQADCTSPEALRQIGIADFKTAVIAIGGDIEASILTALAVIEAGVQTI
FT                   WAKATNERHGKILKSIGVQNVIYPEARMGQMVAHILTGKMMDFVELDNDFAMVKTRTPG
FT                   ELVGLTLEQAQVRQRHGVTIVGVKRPNEIFTYAQATTTLAEGDLLIILGEVERVERFAA
FT                   QT"
FT   gene            complement(436525..439260)
FT                   /locus_tag="Saro_0399"
FT   CDS_pept        complement(436525..439260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0399"
FT                   /product="ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24847"
FT                   /db_xref="GOA:Q2GBC6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC6"
FT                   /protein_id="ABD24847.1"
FT                   /translation="MLKDHNPLWHAQPVDAVLRSLQAVPNGLSSEEASRRLEKYGTNRL
FT                   PEQAARSPFLRFLRHFHNILIYVLLASAVITALMGHLVDTGVILAVVMANAIIGFIQEG
FT                   RAEGAMAAIRQMLAPRSAVLRNGVRATIDASELVPGDIVLLEPGDRIPADLRLIEARGM
FT                   KVEEAILTGESVPVDKDCSPVPENASLGDRASMAFSGTLVVSGTARGVVAATGGGTEIG
FT                   QISGMLSRVETLTTPLVHQMDIFARWLTAFILLVGAAILAFGTFVRQLPFDEMFMIVVG
FT                   LAVAAIPEGLPAVLTITLAVGVQAMAKRNAIVRRLPAIETLGSVSVICTDKTGTLTRNE
FT                   MMAAALVSSGREYTIEGAGYAPAGMLQAGGEPVEASGDPVLVEFARAAALCNDASLVRS
FT                   GDDWRVEGDPMEGALLALAGKISDGSLRAFEHLTRTDVIPFDAAWRYMAVLCHDHQGQA
FT                   FAYVKGAPEAILTMCGDQQDCNGETEPLDEAYWSRSVETLAGDGQRVLALAVRTMRQDD
FT                   TVLNTSDLEGKLTLIGLVGLMDPPRAEAIEAVSECHAAGIRVKMITGDHAATARAIAAQ
FT                   IGLRNTGRVLTGADISDLADDQLAEAVMETDIFARTSPADKLRLVTALQSQGLIVAMTG
FT                   DGVNDAPALKRADAGTAMGIKGSEAAKEASELVLADDNFASIAAAVRQGRTVYDNIKKV
FT                   ISWTLPTSAGEAMTIVVAVLAGLSLPVTAVQILWVNLITATTLGIALAFEPSERKTMLR
FT                   PPRARDAPLLTGELIWHIVLVSGLFVVAVFGIFAYALDKGYSLALAQTMAVNTLVVLEI
FT                   FHLFFIRNIYGSSLNWRAVKGTPIVWLAVIVVTAAQFAITFLEPLQRVFGTQSVPIRDG
FT                   LLIIGVGAAFFGLIEIEKQLRLSLQNLNGRLAPHFRREAA"
FT   gene            complement(439359..440204)
FT                   /locus_tag="Saro_0400"
FT   CDS_pept        complement(439359..440204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0400"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24848"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC5"
FT                   /protein_id="ABD24848.1"
FT                   /translation="MTHAASRRLVMLYATVDTFDLDEGAAHYGLSVCAASNSGLTGLLL
FT                   SLDANLPPSAEGRSYSQMEAESAERVAANRANAEALVAEAARRGITAHTATDLDHSRGV
FT                   IGWLADHARLHDLVVIGADRRGMMSDRMIAENLLFEIGRPLLLVPAQHKQGFSCKTVVI
FT                   AWDNSKSAARALGDALALLPEVQDLAFLIVGDEKAIPSALDDSAVASLLSRRGLAARVV
FT                   RQQLGERSIGTALQEGAQELGADLLVMGGFGHSRLREFILGGATLSVFDDPRLPVLLSH
FT                   "
FT   gene            440475..441857
FT                   /locus_tag="Saro_0401"
FT   CDS_pept        440475..441857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0401"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24849"
FT                   /db_xref="GOA:Q2GBC4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC4"
FT                   /protein_id="ABD24849.1"
FT                   /translation="MDTIVRHSWLRLFLLSLLLAGFAQAWANAQTQPGRDEVPVLTIEG
FT                   AIGPATADYVAGGIARAAEQGAPMVIIRMDTPGGLDTSMREIIRAILGSPVPVVTYVSP
FT                   SGARAASAGAFILTASHVAAMAPGTNVGAATPVQLGAPAAPSTPKSSDQQADDKGTSSP
FT                   AKSGGASEAKALNDAIAYIRSLAEMRGRNADWAEAAVREAASLSAKSALEQKVIDIVAR
FT                   DDGDLLAQINGLTVALGNGQVRLQTDGVRLTEVLPDWRTRLLSAITNPNIALILMMIGA
FT                   YGLLFEFMNPGALYPGTIGAISLLLGFYALSVLPVNYAGLALIVLGLALMGAEAFSPSF
FT                   GILGIGGMIAFVLGATIMFDTDVPQFRVALPVLAAIAVASLGATVLTMRLALRSRRSSV
FT                   ATGREEMIGATGSVLDWQGTGGHVRVHGERWNARAVSELHAGQEVRIIRLQGLTVEVEP
FT                   AN"
FT   sig_peptide     440475..440558
FT                   /locus_tag="Saro_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.926 at
FT                   residue 28"
FT   gene            441880..442653
FT                   /locus_tag="Saro_0402"
FT   CDS_pept        441880..442653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0402"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24850"
FT                   /db_xref="GOA:Q2GBC3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC3"
FT                   /protein_id="ABD24850.1"
FT                   /translation="MGMLGELAFYLPLIFLALLFLMAAVKILREYERGVVFTLGRFTGV
FT                   KGPGLILLVPFVQQIVRMDLRTIVLDVPTQDVISRDNVSVKVNAVIYFRVIAPDLATIQ
FT                   VENFMQATSELAQTTLRSVLGKHELDEMLAERDKLNADIQEILDAQTDAWGIKVANVEI
FT                   KHVDIDESMVRAIARQAEAERERRAKVINAEGEQQAAQKLLEAAEILGQRPEAMQLRYL
FT                   STLNVIAGEKSSTIVFPFPLDFMELLKGSKQAQEG"
FT   gene            442737..443264
FT                   /locus_tag="Saro_0403"
FT   CDS_pept        442737..443264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24851"
FT                   /db_xref="GOA:Q2GBC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC2"
FT                   /protein_id="ABD24851.1"
FT                   /translation="MVGRDLDNEVEAYILESALELPERAYRLVIHVASSEAEPVGKDTI
FT                   AAAVRSYFAYRSDVQARRLRLLLREGRHALLVGLGFLTLCWGLGFLAVDLVPVPFGDFL
FT                   NEGLLIIGWVANWRPAEIFLYDWRPMKRQGAVLDALAEMDVHLRIDRPDSSAEPESGTK
FT                   AQRDIAGKTVII"
FT   gene            443284..443673
FT                   /locus_tag="Saro_0404"
FT   CDS_pept        443284..443673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0404"
FT                   /product="protein of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24852"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC1"
FT                   /protein_id="ABD24852.1"
FT                   /translation="MSYYFSKTVSAPLDETVTQVRNALADQGFGVITDIDMAKTLRDKI
FT                   DVEFRPYRILGACNPKLAYEALQVEDKVGTMLPCNVIVQEFAPGRCEVAAIDPVASMSA
FT                   IDNPALQSAAQAVQQRLRLVIEAIG"
FT   gene            complement(443690..445009)
FT                   /locus_tag="Saro_0405"
FT   CDS_pept        complement(443690..445009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0405"
FT                   /product="Di-and tricarboxylate transporters-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24853"
FT                   /db_xref="GOA:Q2GBC0"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBC0"
FT                   /protein_id="ABD24853.1"
FT                   /translation="MSFEQIITLVVLAGVIAALIHDKIRADIVALAGAAVLLASGAVRP
FT                   SEVQSAFGSPALITLASLFVIAHAMELSGLLDRLIRAMVKACRKTGATGIWAMIGLCGA
FT                   GSAFLNNTPIVVMAAPVVRDVANSLKLDARRFLMPLSYVAVLGGCCTLIGTSTNLLVDD
FT                   MARTSGQAPFTIFEITPVGLAVALAGGLYLMLFSGPLLKSSPRIDGPDPAEIAKHHVSH
FT                   VDIAGDAVGDPRDFAEDHRFDLTKALASVGVFIGVVALAAFNLIPIAAAAFAGAVLLIL
FT                   VRVIRPEEAYGGLRPEILLLIAGMVVIGIALEETGLASSATDWLVKSVDGFGPLMALVL
FT                   LYGGTLLLTELLSNATVAVLVTPLAVALAESMGVSPRPFLVAVMIAGSAAFATPFGYQT
FT                   NVLVYQMAGYRYMDFVKVGLPLNLVTWVVAVAAIHWFFPF"
FT   gene            445149..446018
FT                   /locus_tag="Saro_0406"
FT   CDS_pept        445149..446018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24854"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB9"
FT                   /protein_id="ABD24854.1"
FT                   /translation="MPALSPMSPSFHTRQGKLAVLVGLAALIMSGCSSNVPGEDQAAPS
FT                   DAASENVSEVAPGQPTEATRLAPIGRIDLIAAFGRASDAVAAGQALPDANRQLVGRTFS
FT                   LKLPFGCDGEADKERPAWAGWTLDRNRQALKLSAAPERWTDAAWAKSIAGDMAHEAVEG
FT                   FWIERPWTSSEECPAGNPASESGLPASDERQTMGIAQFFAPDSPRTFQRGSRPYAHTIR
FT                   VREPADVEGRTYRFAVSGRVTGFPDGQPIHCVQDAPDRRPVCLMAVELARVSFEDPRDG
FT                   TVLVEWRN"
FT   sig_peptide     445149..445256
FT                   /locus_tag="Saro_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.935) with cleavage site probability 0.454 at
FT                   residue 36"
FT   gene            complement(446037..447314)
FT                   /locus_tag="Saro_0407"
FT   CDS_pept        complement(446037..447314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0407"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24855"
FT                   /db_xref="GOA:Q2GBB8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBB8"
FT                   /protein_id="ABD24855.1"
FT                   /translation="MPSISHPPSALRDFLRSEAAGGVILMAVAVLAMIVANSPLADSYF
FT                   HLLHVQTGPVLSEKLGPMTPHLWINDALMAVFFLLVGLEIKREFVDGRLVTWQQRRLPF
FT                   IAALGGMAAPALVFLAVTAQSSGLTQGWAIPAATDIAFAIGVMALLGSRVPTALKLFLT
FT                   TVAIVDDMGAVVIIALAYTASIKGIALLAAAVILGAMMAMNRAGVRHLAPYLLGFVLLW
FT                   FAVLVSGVHATIAGVLAAFTVPVVATPGAPDSPDSPLHRLEHALHPWSAFLIVPLFGFA
FT                   NAGISLEGFSLGSLLEPLPLGIAAGLFIGKQLGIFSLIWAAVKLGIAQRPRGSTWLQVY
FT                   GLSVLCGIGFTMSLFIGMLAFASSPDLIEEAKLGVITGSLLSGVLGYLVLRFAPPAADA
FT                   AQAETEIDREIEQDGDVEAIEGKLRQ"
FT   gene            447796..448563
FT                   /locus_tag="Saro_0408"
FT   CDS_pept        447796..448563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0408"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24856"
FT                   /db_xref="GOA:Q2GBB7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB7"
FT                   /protein_id="ABD24856.1"
FT                   /translation="MDFLAGIDFTALLPFIAVGFAAQMVDGALGMAFGVISNTLMVGVL
FT                   GIPPALASQRVHIVECFTTATSGISHLLHGNVDKKLFFRLLIPGMAGGILGAYVLSSLD
FT                   ASLVKPWVLLYLSAIGIYLLVRGILYPPKIKEAGWVAPLGLLGGFLDAAGGGGWGPVVT
FT                   SNLLIQGADPRKVVGTVNTVEFFLTLTVSATFIWHLGVADVAGATLGFLIGGLAAAPFG
FT                   AWAAKHIPAKAMLIMVGVVLTLTSLYGAYKAFA"
FT   gene            448658..449185
FT                   /locus_tag="Saro_0409"
FT   CDS_pept        448658..449185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB6"
FT                   /protein_id="ABD24857.1"
FT                   /translation="MARFDASGMTIVEMREFASFTAGEQRYIRRSLDIALERGEAIERW
FT                   ARNAEEAAAIRRQTIMYRDLADLRGMLPQVEDVETLDPFMGRLVALSAFDLAQERLDGF
FT                   SAYRFLYERLLGAEVRPWLPSAFCGAAALPVIRPTRRRELLQSISEAAATAHGWSMRAP
FT                   QFYPQFVEAEAA"
FT   gene            complement(449193..450791)
FT                   /locus_tag="Saro_0410"
FT   CDS_pept        complement(449193..450791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0410"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24858"
FT                   /db_xref="GOA:Q2GBB5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB5"
FT                   /protein_id="ABD24858.1"
FT                   /translation="MSGQDLKSHDVLIIGSGAAGLTAALVLAETCRVLVLAKGGLDGGS
FT                   TNWAQGGIAAVLDAGDTFEDHIRDTMIAGAGLNRRETVEFVVEHAPAAIRRLVDLGVPF
FT                   NAEAGSLHLTREGGHSHRRIVHVDDATGAAVQKALLKAAREHPNVTLLPGRTCIDLITG
FT                   RHEAARYSGSGRVWGVYALDEASGTVEAHTARATILATGGAGRVYQFSTAPRGATGDGI
FT                   AMAWRAGARVSNMEMMQFHPTCLYNLEVKNFLITEAVRGEGGRLINPRTGARFMEFYDP
FT                   QRLELAPRDVVARAIDAEIKKFGLDFVHLDISHMPADFVRGHFPNIHEKLLGLGIDMTT
FT                   QPIPVVPAQHYTCGGVLIDLDGRTDLPGLYAAGECTESGLHGANRLASNSLLECFVFGD
FT                   AAARDILRRWDSFEAPPEVRAWDESRVTDSDEEVVIKQNWTEIRRFMWNYVGIVRTNKR
FT                   LERAAHRIQMLSDEVNDYYGHFRVTTDLIELRNLLQSAELIVRSARARHESRGLHYTLD
FT                   YPQTNEVARDTVLVP"
FT   gene            complement(451251..452258)
FT                   /locus_tag="Saro_0411"
FT   CDS_pept        complement(451251..452258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0411"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24859"
FT                   /db_xref="GOA:Q2GBB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB4"
FT                   /protein_id="ABD24859.1"
FT                   /translation="MRFGARWCRQRRMEAASEPVPAIRIRDLVKRYAPTGKAQKQGGGK
FT                   LALDGVSFDVPQGQIFGLLGPNGAGKSTLINTLAGLVMKTSGTVEIWGHDIDRDVRNAK
FT                   ASIGIVPQEIVFDPFFTPAEVLENQAGLYGVPKAMRRTMELLRAVHLADKADAYARSLS
FT                   GGMKRRLLIAKAMVHQPPVLVLDEPTAGVDVELRRQLWELVGELNRDGVTVVLTTHYLE
FT                   EAEELCDRIAIINHGRLIANKPTRELVDMAREKIVVLTLDRDVDVAPQHPVFLKSVISG
FT                   ERQIEIGYDKDRMNAGEVMSLVQGQGYAIVDVSTREADLEDVFVTLTSQPREDG"
FT   gene            452294..452494
FT                   /locus_tag="Saro_0412"
FT   CDS_pept        452294..452494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24860"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB3"
FT                   /protein_id="ABD24860.1"
FT                   /translation="MIQPPETVFTDHHRVKCDGASDIRGGAALGHPRVWLEIDEKGYVE
FT                   CGYCDKRFVLKGGPADTAAAA"
FT   gene            452563..454002
FT                   /locus_tag="Saro_0413"
FT   CDS_pept        452563..454002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0413"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24861"
FT                   /db_xref="GOA:Q2GBB2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB2"
FT                   /protein_id="ABD24861.1"
FT                   /translation="MTDPDTRSLLYRSGLLTPDDARRLTRDALTACDDGELYLQFIASE
FT                   SFGFDDGRLKTADYSRDAGFGLRGVSGEMTGFAHANEISAAAIARAGETLKLLDPAKGQ
FT                   PAPPPRNNNRHLYTEASPLDAVPFEAKVRLLESIDAAARARDPRVVQVSASLAGSWSVV
FT                   EIVRPDGFVAHDVRPLVRLNVSIVAEKDGRRETGSFGIGGRRLYDDLFAPETWSRAIDE
FT                   ALSQALVNLESVAAPAGEMTVLLGPGWPGVLLHEAVGHGLEGDFNRKGTSAFSGRIGQR
FT                   VAAPGVTVIDDGTLLGVNGQGRRGSLSIDDEGTPTQENILIEDGILKGYIQDRLNARLM
FT                   GVAPTGNGRRESYAHAPMPRMTNTFMRAGNDDPAELLSRVKNGIFAKSFGGGQVDITSG
FT                   KFVFSCTEAYHIENGRLGAPIKGATLIGDGPTCLTKVTGIGNDLALDEGVGVCGKGGQS
FT                   VPAGVGQPTLLVEGLTVGGTA"
FT   gene            454077..454475
FT                   /locus_tag="Saro_0414"
FT   CDS_pept        454077..454475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0414"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24862"
FT                   /db_xref="GOA:Q2GBB1"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB1"
FT                   /protein_id="ABD24862.1"
FT                   /translation="MPYACHCHGCQRRQGTSFALNQQVLLAGFVAEGEVLVSEVEGHGG
FT                   ARVAHHACPRCLTRVWTVNDQRPEVATIRTGTRDDSPDLVPAFHIWTSRMQPWIALPEG
FT                   AVHFAQQPESREEWMNLVLPEGLREHPR"
FT   gene            454543..454965
FT                   /locus_tag="Saro_0415"
FT   CDS_pept        454543..454965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24863"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBB0"
FT                   /protein_id="ABD24863.1"
FT                   /translation="MKRTASILAAALAAGSLLAAGTAADAKPRLTAEQQLAKALEGRVA
FT                   GEPVDCIFTPRVTSTRIYDKTAIVYDAGSTIWVNRPDSGASALDNDDILVTRQFGAQLC
FT                   NVDVVHMVDRTGGFWRGSVGLGKFVPYKKVKVAQAH"
FT   sig_peptide     454543..454602
FT                   /locus_tag="Saro_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.764 at
FT                   residue 20"
FT   gene            455007..455561
FT                   /locus_tag="Saro_0416"
FT   CDS_pept        455007..455561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0416"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24864"
FT                   /db_xref="GOA:Q2GBA9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA9"
FT                   /protein_id="ABD24864.1"
FT                   /translation="MTLRLATAADAAAIADLGRRAFIAKFGHLYSAENLAAFLDDAHTA
FT                   AKVSGELANPDMKVAVIEEDGRLASFCKIVRTSGLPRHTAAKKPMELKQLYTDPDLIGR
FT                   GHGARLMDWALAEARAWGADEIQLSVYADNPQAQKFYRRYGLEKVADIEFWVGDHCDPE
FT                   FMFAGPLQLPAEARNPGPMCR"
FT   gene            455622..456746
FT                   /locus_tag="Saro_0417"
FT   CDS_pept        455622..456746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0417"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24865"
FT                   /db_xref="GOA:Q2GBA8"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA8"
FT                   /protein_id="ABD24865.1"
FT                   /translation="MSSVRPWRDIARRKSRQIMVGTVPVGGDAPITVQTMTNTPTSDAV
FT                   ATIDQIRRCEEAGADLIRVSCPDVESTAAFRQIARAARVPLIADIHFHYKRALEAADAG
FT                   AACLRINPGNIGSSDRVAEVVRAAKANGCAIRIGVNAGSLEKDLLEKYGEPCPEALVES
FT                   ALDHIKLLQDHDFHEYKVAVKASDVFLAVAAYMGLAEAVDCPLHLGITEAGGLIGGTVK
FT                   SSVGIGNLLWAGIGDTLRVSLSAEPEEEVRVGFEILKTLGLRTRGVRVVSCPSCARQGF
FT                   DVIRTVEALEKRLTHIKTPISLSVLGCVVNGPGEARETDIGLTGGGNGKHMVYLSGVTD
FT                   HHVQSEDMLDHIVSLVEQKAAEMEAAAAEAEAAA"
FT   gene            complement(456748..457443)
FT                   /locus_tag="Saro_0418"
FT   CDS_pept        complement(456748..457443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0418"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24866"
FT                   /db_xref="GOA:Q2GBA7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA7"
FT                   /protein_id="ABD24866.1"
FT                   /translation="MSLRRTLSELAAFLRKPTVLRGQGLRAPGAWRLWTTLTVFQILVL
FT                   CAVVVQAMLLWQKAFGLPSPDAFDGMSPLALWGGAVILAPVLEELFFRAWLGGRPRALA
FT                   ALAVTVAGLAAFVALGRGKPLIGLPILAATALAACVLWWKLRRREDIPPRFASAFPAIF
FT                   YGTVLVFAALHLANYPQVSLLALPMVLPQAWTGVMLGYIRVRIGLVAAILTHVASNAVV
FT                   LSLALATGT"
FT   gene            457574..458338
FT                   /locus_tag="Saro_0419"
FT   CDS_pept        457574..458338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0419"
FT                   /product="protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24867"
FT                   /db_xref="GOA:Q2GBA6"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBA6"
FT                   /protein_id="ABD24867.1"
FT                   /translation="MAGHSKFKNIMHRKGAQDKKRSAMFSKLSREITVAAKMGMPDPDM
FT                   NPRLRAAINAAKAQSMPKDNIARAIDKASKGEGDNYEEVRYEGYGPGGVAIIVEALTDN
FT                   RNRTATNVRTAFAKNGGNLGASGAVSHGFERLGLIEYPGKVGDEEKVLEAAIEAGAEDV
FT                   ESDMGDGDENPGSHQIWVAVESLHEVARELEKTLGEAEGVKLAWKPSMKTSVDADNAAT
FT                   LLKLIDVLEDDDDVQTVWGNYDIPDDVMETLG"
FT   gene            458344..458694
FT                   /locus_tag="Saro_0420"
FT   CDS_pept        458344..458694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24868"
FT                   /db_xref="GOA:Q2GBA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA5"
FT                   /protein_id="ABD24868.1"
FT                   /translation="MWQLAAKALLSGVLIAAIAEIGKRLPALGALVASLPLVSVLGMVF
FT                   LWNARPDAENMAIHAEATFWYVLPSLPMFLVIPALLRHGVPFWISLIAGCLLTVLLYLA
FT                   MMQLAPRIGLKL"
FT   gene            458696..459172
FT                   /locus_tag="Saro_0421"
FT   CDS_pept        458696..459172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0421"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24869"
FT                   /db_xref="GOA:Q2GBA4"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBA4"
FT                   /protein_id="ABD24869.1"
FT                   /translation="MIILGIDPGLTVTGWGVVAKSGSRLSHVANGQIRTDNKATMAERL
FT                   VELDSALAAVIDIYKPDTGAVEEVFVNVNPQSTLKLGQARGVAMVAVARSGIPVAEYPT
FT                   KVIKKALVGTGGAEKQQIQHMLKILLPGVQLAGEDASDALAVAITHANMLGSHR"
FT   gene            459269..459883
FT                   /locus_tag="Saro_0422"
FT   CDS_pept        459269..459883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0422"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24870"
FT                   /db_xref="GOA:Q2GBA3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBA3"
FT                   /protein_id="ABD24870.1"
FT                   /translation="MIAKLTGILDDTGPDWAVIDVNGVGYLVHCSAKTLTHLGLRGDKV
FT                   VVHTEMQVSETDQRLIGFTSAGERAWFRLLTAVQGVGSKVALAILSALSVEELQRACAH
FT                   GDSAMVARANGVGPKLASRIVNELKDKAGGLAGYASPVGPGGEAFVAPPGNASADAVSA
FT                   LQNLGFKPAVASSAVAAAVKELGEDAGLNDLVRVALKRAAG"
FT   gene            459887..460915
FT                   /locus_tag="Saro_0423"
FT   CDS_pept        459887..460915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0423"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24871"
FT                   /db_xref="GOA:Q2GBA2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GBA2"
FT                   /protein_id="ABD24871.1"
FT                   /translation="MTDNPLLSSASQIEDQDAALRPKTLAEFVGQAGAKDNLQVFIESA
FT                   KQRREAMDHVLFFGPPGLGKTTLAQIIARELGVNFRATSGPVIAKAGDLAALLTNLEHG
FT                   DVLFIDEIHRLNPVVEEVLYPAMEDRALDLIIGEGPSARSVRIDLPPFTLIGATTRQGL
FT                   LQTPLRDRFGIPVRLQFYSVEELERVVARGASLMGIGIDKGGATEIARRSRGTPRVAGR
FT                   LLRRVRDFAQVAGAEKITQSIADNALTRLEVDKIGLDLQDRRYLTMIADIYKGGPVGVE
FT                   TLAAGLSEPRDTIEEVIEPYLIQLGMIARTARGRCLNDRGWQHLGLAPPSGQMPGLFGP
FT                   DE"
FT   gene            461134..462072
FT                   /locus_tag="Saro_0424"
FT   CDS_pept        461134..462072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24872"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA1"
FT                   /protein_id="ABD24872.1"
FT                   /translation="MSVRMALAKLAAAAAGGAMLGGGAVHVSEAPSKGEIHHVKPVKVK
FT                   KAKPAKRVVARRAAPREVHRARRVVTTTTTRTCEPAQQMAMVPVPYMPPMPPQPVGGSG
FT                   GGVPVVIGGGGIGGFGGGFFGGFFGGGSSGGSVVVSSTSTGSTSTSGGSTSTSGGSTST
FT                   SSGGSSTTTGGVSTSTGGVSTSTSTSSGNVSTSSGSVSTSSGNVSTSSGNVSTSSGNVS
FT                   TSSSTSTSSGNVSTSSSTSSSTSSSTSSSTSTSSSTSSSTSSSTSSSNGGTTTSSTSGG
FT                   TEVPEPSMVILFGAAAAGLVARRRYGKPKSA"
FT   sig_peptide     461134..461217
FT                   /locus_tag="Saro_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.983 at
FT                   residue 28"
FT   gene            complement(462232..464904)
FT                   /locus_tag="Saro_0425"
FT   CDS_pept        complement(462232..464904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0425"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24873"
FT                   /db_xref="GOA:Q2GBA0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GBA0"
FT                   /protein_id="ABD24873.1"
FT                   /translation="MTQVGQDTLGTRSTMNVGGKEFAYYSLKKASEKFGDISRLPFSMK
FT                   VLLENLLRFEDGGFTVSTDDVKAVVDWQKNPAESNNEIQYRPARVLLQDFTGVPCVVDL
FT                   AAMRDAIATLGGDTSKINPLVPVNLVIDHSVMVDEFGHPKAFEENMEIEYQRNMERYDF
FT                   LKWGSKSLNNFYAVPPGTGICHQVNLENIAQTVWTSTDQNGATVAYPDTCVGTDSHTTM
FT                   VNGLGVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKFTGELKEGVTATDLVLTCTNLLR
FT                   KHGVVGRFVEYYGPGLAALSLADRATLANMAPEYGATCGFFGIDEKTLDYMRLTGREEA
FT                   QIALVEAYAKEQGFWIDPSVEPIFSSTLELDLGTVVPSLAGPKRPQDRVSLPEVDDVFN
FT                   ADMANTYKKTPTRVPVEGKDFDIGDGDVTIAAITSCTNTSNPGVLVAAGLVAKKANELG
FT                   LKPKPWVKTSLAPGSQVVTDYLNKAGLQEHLDAVGFNLVGYGCTTCIGNSGPLAEPISK
FT                   AINDNGLVAAAVISGNRNFEGRVSPDVRANFLASPPLVVAYALKGTVIEDFTTTPIGKS
FT                   KDGADVYLKDIWPSNSEVATTMAGCMDRAMFQARYADVYKGDAHWQAINVTGSETYSWR
FT                   AGSTYVANPPYFEGMSMTPAPVSDIIDAKPLLILGDSITTDHISPAGSIKADSPAGKWL
FT                   MEHQVAKADFNSYGARRGHHEVMMRGTFANIRIKNEMVPGVEGGFSRYGDEVGSVYDVA
FT                   MKHKADGTPTVVIAGKEYGTGSSRDWAAKGTNLLGVRAVIVESFERIHRSNLVGMGVLP
FT                   LQFKEGQNRTSLALSGDDTFTIKGVANLQPRQDVEVEVTRKDGTKLTFTALCRIDTANE
FT                   VEYFMNGGILHYVLRKLAS"
FT   gene            complement(465142..466032)
FT                   /locus_tag="Saro_0426"
FT   CDS_pept        complement(465142..466032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0426"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24874"
FT                   /db_xref="GOA:Q2GB99"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB99"
FT                   /protein_id="ABD24874.1"
FT                   /translation="MNDHRVPLLPVLAALFGLALFSLMDGVMKAASLAIGAYAAMCWRG
FT                   LAGSLLMLPLWLWRGQGWPAWTTLKVHLLRGSVASIMATLFFYGIVRLPLAEGIALSFI
FT                   APLIALYLAALLLGEKVRRSAIGGSVLALAGVIVIAGGKFDGPADAEAVKGLVATLVSA
FT                   VLYAWNLVLQRQQALLAKPEEVAFFQALVQFGFLGLGAWWLAPFPTGTVWWLLIVSALL
FT                   SAASLMLLSWAYGRAEAQVLVPLEYTAFIWAAIVGWVAFAEPVTASMLAGVTLIVAGCL
FT                   YATRKGGTAPAVKAA"
FT   gene            466174..467673
FT                   /locus_tag="Saro_0427"
FT   CDS_pept        466174..467673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24875"
FT                   /db_xref="GOA:Q2GB98"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB98"
FT                   /protein_id="ABD24875.1"
FT                   /translation="MTAPAAKMRVNGEVRKVKRANLGAGLSGMLGVAVVALTFASQPLA
FT                   AKAGTQAGSQAGTQAGTQAGTQAGPVDLTKQAKPAPVVAPTATPTAAPAASPTVSPTAA
FT                   PVEAPTPVPAPHWTQSDAQGLLAMIKGIGAEGLFPRDYQPEALSAAILKGEGPELDETA
FT                   TRLFTWLAEDLRDGRTPMTARVQWFAVDPDQDVHPTSLILADALARHDVKGALMALLPT
FT                   VPDYAALKAALPKAQTQKQAALIRANMDRWRWLARDLGTQYLLANVPEQVLRLTVRNKI
FT                   ISTYKVIVGKPGKTATPQLAETVEGVIFNPTWTVPQSIVVGEGLGARLVNNPRQAEREG
FT                   YKVTKAGDGTIYVVQQPGDNNSLGRMKLDMPNEHAIFLHDTPNRNLFNLPARALSHGCV
FT                   RVERATELAMTMAILGAGMTPDDAVAAHTSKVYTKVPMTKTFPVYLTYFTVARDVNGML
FT                   RSFPDIYNRDAPVLATFAQPRQLHTTQRKSNEEVIKLDNPL"
FT   sig_peptide     466174..466314
FT                   /locus_tag="Saro_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.400 at
FT                   residue 47"
FT   gene            complement(467869..468492)
FT                   /locus_tag="Saro_0428"
FT   CDS_pept        complement(467869..468492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0428"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24876"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032676"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB97"
FT                   /protein_id="ABD24876.1"
FT                   /translation="MSIEVDRRTVIAGVAASAAAAVFPPRVAAATYYPTEQHRRVLEIA
FT                   KEQVERHRASLWRTDIVAIADFALPSSLPRFHFANLDRGEVRSFLVAHGRGSDPEHDGF
FT                   LKTFSNDVGSLATSRGAYVTYEWYKGKYGTSIRLGGLSPENSNVLDRAIVLHPAWYADP
FT                   AMLDKWGKLGRSDGCFAMSETDFNEALWHLSGGRLIYADRLGLG"
FT   sig_peptide     complement(468403..468492)
FT                   /locus_tag="Saro_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.900 at
FT                   residue 30"
FT   gene            complement(468544..469047)
FT                   /locus_tag="Saro_0429"
FT   CDS_pept        complement(468544..469047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0429"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24877"
FT                   /db_xref="GOA:Q2GB96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB96"
FT                   /protein_id="ABD24877.1"
FT                   /translation="MSISIRAATPDDLPLVARLVRALAEYEKLAHEVRFDEAVLGEKLF
FT                   GPRPYAEVAIGEIDGEAQGFALFFHNFSTFEGKPGIYLEDLFVQPAARGSGLGKALLSH
FT                   LAALATERDCARLEWSVLDWNEPAIGFYKSLGARLMDEWTVMRVDGDALARLGANAGNS
FT                   VEIA"
FT   gene            complement(469082..469318)
FT                   /locus_tag="Saro_0430"
FT   CDS_pept        complement(469082..469318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24878"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB95"
FT                   /protein_id="ABD24878.1"
FT                   /translation="MADSADDRLRLLIERIERLEEEKKGIGDDIKDVYNEAKATGYDAK
FT                   IMRQIVRLRKMKPDDRREMEAVLETYKNALGID"
FT   gene            complement(469415..469723)
FT                   /locus_tag="Saro_0431"
FT   CDS_pept        complement(469415..469723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0431"
FT                   /product="protein of unknown function DUF1244"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24879"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB94"
FT                   /protein_id="ABD24879.1"
FT                   /translation="MDTNAIDELPDAVAAAAFRRLVKHLQHRHDAQNIDLMGLAGFCRN
FT                   CLADWIVDGGFEGDKAAAREVIHGLPAAEWKARYQTEATPEQLARMDESLKKNAGAH"
FT   gene            469798..471252
FT                   /locus_tag="Saro_0432"
FT   CDS_pept        469798..471252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0432"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24880"
FT                   /db_xref="GOA:Q2GB93"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB93"
FT                   /protein_id="ABD24880.1"
FT                   /translation="MAKLDPRGRKVKILATVGPASRDPEMLEKLFRAGADAFRVNMSHG
FT                   EHAIHAETIANIRALEKKVNRPITILCDLQGPKLRVGKFKDGRAVIRHSGHFTLDRNPE
FT                   PGDETRVCLPHPELFGVLHKGQRLLIDDGKLRLRVIRADENEILCSAEVGGVISDRKGV
FT                   NVPDAVVPVPALTDKDRRDLSFAVEQGADWIALSFVQRPEDVAEARRLLGGHGSLMAKI
FT                   EKPAAISRLEEIVELSDGIMVARGDLGVELNPEEVPPLQKRIVETARRQGKPVVVATQM
FT                   LESMIEAPTPTRAEVSDVANAVYDGADAVMLSAETAAGAWPEEAVTIMHRIAAQVEADP
FT                   GYGARVHFLETLPDPTTADALAQAAASITETLPISGIIVFTGSGSTARRVARERPGVPM
FT                   LVLTPSHKTARKVGLLWGAHAVSTKDIGSFEEMIAKGKRMALRHGFGSAGSKLVALAGV
FT                   PFGTPGATNLLHVVTLTGDELTRHGE"
FT   gene            complement(471309..471884)
FT                   /locus_tag="Saro_0433"
FT   CDS_pept        complement(471309..471884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0433"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24881"
FT                   /db_xref="GOA:Q2GB92"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB92"
FT                   /protein_id="ABD24881.1"
FT                   /translation="MTLVAVSKTKPAEAILDLVAQGQRVFGENRVQEAQAKWPAIRAAH
FT                   PDISLHLIGQLQSNKAEDAIALFDCIHSLDRPSLVAALAKAQDKLGKRVPCFVQVNIGA
FT                   EEQKGGCAVADLPALLADAREKGIDVVGLMCVPPAGIEAAPFFALLDKLADDNGLSGLS
FT                   MGMSDDLETAVQLGATHVRVGSALFGER"
FT   gene            471997..472533
FT                   /locus_tag="Saro_0434"
FT   CDS_pept        471997..472533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0434"
FT                   /product="thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24882"
FT                   /db_xref="GOA:Q2GB91"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB91"
FT                   /protein_id="ABD24882.1"
FT                   /translation="MAKRQTIQRARAPHLILLSDARNDAALARAIARLPRGSALVFRHY
FT                   HLPAHERRRRFAELRRLARARGISMIGARVPTAWGGEGVYGTAREVAGRRGIRLATAHS
FT                   LGEVAAAARAGADAVLLSPVHPTRSHPGAPVLGPVRFLLLARRSPLPVIALGGMTARRA
FT                   ARLPVHGWAAIDGLA"
FT   gene            472628..475009
FT                   /locus_tag="Saro_0435"
FT   CDS_pept        472628..475009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0435"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24883"
FT                   /db_xref="GOA:Q2GB90"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB90"
FT                   /protein_id="ABD24883.1"
FT                   /translation="MASRAGSNARGSGADWRAVLRRSLRRSLELIGGGVLAAAMLFLAL
FT                   ALVSYTQTDPSGSTASGSPVENWMGLAGAWTAERVLLFFGLPGALLLPLLWVFARRLWD
FT                   AESDLIDIDDDDEAPPPQRWWRPALLLLLAMALIGTALALWGAGSSSRLPAGPGGLAGL
FT                   LGATLVNALAGLVPQVSPLWFSVPVGLATLGGGIALASRIFAFDWARMASLPSFLHRRE
FT                   RVEKTGDEVPFEPTPRKEKREKEARAAAEAVDVEAALAPRKPTEITDPSRAPAPAAVQS
FT                   KARQGDLFDKYELPSIELLVEAPAGSAQKIDKLALERNARLLENVLDDFNVKGEITAVR
FT                   TGPVVTMYELEPAPGIKASRVIGLADDIARNMSAISARVSSIPGRTVMGIELPNAIRDM
FT                   VSFRELVACEKFASSKALLPIILGKDISGDPIVADLATMPHLLVAGTTGSGKSVGLNCI
FT                   LLSLLYRLTPAQCRLILVDPKVLELKSYDDIPHLLSPVVTEPGKAVRALKWAVEEMERR
FT                   YRQMSSIGVRNISGFNEKVRAAQAKGKPLGRRIQVGFDPDTGEELFEEQQLDYEVLPQI
FT                   VVIVDELADLMVTVGKEIEVLIQRLSQKSRAAGIHLIMATQRPSVDVITGVIKANLPTR
FT                   ISFAVTSRIDSRTILGEQGAEQLLGKGDMLYKPNTDPIKRVHGPFVSDEEVEKVADHWR
FT                   SQGSPEYVDSVTEEPEDGGFGFDDIDSASDNPEDRKYRQVCQLVFESQKASASWIQRQM
FT                   GVGYNTASKWIERMEADGLVGPANHVGRREIYRDKDGNPL"
FT   gene            complement(475017..475415)
FT                   /locus_tag="Saro_0436"
FT   CDS_pept        complement(475017..475415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0436"
FT                   /product="thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24884"
FT                   /db_xref="GOA:Q2GB89"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB89"
FT                   /protein_id="ABD24884.1"
FT                   /translation="MSNRHTLTFTAGPEHIDELGHVNNAVWVTWIQDIATSHWSAVAPQ
FT                   AHQEAYVWVVTRHEIDYRGNIGPGESVTAETFIPEGPTGARFDRCVEFRNGQGRVIVSA
FT                   RTTWALIDRASGRLLRVPREVAATFLGT"
FT   gene            complement(475412..477487)
FT                   /locus_tag="Saro_0437"
FT   CDS_pept        complement(475412..477487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0437"
FT                   /product="oligopeptidase B, Serine peptidase, MEROPS family
FT                   S09A"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24885"
FT                   /db_xref="GOA:Q2GB88"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB88"
FT                   /protein_id="ABD24885.1"
FT                   /translation="MQRMTLATPPVAARKPHSFSHHGLTVSDDYFWLRDPGYPDVTDKD
FT                   VLAHLEAENAWFETRMAAQKPVIDKLFKEMRGRIKEADKSVPQKDGNFLYWIEYEDGAE
FT                   YKKWWRRPVGAPDDGSADELILDEVALAEGKEYFRLGAIAVSNDGTRLAWSVDDNGSER
FT                   FTARIKVIATGEILPDEIPGTLSGLIWVKNDTGLVYSLANENWRTDNARLHWIGQPLES
FT                   DVELYHEDDEGFRVSAALSANEKWLIIATGDHETGEVRLVPANDPLAPPLLVKPRQRGV
FT                   EYDVDEREGVLYIHTNDTHENFRLATAPLSDPGNWTTLIEGTQDFYLTGFELFRDFYIV
FT                   EGRVRGLDRIEVRYYDDPTRIEPIEFPEASYEASLGDNPEWAMQVLRVGYESMVSPSSV
FT                   FDYDVATRHLTLLKVQEIPSGYDASLYETTRLEIAARDGTMVPVSVVWRKDRQPGGPLH
FT                   LYGYGAYGIAIGPGFSTTRLSLVDRGFAYAIAHIRGGDDLGRAWYKAGKLEARTNTFND
FT                   FVDVAKGLIERGFTEAGKISISGGSAGGELMGAVINSDPDLWGAVVAHVPFVDVLATML
FT                   DEDLPLTPGEWPEWGNPIEDKAAFELIRSYSPYDQVKPQAYPPLMVTAGLNDPRVTYWE
FT                   PAKWVARLRELKTDENELILKTNMGAGHGGKSGRFESLKETAEEFAFILWQLGVAA"
FT   gene            477544..479349
FT                   /locus_tag="Saro_0438"
FT   CDS_pept        477544..479349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0438"
FT                   /product="peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24886"
FT                   /db_xref="GOA:Q2GB87"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB87"
FT                   /protein_id="ABD24886.1"
FT                   /translation="MLMHTHEARLDALRKQLAKDGLDGFVIPISDEHMSEYVGAYAQRL
FT                   EWLTGFGGSAGTAVVLANEAAIFVDGRYTLQVRDQVDGSLWSYQSVPQTSVAAWLGEHA
FT                   PKGARIGYDAWLHSKGWAQAAQKALADRGATLVPVSANPVDAVWQDRPAPSLAPAIPHA
FT                   DEHAGKSASEKRAEVAEWLAARGLDAAVVTALDSVAWLLNIRGSDVDRTPVALSFVLAH
FT                   ADGTADLFIAPEKVTPALLAHLGNAVRVQPREAFVPALRALAGRKVAVDPERAVAAIFH
FT                   ALEDSGAEIVAETDPVVLPKALKNPVEQAGHRAAQARDGAAIARFLRWVAVEAPKGGVT
FT                   ELSAANRLQAFRAEGGLLRDLSFDTISGAGPNGAVVHYRVSEETSRVLEPNSVYLVDSG
FT                   GQYVDGTTDITRTVWIGPGEPPALVKDRFTRVLKGHIALARAVFPKGTAGSQLDSFARQ
FT                   FLWAAGLDYAHGTGHGVGSFLAVHEGPQRIAKASGGQAGTGQELMPGMILSNEPGYYKT
FT                   GEYGIRIENLVLVERREIEGAEGEFYGFETLTFAPIDRALVDVALLSGEEREWLNAYHA
FT                   SVRAVLAPQLGGEDREWLVRACAPL"
FT   gene            479405..479773
FT                   /locus_tag="Saro_0439"
FT   CDS_pept        479405..479773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0439"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24887"
FT                   /db_xref="GOA:Q2GB86"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB86"
FT                   /protein_id="ABD24887.1"
FT                   /translation="MIGYVTVGTNDLERSAAFYDAIAAEMGVGRMMEFPTGIAWGVPGG
FT                   AAGIAAMKPFDGNAATVGNGVMVALEAKDNAQVDRLHAIALAHGGSDEGAPGLRGGGFY
FT                   AAYFRDPDGNKLNAFVMG"
FT   gene            480001..480681
FT                   /locus_tag="Saro_0440"
FT   CDS_pept        480001..480681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0440"
FT                   /product="Calcium-binding EF-hand protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24888"
FT                   /db_xref="GOA:Q2GB85"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB85"
FT                   /protein_id="ABD24888.1"
FT                   /translation="MKKFQLAAAAAVMATASVALYAASPAIAQKMDADGDKTITWAEAK
FT                   AKSDEMWTKLDVNKDGKLDQADRAAKWAEKFAEIDTDKNGSISRDEFIAHHEAMKDRMG
FT                   DMPGDRPDASPGERPGGHPDGMPGHEGHRGKRGPGGHHGMMGGGMHMLGMADANKDGTV
FT                   TRAEFDAAAKAHFDKADANKDGKITPEERRAAMKEMMGKMGRPGERGPMGAMGDGPPPP
FT                   PPAN"
FT   sig_peptide     480001..480069
FT                   /locus_tag="Saro_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.891 at
FT                   residue 23"
FT   gene            480687..481424
FT                   /locus_tag="Saro_0441"
FT   CDS_pept        480687..481424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0441"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24889"
FT                   /db_xref="GOA:Q2GB84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB84"
FT                   /protein_id="ABD24889.1"
FT                   /translation="MNEAPIRILLVDDEPALREPLADYLVRQGFVVTQAGTAAEARSRL
FT                   LETGCDLVLLDIMMPGEDGLSLCRHLVESKRLPVIFITAKGESTDRIVGLEIGADDYVV
FT                   KPFDPRELVARIRSVLRRATKQSSEVSDEVIYEFEGWRLDPLKRRLIDAEGAVVAISSA
FT                   EFRLLMAFLDHPRQVLDRDRLLDMVQGREAHLFDRAVDNQISRLRRKIEVDSRNPELIQ
FT                   TVWGGGYMLAAEVRKRAAVEGEA"
FT   gene            481428..482825
FT                   /locus_tag="Saro_0442"
FT   CDS_pept        481428..482825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0442"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24890"
FT                   /db_xref="GOA:Q2GB83"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB83"
FT                   /protein_id="ABD24890.1"
FT                   /translation="MRALRLWPRSLQGQVLLAIAFALLIAQTISAVLIWREQSHRRESG
FT                   MVSSAAFRLLGPPPEMRRKHHGDDDERPPPPPFRVDVTDRSPQRPGERRLPRVEHELAE
FT                   VLTAQGYDAAQVVVFQRDPLQDEPSLEFMRRHRRELAAVSKEPMPRLVIAAVRQSSGQW
FT                   VSTRVFSEGGEMRVLAPLVGQTIVLYFVLVGVMALILRRITRPLKALTRRVGDFASNRT
FT                   LDGQLEPEGPEDIQGLIDAHNAMEARIAAMLDEKDVMLGAIGHDLKTPLAALRVRIEAV
FT                   DDDTERARMAATIEDINRSLDDILSLARVGRPSDPVEPTELSALVADVIGEFEDMGEPV
FT                   ELGDTERVVVPLRATWLRRALRNLVSNAMRYGERARVSLARDGRTAVLRIEDDGPGIPE
FT                   GEIARMMEPFTRLEASRNSGTGGTGLGLTLARAIADQHGGTLILTNRHGPGGEIVGLTA
FT                   TVRLPTG"
FT   sig_peptide     481428..481523
FT                   /locus_tag="Saro_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.739 at
FT                   residue 32"
FT   gene            482963..485629
FT                   /locus_tag="Saro_0443"
FT   CDS_pept        482963..485629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0443"
FT                   /product="peptidase M1, membrane alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24891"
FT                   /db_xref="GOA:Q2GB82"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB82"
FT                   /protein_id="ABD24891.1"
FT                   /translation="MRTISLVSALALSIACLAVPATAQQAPANPSAAAGVHTDLPRVAH
FT                   PSHYAISITPDATNLTFTGTSSVDLEVTEASPVLTLHALDLKIASATLTPAGGAAMPVT
FT                   VTMDAASQTARFAAAQPLAPGKYRLDTTYSGVINTQANGLFALDYPDKVTGKDVRGLFT
FT                   QFEAPDARRFAPMFDEPIYKATFDLSAVVPSNRMAISNMPTIKEEDLGKGLKRVTFGTS
FT                   PKMSSYLLFFALGDFERMAKEAAPGVQAGIVAPRGSGEQPRFALDELAPLIPYYSEYFG
FT                   QPYPLPKLDNVAAPGQSQFFSAMENWGAILTFERILLNDPAITSASARQNIVTTQAHEV
FT                   AHQWFGNLVTMAWWEDLWLNEGFASWMETKATAHFHPDWFPLLGRVEGREAAMGLDGFK
FT                   TTHPIVQEIKTVDETNQAFDAITYQKGEAVISMLESFAGETVWRDGLRAYMRDHKFANT
FT                   RSRDLWQAVEKAGAPGLTSVATDFTTKPGIPLVKVTGLTCRKGVSTVMLEQGEFSIDRK
FT                   DQVAGQPQQWKVPLLVSAGGEATRTILDGGKGTVTVNGCGPVVINAGQLGYYRSLYTPK
FT                   MLASLKTAMPSLQPVDQMGLIADNLALSTSGYQPYAPALDLLAAVPGNANPVVASSAFG
FT                   RYVGAWRTLEKDPATQKRLAAKVAATWKPRLMTLGFDPKANESLPDADLRSTLISGFGT
FT                   MGDPDVVAEARRRFAMLASNPKALDGPQKTTWLNIVARNATKADWDAIRQMAAASNSAV
FT                   ERQFLYTLLGRPADPALAAAARDLALTDVPGKTTSAAMIVAAAGLHPDATYDFAVANRA
FT                   KIEGLVDAQSRVTFIASLANASNDPAMLAKLEAFKATVPAEASRPVDRVIGGLTERAKA
FT                   RPLFVKGLTDWLNARKK"
FT   sig_peptide     482963..483034
FT                   /locus_tag="Saro_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            complement(485699..487273)
FT                   /locus_tag="Saro_0444"
FT   CDS_pept        complement(485699..487273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0444"
FT                   /product="protein of unknown function DUF853, NPT hydrolase
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24892"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB81"
FT                   /protein_id="ABD24892.1"
FT                   /translation="MDDIYLGLGSNGERQVLRLGRANRHGLIAGATGTGKTVTLQGIAE
FT                   QFSARGVPVFMADVKGDLAGIAMPGSPTFKHAASLEARAKELGIADYAYSDNPAVFWDL
FT                   YGESGHPIRTTISEMGPLLLARLMGLNETQEGVLNIAFRYADDNGLLLIDLADLQSVLV
FT                   ACAENASELATRYGNVSKASVGTIQRQLLAFESQGADRFFGEPAFEINDFLKVDEQGRG
FT                   MVNVLAAEKLMQSPKLYATFLLWLLSELFEALPEVGDPEKPCLVFFFDEAHLLFEDAPQ
FT                   ALMEKVEQVVRLIRSKGVGVFFVTQNPIDIPEKIAGQLGNRVQHALRAFTPRDQKAIRA
FT                   AAETFRINKDLDVETVITELKVGEALVSTLEEDGAPSVVQRTLIAPPRSRLGPLTPKER
FT                   AIIQSVSPFDGKYDTAVNRESAAEILARKASDAAAAAQQIEAEGEDSQRASARRSPSMW
FT                   ERAGKAAAGAVASSAGAVIAAQITGKKSRAAPMASGITAMAGSIASSIGGEAFGRFARG
FT                   ILGGLLR"
FT   gene            487393..489180
FT                   /locus_tag="Saro_0445"
FT   CDS_pept        487393..489180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0445"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24893"
FT                   /db_xref="GOA:Q2GB80"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB80"
FT                   /protein_id="ABD24893.1"
FT                   /translation="MTRAPFILLDDARSEGASDARLYEDAVEIVVARRAEEVEAALERI
FT                   AAVPGNWAGYLAYEAGLALEPRLLPLAAVRTGADGPLVWFARFDRVTRMPSAEVEQWLV
FT                   RNARGPGRLGPLGPALSSGGYARAFDLVQEAIRAGDIYQANLTFPLTGTWDGDPLSIYG
FT                   EVRRDARAGYGGVIWDGAHWHLSFSPELFFKLSGGEARVRPMKGTAPRGATPEEDARFK
FT                   ADLSASVKDRAENLMIVDLMRNDLARVSQAGSVKVEAPFAIESYPTVHQMVTTVRARLA
FT                   PGEDVRSLLRAIFPCGSITGAPKIRAMEIIHAAERDARGLYCGSIGRIDPTGEAAFNVA
FT                   IRTLRLSSDHAGASGGRAVMGVGSAVVADSAMIGEWRECVVKGNFLRLSAGHADLIETM
FT                   AFDPAKGIELLELHLERMKASALALGYSFDRHAVRNAIHALCFDLDAPSRVRLVVSKGG
FT                   AHALDASAMPAPIESLTCAVLSLPVSDGDWRLRHKTTDRAFYEAGLSAAKRAGAGEALF
FT                   LRDDGFLTEGTFTNIFVERDGILLTPRAELGLLPGVLRRSLIEAGRAVEADLTLDDLAG
FT                   GFLVGNALRGLIPARLLGA"
FT   gene            489185..490354
FT                   /locus_tag="Saro_0446"
FT   CDS_pept        489185..490354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0446"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24894"
FT                   /db_xref="GOA:Q2GB79"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB79"
FT                   /protein_id="ABD24894.1"
FT                   /translation="MNQLSRALARIAPSRTTAITDRAIQLRAEGRDVISLSVGEPDFAT
FT                   PAHVVQATKDALDAGDTKYTAVVGTAALRSAAALHFSRDLGLEVPPSQVIVSAGGKQAI
FT                   FHALLATLDPGDEVLIPSPWWVSYPEIVRFAGAEVVDLPTDAAGGFRITAAQLEAAITP
FT                   ATRWLLLNSPGNPTGATYPAQELRALGEVLRRHPRVLVMSDDIYAPLRYGEGRHATLAV
FT                   ECPDLADRILTVSGVSKSHAMTGFRIGVAAGPAWLISAMGRLQSHSSGNPASISQAAAV
FT                   AAFEGPQDFLLDWRERFRARRDMVCARVNAIPGLSTPVPDGAFYCMVDAAPLMARFGDD
FT                   EALCLHLLESGVAVVPASAFGGRDGFRISFAADEAKLEEALRRIEKAVA"
FT   gene            490351..491019
FT                   /locus_tag="Saro_0447"
FT   CDS_pept        490351..491019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0447"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24895"
FT                   /db_xref="GOA:Q2GB78"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB78"
FT                   /protein_id="ABD24895.1"
FT                   /translation="MIDFSILFEDGEALVIDKPAGLPLDRPRAGGDSLENHLDALRFGF
FT                   QREPFPVHRLDRDTSGCLLLARNPKALKRFSAAFEAREVEKVYLGIVAGEVTGEKGTID
FT                   LALSKVSSAEKGWRMIPARKGKPALTHWRVVARKPGLTLVEFRPETGRTHQIRIHALAG
FT                   LGHALVGDPVYGDGKGAWRTMLHASDLVVPRAGKAPIVAHAPLPLDFDAFGFELPDAGA
FT                   "
FT   gene            491021..491434
FT                   /locus_tag="Saro_0448"
FT   CDS_pept        491021..491434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0448"
FT                   /product="class I peptide chain release factor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24896"
FT                   /db_xref="GOA:Q2GB77"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB77"
FT                   /protein_id="ABD24896.1"
FT                   /translation="MSPDAIVAKALSLVEESFIASAGPGGQNVNKVATAVQLRLDVFAL
FT                   RLSPEVFHRVKALAGSKMTAKGEIVLTARSYRTQEQNREDARKRLAELLREACNLPQKR
FT                   AKSRLNRVGKVERLAGKKIRGAVKAGRGKVRLD"
FT   gene            complement(491483..492766)
FT                   /locus_tag="Saro_0449"
FT   CDS_pept        complement(491483..492766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0449"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24897"
FT                   /db_xref="GOA:Q2GB76"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GB76"
FT                   /protein_id="ABD24897.1"
FT                   /translation="MDKIIIRGGKRLSGAVPVSGAKNSALTLLPCALLTDEPVTLRNLP
FT                   RLADIDGFQHLMNQFGVSTSIAGARPEDFGRVMTLQATRLTSTVAPYDLVRKMRASILV
FT                   LGPMLARAGEATVSLPGGCAIGNRPIDLHLKALEALGAQIELAAGYVRAIAPDGGLPGG
FT                   RYSFPVVSVGATENALMAAVLAKGKSTLHNAAREPEIVDLCNLLVAMGAQIEGIGTSDL
FT                   TIHGVDRLHGATYMVMPDRIEAGSYACAAAITGGEVMLNGARIEDMEATVQALRDAGVH
FT                   VEPRKGGIYVAADGPLKPVTISTAPYPGFATDMQAQLMAMLCLAHGSSVLTETIFENRY
FT                   MHVPELNRMGARIETKGRTAVVHGVEKLTGAEVMATDLRASMSLVIAGLAAEGETQVHR
FT                   LYHLDRGYERLEEKLSLLGAEIERVGGD"
FT   gene            492864..493802
FT                   /locus_tag="Saro_0450"
FT   CDS_pept        492864..493802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0450"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24898"
FT                   /db_xref="GOA:Q2GB75"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB75"
FT                   /protein_id="ABD24898.1"
FT                   /translation="MHQEYETTFGYRGGMTLKEQRKPIRKAVFPVAGLGTRFLPATKAI
FT                   PKEMLPIIDRPLIQYAVDEAREAGIEQLIFVTGRGKTAIVEHFDTAYELEHTMRDRGKV
FT                   LDILAPTRIQPGNLVTVRQQVPMGLGHAIWCARAVVGDEPFAIFLPDEMMIGTPGCMKQ
FT                   MVDAYEDVGGNLISVLEVPAAEVSSYGVIAPGARVSDTLTEVKGLVEKPKREDAPSNLI
FT                   ISGRYILQPEVMRTLECQESGAGGEVQLTDAMARMIGRQPFHAVTFAGRRYDCGSKAGF
FT                   VEATLALALEREDMAEDVRAIMRRLLAQSGG"
FT   gene            complement(493816..494490)
FT                   /locus_tag="Saro_0451"
FT   CDS_pept        complement(493816..494490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0451"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24899"
FT                   /db_xref="GOA:Q2GB74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB74"
FT                   /protein_id="ABD24899.1"
FT                   /translation="MARGGNKQAEEPALAVETVSRKPQQGRSKASLERMLSAARELMLE
FT                   RGSEDFTLQDVNQRGNVSIGSIYLRFQSKENLVRAVIARALEDLAQAEEAMVEEVLGSS
FT                   ATLEEFMPRYVAGYAEVLRVNAPLLRLAMERASFDPLVSKPGKDHALRATALGMDAMLH
FT                   YRSSFGGSDHETKANSAYKIVFATLARQLSLGSSGEAAHDYDWEVLKRELGRMCLAYLR
FT                   AP"
FT   gene            494678..495793
FT                   /locus_tag="Saro_0452"
FT   CDS_pept        494678..495793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0452"
FT                   /product="oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24900"
FT                   /db_xref="GOA:Q2GB73"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB73"
FT                   /protein_id="ABD24900.1"
FT                   /translation="MRRLRMGMIGGGPGAFIGPVHRFAAELDREIELVAGVFSSDAGRS
FT                   AAAGESYRIDSARAYPSLEAMFAGEAARDDGIDFVSIVTPNHNHLPSARAALAAGYPVI
FT                   TDKPLTATLDEAHQLAGVVAAAGKPFGVTYTYSGYPLVREARARVAAGEIGTVRKVVVE
FT                   YPQGWLAGPAEGKQAEWRVDPARAGLGGCIGDIGVHAFQLAEFVTGLRVTELLADLGSV
FT                   VPGRLLDDDCSILLRFENGARGVLLASQIEVGELNGLRIRAYGDMGGIVWRQEEPNTLT
FT                   ISRLDGTCTLVRSGTGVLGADAASRTRTPGGHPEGYLEAFANLYRDFAAIVRGDAAPLL
FT                   PGIAEGVRGMTFIHKAVTASRENAGWVKLED"
FT   sig_peptide     494678..494752
FT                   /locus_tag="Saro_0452"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.963 at
FT                   residue 25"
FT   gene            495805..496860
FT                   /locus_tag="Saro_0453"
FT   CDS_pept        495805..496860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0453"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24901"
FT                   /db_xref="GOA:Q2GB72"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB72"
FT                   /protein_id="ABD24901.1"
FT                   /translation="MKTIKGPGIFLAQFAGDSAPFNSLETIADWAAGLGYKGVQIPSWD
FT                   GRLFDLEKAATSKDYCDEVKGMLAAKGIEITELSTHLQGQLVAVHPAFDAQFDGFAPAS
FT                   VHGNPAARQQWAVQQLKFAAQASRNLGLAAHASFSGAFAWPYFYPWPARPAGLVEDAFD
FT                   ELARRWKPILDVFDENGVDVAYEIHPGEDLHDGVTFEMFLERVGNHPRANILYDPSHFV
FT                   LQQLDYLAFIDIYHERIKCFHVKDAEFRPNGRSGVYGGYQSWVDRPGRFRSLGDGQVDF
FT                   AAIFSKMAANDYAGWAVLEWECALKHPEVGAAEGAPFIDRHIIRVTEHAFDDFAAGGAD
FT                   RALNARLMGIG"
FT   gene            497246..499669
FT                   /locus_tag="Saro_0454"
FT   CDS_pept        497246..499669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0454"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24902"
FT                   /db_xref="GOA:Q2GB71"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB71"
FT                   /protein_id="ABD24902.1"
FT                   /translation="MPKSTYTRALLAGACALAFALPAHAQDAAQATEAEDTNPNVIIVT
FT                   AQNRAQNLNDVPIKIDVVSGEELQKAGFASMNDVGQIAPVVQVNQDQGTVKVSVRGVGT
FT                   TSNDEAQDTSVVINIDGEYINRPNVMGMALFDIDRVEVLRGPQGTLYGRNSTGGAINFI
FT                   TRKPGKEFGVNGSISYGNYNAIRADAGIDLPLGEIAGLRVAGFYDERDGYSKHPAGGGF
FT                   FVFPAYAAGRSDDNKSYGGRASLRLEPTDRLSINLAAEYSHRSFTPGIFAAGDLNGAGN
FT                   GPTGGACNNGFTQVAPEYAQVLCVPSNTNLLSKVDRSNYAAPLFGIGHVSDHTWAARGR
FT                   IEYELSDAATITYIGGYRKYSGDPGRLTLPTIYQSFGYQDEAKTQSHELRINGTVGGVV
FT                   YQVGGFYFKEDLARESGFMLPSFVFADPLNDPSLFGKPGTFLSYFGRYVKSDSKSVFGQ
FT                   VEVPLGDKLTAIGGLRYTDNKRNATYLNVDPFRFSLETFSLVPDPYIVGAGPGRKDFSK
FT                   VMYLTTIPLKSSDSKVTWLAGLNFKPNSDTLIFVKASTGFKAGGFDSVGTYKPETNTAF
FT                   EGGWKQTFGDHGQHQFNLGAFYYDYKDLQVSVLLDTAIGGQIFNAGKAKIWGIEASADI
FT                   ALDDRTNFHASANYLNAEYKELLAQFNVFDTTGEINGVGDLDPNTDGIQQPNFAGNRPP
FT                   FSPEWVLTASLDHTFPLGDMGGLTARVNTTFKSKYFTDFYNYRDGTQSALSQTDASLEY
FT                   KPENEKFSITAFVKNIEGTRPLTYGSFVSAGPDDIFNWQFGTPRTYGVRLAVDF"
FT   sig_peptide     497246..497323
FT                   /locus_tag="Saro_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(499747..500358)
FT                   /locus_tag="Saro_0455"
FT   CDS_pept        complement(499747..500358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24903"
FT                   /db_xref="GOA:Q2GB70"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB70"
FT                   /protein_id="ABD24903.1"
FT                   /translation="MLRLSRQLDYGKPAPAFALPDVTGKIREIGEFADKPALLVAFICN
FT                   HCPFVLHILDGFIDFAREYEAKGLQVVAISSNWPDDYPDDDYPHMQKLAAERDFPFPYL
FT                   HDEDQDVALAYNAICTPDFFLYDRDRLLYYAGQFDASRPKINRPPVPGLPPLRTDLPVT
FT                   GEDMRRAVDALLAGDPAPQPQHPSAGCSIKWRPGKDPSWG"
FT   gene            500603..501355
FT                   /locus_tag="Saro_0456"
FT   CDS_pept        500603..501355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0456"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24904"
FT                   /db_xref="GOA:Q2G3G9"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G3G9"
FT                   /protein_id="ABD24904.1"
FT                   /translation="MKALVCVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEE
FT                   AIRLKEKGVVTEIVAVSVGPAKAQETLRTALAMGADRAVLVQVDDGVEVEPLAVAKIVK
FT                   GIADEEQPGLIITGKQAIDDDSNQVGQMVAALLGRPQGTFANEVSVEGDAVVVKREIDG
FT                   GLQTVRLALPAVVTTDLRLNEPRYASLPNIMKAKSKPLANKTPADYGVDVAARLKTLKV
FT                   SEPPVRSAGIKVADVDALVAKLKEMGVA"
FT   gene            501355..502287
FT                   /locus_tag="Saro_0457"
FT   CDS_pept        501355..502287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0457"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24905"
FT                   /db_xref="GOA:Q2G3H0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G3H0"
FT                   /protein_id="ABD24905.1"
FT                   /translation="MTKVLVLVEHDNASVKDATLAAVTAAGQLGEVTALVAGEGCDAAA
FT                   QAAAQIAGVAKVLKADDASLANALAENVAPLVAGLMAGYDAFVAPATTTGKNVAPRVAA
FT                   LLDVMQISDILSVEGPRTFTRPIYAGNAIATVESSDAKLVITVRGTAFAKAAATGGSAS
FT                   VESTGANGDSGLSTFVSAEIAKSERPELTSAKIIVSGGRALKDAATFEQVITPLADKLG
FT                   AGIGASRAAVDAGYVPNDYQVGQTGKIVAPEVYIAIGISGAIQHLAGMKDSKTIIAINK
FT                   DEDAPIFQVADIGLVGDLFTLVPELTGKL"
FT   gene            502433..503392
FT                   /locus_tag="Saro_0458"
FT   CDS_pept        502433..503392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB67"
FT                   /protein_id="ABD24906.1"
FT                   /translation="MTKARKVLVSALCFTALIGEAAVGREQVVLKPSGQWNINYADESC
FT                   QLARTFGVGDQKTLVQFERFGPENGFALMIVSPLLKFQENFRAVPNRMLHPTKRQYLDT
FT                   VFQFLPGGEPYKQPGIPAMDAASRQPTLMAFLSLEGPRKDAAPTATGTASASEDRKLTN
FT                   EERLALEKATNALLVEQPFNDPIRFELGSLAQPFATLAACTDDLVRSWGLQTDPEHAAV
FT                   NPPKPIGSPSEWFDDKKLAERVWSKRENAIIYFRMIVSDKGAPESCVIQDSSQTTELRD
FT                   LSCRALMGKARFTPGTNAAGQSVRSVYRGAVRYFTSRN"
FT   sig_peptide     502433..502507
FT                   /locus_tag="Saro_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.625 at
FT                   residue 25"
FT   gene            complement(503393..503857)
FT                   /locus_tag="Saro_0459"
FT   CDS_pept        complement(503393..503857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0459"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24907"
FT                   /db_xref="GOA:Q2GB66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB66"
FT                   /protein_id="ABD24907.1"
FT                   /translation="MARLRIVEDDLSGEAIRGLVALHLAGMHAHSPACKVHALPVEALR
FT                   QPGVTFYSAWMDDDLAGMGALRQIDPSHSEIKSMRVVPDFLGKGIGEAILLHLLAVARA
FT                   KGHARVSLETGTGPAFEPALRLYRKHGFNNCAAFADYVLDDFSQCLTLVL"
FT   gene            504045..504479
FT                   /locus_tag="Saro_0460"
FT   CDS_pept        504045..504479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB65"
FT                   /protein_id="ABD24908.1"
FT                   /translation="MNKLMLLPALALACATPLAAQDYPVVPGDYVTVSMITVEDGHDLD
FT                   YANHLAGMWRKGQDFAVKQGWINSYEIQTNENKRPGEPDYFLVTRFSKFADPAQEEARE
FT                   KAYNSYMAMTAAQMQAASGERAKYRKVMGSMLLRSWKWKN"
FT   sig_peptide     504045..504107
FT                   /locus_tag="Saro_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.955 at
FT                   residue 21"
FT   gene            complement(504527..505498)
FT                   /locus_tag="Saro_0461"
FT   CDS_pept        complement(504527..505498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0461"
FT                   /product="RDD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24909"
FT                   /db_xref="GOA:Q2GB64"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB64"
FT                   /protein_id="ABD24909.1"
FT                   /translation="MALANPFRRKGNTARTPAPLDHDARRRRMVNTPEGVPIPFLLASR
FT                   GARAGALFLDLAMIVGAMIGATLVLAKVADGVGLSFNDGDTPQGRATQALVVVWIIALF
FT                   LFRNAWFLFFELGPRGATPGKRITGIRVAARARGTDGARLTTEAVIARNLVRDIELFMP
FT                   LLFLFAAWAEGGDTVTAGWAGLAWFLIFALFPFFNRDRLRCGDLIAGTWVVEVPRRKLE
FT                   QALSVGKAARGLSQETGARYRFADADLAVYGEYELQVLERVLRENRPEAMREVAETICR
FT                   KIGWNAGSGDERAFLEAYYAQLRARLETGMRFGRRKADKHSG"
FT   gene            complement(505498..506568)
FT                   /locus_tag="Saro_0462"
FT   CDS_pept        complement(505498..506568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24910"
FT                   /db_xref="GOA:Q2GB63"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB63"
FT                   /protein_id="ABD24910.1"
FT                   /translation="MNGVAAGIAGKVGGWFAKAPEQAVAAEQAALRSDRFRLEREADWK
FT                   RLEGIVRRMESGRMRRLPDEDLLALPTLYRTVASSLAIARETSLDAALVAYLEALTQRA
FT                   WFLVYGPRASLWSWFRRFLGGEWSAAVRGLGIDLLLALLLMVAGVAVGWFLVSANTEWY
FT                   YSLVPGGFADERVPGASREALRATLFGNQSQNGMSVFAAALFSNNAQVSILCFALGFAF
FT                   GLPTILLLIHNTALLGAMLWLYQGQGLLLDFVGWLSIHGTTELFAILLAGASGLHIGRS
FT                   MAFPGDLSVVDAAAAAGRRAAVVMTGVVLMLVVAAVLEGFARQLVDATPSRLIVGGFML
FT                   VLWTGYFFAFGRGVRA"
FT   gene            complement(506565..507851)
FT                   /locus_tag="Saro_0463"
FT   CDS_pept        complement(506565..507851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0463"
FT                   /product="protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24911"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB62"
FT                   /protein_id="ABD24911.1"
FT                   /translation="MVLAGIAPLALLLAATIPAAWIAAPALGGALVVVILLDGLLAGRL
FT                   ADLRVIAPEDAEVGEPARLVVAAELDRASPRARPEIALECDPRLAPGGRLAFALIPDGG
FT                   AWTGAGEISPTRRGTGVFGRVWLRWSGPLGLAHRQVSRPLDQSVRVWPNIAPVRSPALQ
FT                   IFLRDAQFGLIARRIRGEGAEFEALAEYEPGMDRRRIDWKSSARHARLFAKEYEVERNN
FT                   QIVFAFDCGQTMCEPIDGLPRIDRAVTAALTTAYVALKAQDRVALFGFAARPEVATPFI
FT                   TSSRDFPRLQRAAAGLDYHPGEANFTLALSTLAARLQRRSLIVLFSDFTDPTSAELMVE
FT                   SVGRLVERHLVLFVVMTDADLARIVSAPVEDMQSVAESVTATTLVRQRALVLQRLRHLG
FT                   VRVLEAPHDAVGTRLLDAYLAIKREGRIG"
FT   sig_peptide     complement(507765..507851)
FT                   /locus_tag="Saro_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.938 at
FT                   residue 29"
FT   gene            complement(507890..508846)
FT                   /locus_tag="Saro_0464"
FT   CDS_pept        complement(507890..508846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0464"
FT                   /product="ATPase AAA_3"
FT                   /note="associated with various cellular activities"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24912"
FT                   /db_xref="GOA:Q2GB61"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB61"
FT                   /protein_id="ABD24912.1"
FT                   /translation="MTLADLGDLSAAIRAEVAKAVVGQEDVIDHLLVALFAGGHVLLEG
FT                   PPGTAKTFLAQCLAGALGLDFGRIQFTPDLMPGDILGSNLFNFQTSQFTLTRGPIFHEL
FT                   LLADEINRTPPKTQAALLEAMQERRVTLDGEVHALSDRFMVVATQNPIESQGVYPLPEA
FT                   QLDRFLFKLLVPYPSAEEEARIVTQYSTGRTAPKPADLGIAAVTDADRLAQANRVVASV
FT                   TLADSVVDYVVRLVRATRETGDLVAGASPRAAVLLAGAARARAALDGREYVIPDDVKAL
FT                   ATAVLRHRLLLSPAAEIEGKQVEAIVGALVEGTEAPR"
FT   gene            complement(508864..510147)
FT                   /locus_tag="Saro_0465"
FT   CDS_pept        complement(508864..510147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24913"
FT                   /db_xref="GOA:Q2GB60"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB60"
FT                   /protein_id="ABD24913.1"
FT                   /translation="MTAPHASPFSRGSVIGILLVGALAFVALLWFLGNDTGGSGNNGGA
FT                   HVGGHGLNGYAGLARMLEAEGLDVVRQRNRRALETAPGLLILTPPADAEGKDIAKVVDA
FT                   RRYLGPTIVVTPKWFAAGVNSGKAKRGWVQLLATQAPEWPGFADNVTVDIGEEKSQPAG
FT                   GWRLGNRRGRLPDDLRVESGSGDGLVPLVRGGDGRILAAWLDDDGYYPALNRLAGIDPD
FT                   RGGEDDDLYPVVLVFEPDLLDNWGLGDKATAMLARDLVLATADNRSQPFAFDMTFNGFG
FT                   ASRNLLTLAFEPPFLAATICLLLAALAVAWRALHRFGPPLRHGPEIAPGKAALVANAAG
FT                   LIRRAGRVHLVAAPYADATRERIALALGLPRGMAPDEVERQIDATQQRRGHEGPLFSQA
FT                   AKYLREARKPHDLARRALVLQAMERHLK"
FT   gene            complement(510144..510803)
FT                   /locus_tag="Saro_0466"
FT   CDS_pept        complement(510144..510803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24914"
FT                   /db_xref="GOA:Q2GB59"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB59"
FT                   /protein_id="ABD24914.1"
FT                   /translation="MTASAAANPATNDAAAAEAAWRALHGSSDIQFAPVPPDPAPVSPE
FT                   WLKAIGRFLEWLLSPVGHLLGSGWGVVETALLVGAVIGAIWIAWTLLWPLLRNRGRKSG
FT                   LDVPQWIPPREEALALLEDADRLAAEGLYAEAAHLLLRRSVGQIAAARPQWLTPASTAR
FT                   EIGAIAELPEAARAAFSSIAGMVERARYALRPLGAEDWSVARDAYARFALAELVSG"
FT   gene            complement(510856..511746)
FT                   /locus_tag="Saro_0467"
FT   CDS_pept        complement(510856..511746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0467"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24915"
FT                   /db_xref="GOA:Q2GB58"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB58"
FT                   /protein_id="ABD24915.1"
FT                   /translation="MQSYPAPALALVEEMAAAAAKDPARAVSFQGAPGANSHRAALEAL
FT                   PDCLPLPCFSFEDALDAVKEGRAGQAIIPIENSQHGRVADIHFLLPESGLSIIGEHFLE
FT                   IHASLMALGDGPFSAAYSHPQALGQSRFYLRERGIVPMSYADTAGAAAYVAELGDPTVA
FT                   AIAPKIAAELYGLKLIAENVEDAHDNTTRFVILSKTPLDPATIPGPAMTTFVFEVRNIP
FT                   AALYKALGGFATNGVNMTKLESYQRGASFAATEFYADIVGAPGERPVDLAFEELGFFAK
FT                   RVRMLGTYPMERIRG"
FT   gene            511901..512791
FT                   /locus_tag="Saro_0468"
FT   CDS_pept        511901..512791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0468"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24916"
FT                   /db_xref="GOA:Q2GB57"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB57"
FT                   /protein_id="ABD24916.1"
FT                   /translation="MDDRFNTIAGWTLFGGIVALGLSSLSAHYFLADKEHRPETMGYAI
FT                   EGVEEEGGAGAAAELPLPNLLAKADVKAGEALFAKCKACHTAEQGGANGIGPNLYGVVG
FT                   EAVAAGRGGFAFSDALKAKGGKWDFESLDAWLKNPKAYADGTKMSFAGLPKGEDRANVI
FT                   VYLNSLGSNLPLPAPVEVPAAGAAPAAVAVVGDAAKGEAIFAKCKACHTIDQGGANGIG
FT                   PNLFAVYGEKVAGERGGFAFSDALKGKGGTWDDATLDAWLTSPAKFAQGTKMTFAGIAD
FT                   AQQRADVIAYMKTKK"
FT   gene            complement(512851..513237)
FT                   /locus_tag="Saro_0469"
FT   CDS_pept        complement(512851..513237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0469"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24917"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB56"
FT                   /protein_id="ABD24917.1"
FT                   /translation="MTAIPAPRGDVYAANCPTRQLLDRIADKWSALVLLLLSAEDMRFN
FT                   ALKRRIEGVSQKMLSQTLRSLERDGLVSRRAEATVPVSVTYAITPLGRGLVGALSGMIE
FT                   WAETCMIEVSAAQRAYDLRQETAA"
FT   gene            513332..513940
FT                   /locus_tag="Saro_0470"
FT   CDS_pept        513332..513940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0470"
FT                   /product="TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24918"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB55"
FT                   /protein_id="ABD24918.1"
FT                   /translation="MKVAVLGASGRAGSEITAELARRGHEVVAIARKPEAIAAAPGVTA
FT                   VQGDASDPQALAALIRGSDAVISALHFDVKAETLLSALKAAGVPRLLVTGGAASLEVAP
FT                   GKILFDAMDLPDEWKPAILGGIAFLKDLRSETEIDWTFFSPAAFIEVGPRTGTFRLGTD
FT                   QLVVDDKGESRISFADYAIAMVDELEQHRHPRARFTAAY"
FT   gene            complement(513974..514474)
FT                   /locus_tag="Saro_0471"
FT   CDS_pept        complement(513974..514474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB54"
FT                   /protein_id="ABD24919.1"
FT                   /translation="MAARHGYPGVHRSTFSESHPMTSIRSLLLPFALLGFSGGAAAEGI
FT                   AAKGWSADWKVVGVAEDRTEVLMRPGSVRELPPGPQRTFAVRQVWAGFDYAGTHGLHAA
FT                   RKIALFRYDCAGRRLLVAAATDYAANGVVLARNAVDADRADQYLPVEPDTLGAAIMDKA
FT                   CAA"
FT   sig_peptide     complement(514346..514474)
FT                   /locus_tag="Saro_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.935) with cleavage site probability 0.907 at
FT                   residue 43"
FT   gene            complement(514536..515204)
FT                   /locus_tag="Saro_0472"
FT   CDS_pept        complement(514536..515204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0472"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24920"
FT                   /db_xref="GOA:Q2GB53"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GB53"
FT                   /protein_id="ABD24920.1"
FT                   /translation="MSRSDKNPHERLKTAKKRTASSARWLSRQLNDPYVKKAKAEGWRS
FT                   RAAFKLIELDEKFGLLKGAKRVVDLGIAPGGWSQVVRKKAPAAKIVGIDLLPTEPIEGV
FT                   TIFEMDFMADEAPEALQSALDGPPDLVLSDMAANTVGHKQTDHLRTMGLVETAVDFAVQ
FT                   TLAPGGAFVAKVFAGGTDTELLAILKKNFTTVKHAKPPASRKDSSEWYVIAQGFKGRPD
FT                   "
FT   gene            complement(515201..516508)
FT                   /locus_tag="Saro_0473"
FT   CDS_pept        complement(515201..516508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0473"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24921"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB52"
FT                   /protein_id="ABD24921.1"
FT                   /translation="MAESIPPASGQGARSGRKKGQRKSRPPRSNAGSSLPPRSAGKTRP
FT                   PSSRGGAAQESLPAQARQAGPQGLAETALPPAETALPQAGERTSERPGPWQKPLPHHRQ
FT                   AYAAIDLGTNNCRLLIARPSGEHFVVIDAFSRVVRLGEGLAQTGRLSDAAMDRALAALH
FT                   VCADKLRKRNVHLARSVATEACRRATNGQAFIDRVREETGIRLNIITAQEEARLAVLGC
FT                   HILLEQGDGPAMIFDIGGGSTEMVLVETGETVPRILDWQSVPWGVVSLTESIGHIDDEP
FT                   VARAVAYAEMRRRVDEGFADFAERVAPMRHAAQGQGRIRLLGTSGTVTTLASLHLELPQ
FT                   YDRRAVDGLVVPAESMRDISRRLSTMSPAERISVPCIGRERSDLVVAGCAILESIFDIW
FT                   PADRLGIADRGIREGILRSLMAGGADPRARKRIEAA"
FT   gene            516668..516741
FT                   /locus_tag="Saro_R0006"
FT                   /note="tRNA-Gln1"
FT   tRNA            516668..516741
FT                   /locus_tag="Saro_R0006"
FT                   /product="tRNA-Gln"
FT   gene            complement(516979..518454)
FT                   /locus_tag="Saro_0474"
FT   CDS_pept        complement(516979..518454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0474"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24922"
FT                   /db_xref="GOA:Q2GB51"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB51"
FT                   /protein_id="ABD24922.1"
FT                   /translation="MCGLTRPRAGPLPAAITDRHMISSFNLTRRATLGGAAATMVLGAA
FT                   PAIASKRARRPNILYIMADDLGYADLSCYGRRDFETPVLDKLAAQGLRFTNAYANSAVC
FT                   TATRVGLITGRYQYRLPVGLEEPLAFRPNIGLPPSHPTLPSLLAKAGYRTSLIGKWHLG
FT                   SLPDFDPLKSGYQTFWGIRSGGVDYYTHATSNGQPDLWDGPTPVERAGYLTDLLADRAV
FT                   SEIREASSGEAPWFMSLHFTAPHWPWEGPDDASESARIAKLKDPSALFHFDGGSAAIYA
FT                   AMVRRLDYQIGRVLEALKANRAEQDTIVVFTSDNGGERFSDTWPFSGRKTELLEGGLRI
FT                   PAIVRWPGVTRAGTTSDAQIISMDWLPTFLAAAGSAPDPGHPSDGVDVTPALGGGSLAE
FT                   RALFWRYKNRAQRAVRRGNLKYLRIAENEFLFDVAADPLERANLKDRQPEDFAALKAAW
FT                   EKWNATMLPLDPQSYTHGFHADELADRFGVQPD"
FT   gene            complement(518616..519611)
FT                   /locus_tag="Saro_0475"
FT   CDS_pept        complement(518616..519611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0475"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24923"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB50"
FT                   /protein_id="ABD24923.1"
FT                   /translation="MQTRTLGQSGLAVSALGYGCMGIDFGYRNKLSREDGISIIRAAAE
FT                   RGVTFFDTAEVYGPWTNEDMVGEALEPFKDKVVIATKFGFDIDPDTGAISGTDSRPERI
FT                   RKVCEASLKRLRVDAIDLFYQHRVDPKVPIEDVAGTVRDLIAEGKVKHFGLSEPGAPTV
FT                   RRAHAVQPVAALQNEYSLWTRQVESNGILDTCRELGIGLVPYSPLGKGFLAGGVTSAEQ
FT                   VANGDFRGTLPRFQAAAFAHNLQLLDLVKRIAAERDATPAQIALAWLLAKAPFIVPIPG
FT                   TTKLHRLDENLGAADVVLTGTDLTEIEALLATVTVVGTRYPPEREAATGL"
FT   gene            519733..520689
FT                   /locus_tag="Saro_0476"
FT   CDS_pept        519733..520689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24924"
FT                   /db_xref="GOA:Q2GB49"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB49"
FT                   /protein_id="ABD24924.1"
FT                   /translation="MFRTELGDLSVFLVVSEERSFTRAAVRLGTSQSAVSLAVRRLEEH
FT                   LGLKLLARTTRSVSPTEAGEQLLATLKPSLGDIRDRLTSLTRLRARPAGLVRITTSRHA
FT                   AETLLWPAVDAVMARYPDIEVEISIDGALTNIVADRFDAGVRLGESLEKDMVAVRIGPD
FT                   LRMAVVCAPAYLEGREPPRGPRDLEAHRCINLRMATRGNLYAWEFEKDGRALNVRVEGA
FT                   LIVNDAGIAVRAAKAGHGLACVLEDEGVLRDIEAGNLVRVLEDWCPPLRGASSLLSGPA
FT                   QPFARVPRGAGRAASARRLTASRALLRFGAPQPNYEA"
FT   gene            520686..521564
FT                   /locus_tag="Saro_0477"
FT   CDS_pept        520686..521564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0477"
FT                   /product="conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24925"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB48"
FT                   /protein_id="ABD24925.1"
FT                   /translation="MTEEEKLHELTKRKFYKAEQEAGFVESQPRTTPQQQDPAYRLAFR
FT                   DTDFLLREELRPVRFQLELLKTEMLLDEAAIGSTLVVYGSARIPSPDMAEAAMSTATTP
FT                   EKKAVIERLVAKAKYYEEARKLAYTASSCGLVEEGKRQFVICSGGGPSIMEAANRGAQE
FT                   AGAESIGLNIVLPHEQAPNSFVTPHLSFQFHYFALRKMHFLLRARAVAVFPGGFGTFDE
FT                   FFEMLTLIQTGKMKPIPILLFGKDYWSRVVNFEALAEEGVINFEDLELFTPVETADEAW
FT                   KHIVDFYDLDC"
FT   gene            521569..522087
FT                   /locus_tag="Saro_0478"
FT   CDS_pept        521569..522087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0478"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24926"
FT                   /db_xref="GOA:Q2GB47"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB47"
FT                   /protein_id="ABD24926.1"
FT                   /translation="MTIRTPRLVLRPVRPEDDLPAMHRIMRQPRAMAYWSTPPHANEDE
FT                   TREWLANMADIPAALGEDFIVELEDRVIGKAGFYRFPDLGYLFDPDVWGQGLAREAVEA
FT                   VVARGFAVHRLPRVQADVDPRNKASIRLLERLGFVETHRQARTWLVGEEWCDSVYFALT
FT                   PEAWDQRTA"
FT   gene            complement(522072..522821)
FT                   /locus_tag="Saro_0479"
FT   CDS_pept        complement(522072..522821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0479"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24927"
FT                   /db_xref="GOA:Q2GB46"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB46"
FT                   /protein_id="ABD24927.1"
FT                   /translation="MSAPPRILSIAGSDSGGGAGIQADIKTITMLGGYAMTAICALTAQ
FT                   DTTGVHAVLPVAPDMVAAQIDACVNDLGVDAVKIGMLGSPEIAAIVADRLERLAVPIVF
FT                   DPVMIATSGAALADAATVAAFERLMAIATLTTPNVPELEALGGDAAMQARGVAYVAKGG
FT                   DAQGPEVTDRLVVPGREARTWTAPRIATTSTHGTGCTMSSAIATFLGFGAPLDEAVEDA
FT                   REFVRAALLAAPGFGAGHGPLGHHAVR"
FT   gene            complement(522823..523047)
FT                   /locus_tag="Saro_0480"
FT   CDS_pept        complement(522823..523047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0480"
FT                   /product="protein of unknown function DUF1272"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24928"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB45"
FT                   /protein_id="ABD24928.1"
FT                   /translation="MLEMRPDCERCGADLPAEAPGAFICSFECTFCAECADDLDDRCPN
FT                   CGGELMDRPTRAKALHAKHPPSTTRKFKG"
FT   gene            complement(523049..524386)
FT                   /locus_tag="Saro_0481"
FT   CDS_pept        complement(523049..524386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0481"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24929"
FT                   /db_xref="GOA:Q2GB44"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GB44"
FT                   /protein_id="ABD24929.1"
FT                   /translation="MARKFFGTDGIRGRTNSGVMTAEIAMKVGQAAGTYFQRGTHRHRV
FT                   VIGKDTRLSGYMMESAMTAGFTSVGMDVVLLGPMPTPAVAMLTRSMRADLGVMISASHN
FT                   PFEDNGIKLFGPDGYKLSDEAELTIESMLLQELPLADAAQVGRARRIEDARGRYIHAVK
FT                   ASLPDNVRLDGLRIVVDCANGAAYHVTPSALWELGAEVIAIGVEPNGKNINAGVGSTHL
FT                   DAIKAKVRETRADIGIALDGDADRLIVVDEKCQTVDGDQIMALIGTQLAARGELRGGGV
FT                   VATVMSNLGLERHLNAHGLTLERTAVGDRYVLERMRSGGFNVGGEQSGHMILTDHATTG
FT                   DGTVAALQVLAALVSSGKPASELLHLFDPVPQLLKNVRFTGGKPLEAKSVKEAIAEAEA
FT                   RLAGKGRLVIRPSGTEPLIRVMAEGDDADEVEAVVDQICDAVRKAA"
FT   gene            524457..525746
FT                   /locus_tag="Saro_0482"
FT   CDS_pept        524457..525746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0482"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24930"
FT                   /db_xref="GOA:Q2GB43"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB43"
FT                   /protein_id="ABD24930.1"
FT                   /translation="MKQSELATSDQAPAAPPISTIRAGWIFAALVGGLALGLGLAFAAP
FT                   AALESVLLVVEPIGNLWLQALRGTIVPLVVALLFTGIVQTVAAARAGALARRALLFFAS
FT                   VLAGGCAMAAVLVPAMLAAFPMPQAAADALRQGVAQIHDKADVPGFAAFLQSIVPANVL
FT                   QSAASDQILPVILFTSVFALAATRLTDVQRRTLATFFEATANAMLVVIGWVLLAAPVGV
FT                   FCLSLAVAAHSGTAAIGALAHYVLVVTAAGVVVFLAAYAVAVVAARQPFGRFARAMLPA
FT                   QALALSTQSSLATLPAMLGVCRTLGVRAQTADLVLPLAVALFRATGPAMNLAVAIYVAH
FT                   WFGMELTPSMLVAGFAVATLTTLGAVSLPGAISFVTSIGPIAIAMGVPVEPLALLVAVE
FT                   VLPDLMRTLGNVTMDVAVTAAVDRAHGPGE"
FT   sig_peptide     524457..524588
FT                   /locus_tag="Saro_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.712) with cleavage site probability 0.701 at
FT                   residue 44"
FT   gene            525874..526488
FT                   /locus_tag="Saro_0483"
FT   CDS_pept        525874..526488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0483"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24931"
FT                   /db_xref="GOA:Q2GB42"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB42"
FT                   /protein_id="ABD24931.1"
FT                   /translation="MAITLPPLPYADDALAPAISATTLQTHHGKHHKAYVDKTNAAIDG
FT                   TDLAGASLEQIIAAADAKGDKGLFNNAAQSWNHAFYWNSMTPDAATPTGELAAAIDAAF
FT                   GSLDKLKAELAAQGTAHFASGWVWLVSRGGKLAVEQTHDAATLATGDAKPLLVIDLWEH
FT                   AYYLDHKNLRPDYLKAVIEKHLNWTFAAENLAREGTWTYPA"
FT   gene            complement(526476..527696)
FT                   /locus_tag="Saro_0484"
FT   CDS_pept        complement(526476..527696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0484"
FT                   /product="protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24932"
FT                   /db_xref="GOA:Q2GB41"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB41"
FT                   /protein_id="ABD24932.1"
FT                   /translation="MRRPVPQVNQPILPDSASIAPADDDLPDRRARLQSAIVLLLGLGL
FT                   FLALPFVLSIGSVVFLPPVTAMIFTIVLSPLADRLTRMGLPNVLASFIAILALVAVVVM
FT                   ALLLILQPAFVMVDQVPTLARQVARRFAELRGNLWWIADVNRQLARITGHSAREVVVAS
FT                   PSVIEQVAFATPSVILETLLTLLMTFFMIEARIRMKRRILLDRHTFNASVRLARVLRDV
FT                   QERVASYILTVAQVNFGVGVLVALGAWSFGLAAPVMWGGLAFVLNFLPYLGPLVMMGLL
FT                   GLVGLGTAPTVAVGLLPALAFLGLHAVESNVVTPSILGARFTVNPVAILISISYFSWIW
FT                   GVLGALLSVPILLTVSALLDHIGKPNLVGFLFGEALFEPGRLAGMDDDPDEGGPPDNST
FT                   AGAAQAG"
FT   gene            complement(527833..528441)
FT                   /locus_tag="Saro_0485"
FT   CDS_pept        complement(527833..528441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0485"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24933"
FT                   /db_xref="GOA:Q2GB40"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB40"
FT                   /protein_id="ABD24933.1"
FT                   /translation="MADAGTPPRPASDPAAFKRDLTSVIPHLRAFARGLCGRPDLADDL
FT                   VQETLLKAWAAQERFEPGTSMRAWTFVILRNAYLTDMRRNRFRADYDETVAERILVAPA
FT                   AQEGPMHLSDMHRALLTLPPERREALLLVGAGGFSYEEAAQICGCAVGTIKSRVGRARA
FT                   ALSQMIENGQIPRRSTDDAQAHSAIMGELEETVQAGKHR"
FT   gene            complement(528434..528607)
FT                   /locus_tag="Saro_0486"
FT   CDS_pept        complement(528434..528607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24934"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB39"
FT                   /protein_id="ABD24934.1"
FT                   /translation="MSKEKPMNRGQVRRKGGKPQAPEWADGLKRLYDSVLDEPLPDTFA
FT                   QLLDKLDDSSHG"
FT   gene            528858..530525
FT                   /locus_tag="Saro_0487"
FT   CDS_pept        528858..530525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0487"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24935"
FT                   /db_xref="GOA:Q2GB38"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB38"
FT                   /protein_id="ABD24935.1"
FT                   /translation="MEKLLSGKKLTPRWYERFPRGVPLGIFGLTMAVTMLSVFAIENAE
FT                   YRRQTAQTAQTAQAVASGLERRSNANAAYLRSSAALFATQQMVEAPLFRTFIRQLHLDG
FT                   RYVGSDGIGWAMKVYRDDIPTVEAIMRDGGNPGFAVRPTPEPERPFVVPVMFLEPDTPR
FT                   NRRAIGFDMFSEGVRRTAMKAAERTGQPTASGHVVLQQEGRPDGLPGFLVYMPVYTLQE
FT                   DGPRKLRGFVYSPFNAQRFLESSIDVNHLDGAGVRLYDEDAGGLVVLASVAPAEVSGRV
FT                   IRRPIDISGHRFMLEIEAPATAMLSVMSVMTLLFGLLVATLLLVLARLLTQQAVEDRIA
FT                   LAWFEQQSSIRNSLTRELNHRVKNTLANVLSIISLTRRRATSLPEFADSLEGRIRALSA
FT                   THDLLTQSDWGTTPIELVIRAELAPYAGDTQRHVEMGGPEVELAPNDALSLGLAIHELA
FT                   TNAAKYGALSVEKGRVSVRWELAGEGQARIEWVERGGPPIDQETKRKRGFGTELIEKIV
FT                   AHELRSPVDLRFETEGVRCKLLVPVRRKSDFAIRQGRA"
FT   sig_peptide     528858..528980
FT                   /locus_tag="Saro_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.791) with cleavage site probability 0.781 at
FT                   residue 41"
FT   gene            complement(530563..531360)
FT                   /locus_tag="Saro_0488"
FT   CDS_pept        complement(530563..531360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0488"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24936"
FT                   /db_xref="GOA:Q2GB37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB37"
FT                   /protein_id="ABD24936.1"
FT                   /translation="MSLGAKVANQLPYLRRYARALTGSQSAGDSFVRATLEAALADDDL
FT                   RATIGEGRAQLYHAFNRVWSTAYVDTADRSSGSLGQHEAAAQERLAAMTPANRQALLLT
FT                   TLEDFSIDDAAYIMDREPEDVESLVQDAIAEIDRESATSVLIIEDEPLISMQLEDLVRS
FT                   LGHDVCGMAATRTQALEIVQREQPGLVLADIQLADGSSGLDAVDDILKIGSVPVIFITA
FT                   YPERLLTGNRPEPTYLITKPFQEQTVRTAISQALFFGSSRPLG"
FT   gene            complement(531406..531810)
FT                   /locus_tag="Saro_0489"
FT   CDS_pept        complement(531406..531810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0489"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24937"
FT                   /db_xref="GOA:Q2GB36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB36"
FT                   /protein_id="ABD24937.1"
FT                   /translation="MTATIKEPPLVLVVEDGLLVAMAIEDALLERGFGVQVATTLARAE
FT                   EIITQNLPQAALLDLQLPDGHSVELARRLHEAGCRVAISSALDSGEVFESCHFAARFGK
FT                   PASPDLLADWVASVTDAGMPNPACPSPGTG"
FT   gene            531932..532702
FT                   /locus_tag="Saro_0490"
FT   CDS_pept        531932..532702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0490"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24938"
FT                   /db_xref="GOA:Q2GB35"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB35"
FT                   /protein_id="ABD24938.1"
FT                   /translation="MARDDETGLMVENAAARCAQCPLATCEGLRQPPDELRAWIAAFRQ
FT                   GEARFVRGEQVFAQGLRLRHLYTVLSGVLMRTRLLEDGRRQIINFMFPGDFIGLQAALD
FT                   GEMSHAVEAVTSATLCVFARDRFFELAALQPRLSFDLTWLAAHEEAALEEHIVSLGQRN
FT                   ARERMAALAVFLVQRGMDTGLAPDGILPITVTQGQIADMLGLSLVHTNRTLQALRRMGL
FT                   VDWTLSAIRIPDMDAARRMARIDGVGASAPRPYI"
FT   gene            complement(532919..533377)
FT                   /locus_tag="Saro_0491"
FT   CDS_pept        complement(532919..533377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0491"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24939"
FT                   /db_xref="GOA:Q2GB34"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB34"
FT                   /protein_id="ABD24939.1"
FT                   /translation="MLTTGQDQDKPVRRRRPGPLGRALVVEDDGLIATDIAEALVEAGA
FT                   SPVEICASIAHAMERLERAVPALLILDVHLADRDDGWALAELAIQLGESPPLILFTTAT
FT                   PDSIPQSAAELGHVLAKPFRTEDLIALVRREKPRGLLGRIRNALSGSD"
FT   gene            complement(533476..534690)
FT                   /locus_tag="Saro_0492"
FT   CDS_pept        complement(533476..534690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24940"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB33"
FT                   /protein_id="ABD24940.1"
FT                   /translation="MNRSSPGKSRLPANKGKIVAQGEVIITPVSGKADRKAFIDLAYRL
FT                   NADDPNWVPPLRMEAEELITPGKNPFFEHADVQLFLARRGGAVVGRISAHIDRLALAMD
FT                   PQQGMGPGTGNWGLLEAEDEAVARALIGRAEEWLREKGMTRVLAPLSMSIWEEPGQLVK
FT                   GFDHPPTVMMGHQPERYDAYIKALGYQPAKTLNTYELDITKDFPPLIQRIVQSGHKNAK
FT                   IRIRNVDKSRFDEEAALILDILNDAWSDNWGFVPFTDTEIKYAGKKFKPIVREDLIMVA
FT                   EYEGEPVAFMMTLPDLNEVLKPMGGKLFPFNWAKLLLWLRKPRVRTMRVPLMGVRKRLQ
FT                   ASRLASQLAFMMIEAIRQNSVREYGASRGEIGWILDDNQGMNAIAEAIDSHVNKAYVIY
FT                   DKPLR"
FT   gene            534777..535892
FT                   /locus_tag="Saro_0493"
FT   CDS_pept        534777..535892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0493"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24941"
FT                   /db_xref="GOA:Q2GB32"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB32"
FT                   /protein_id="ABD24941.1"
FT                   /translation="MGLIGISGMIATDTLDHTAAAPAQPTLPRGLAGTPDDKEMLRAAV
FT                   ELTRDIAVARPEIYWPDMLASAALGYGALAGAILSANPFIATLWGVVAALALYRALLFI
FT                   HELTHIHKNALPGFRFGWNLLVGIPMLTPSLMYEGVHTLHHARTRYGTADDPEYLPLAL
FT                   MKPWSLPLFILVAILLPVGLLIRSAVLVPLGAVIPPLGRLVWERASALSINPDFRRRPP
FT                   EGEFARMVFWQELGASAWALFLVWWSATHGWRPLLIGIAVISLTAVLNQIRTLVAHLWE
FT                   NEGDAMTVTGQYLDSVNVPPPAVLAPLWAPVGLRYHALHHLLPSMPYHSLGEAHSRLKK
FT                   HLGLESTYEKANYRGLLPLVGRLARSTMMPR"
FT   gene            complement(535912..536418)
FT                   /locus_tag="Saro_0494"
FT   CDS_pept        complement(535912..536418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0494"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24942"
FT                   /db_xref="GOA:Q2GB31"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB31"
FT                   /protein_id="ABD24942.1"
FT                   /translation="MPTISPADARALMATGATLIDIREPDEHRRLRIPGARNVPVAKLA
FT                   PVSGKQAVIYHCKSGMRTAGNAARLSAMSDCPAYMLEGGLDAWAAAGLPVEQDRRAPLE
FT                   IMRQVQITAGALILAGVLLSLTVSTAFVALSAFVGAGLVMAGTTGWCGMARLLAKMPWN
FT                   RRPAA"
FT   gene            complement(536474..537574)
FT                   /locus_tag="Saro_0495"
FT   CDS_pept        complement(536474..537574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0495"
FT                   /product="permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24943"
FT                   /db_xref="GOA:Q2GB30"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB30"
FT                   /protein_id="ABD24943.1"
FT                   /translation="MQLEFFPSRTLAIYIAKMFAVRIVAVLLMLVLVLQMLDLLSESGA
FT                   VLAAPGNGQGELLTYVSLRMPQLVSRFLPYSVLLATIITLMTLNQNSEVIAMKAAGLSA
FT                   HQVLAPLFLVAAATSVVTFAFNERIVTRSTSTLKAWQDVDYGPIPVESATKSNVWLQDG
FT                   PNILFARSVAGQGKAMHMTGVSWYRRDPTGMVTEIVTAPSASYANPGWRFREPVMFDVQ
FT                   SARKTALAASEVFAKSVEPVQVVISRVDADAESLTQLTGSLAAIRDAGFRTTELDGKWW
FT                   HKISGPLSALLMPLLGAVAAFGLARSGHLFVRAVIGMALGFAYFVFDNAALAMGNFGAY
FT                   PPFLAAWAPFVLFLLIGETVLIRTEE"
FT   gene            complement(537564..538808)
FT                   /locus_tag="Saro_0496"
FT   CDS_pept        complement(537564..538808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0496"
FT                   /product="permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24944"
FT                   /db_xref="GOA:Q2GB29"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB29"
FT                   /protein_id="ABD24944.1"
FT                   /translation="MKLLTATDRYIARLVFVPMLSVFVLAASLLILDKMLKLFDFVATQ
FT                   GGPVSVVFKMLANLLPEYASLAIPLGLMLGILFAFRKLAMSSELDVMRAVGLSYTRLLR
FT                   VPYMFAIALAALNLLIVSYLQPLSRYYYEQLQFELRSGALGASIRVGEFNSLQDRTALR
FT                   VDASRDEGRDLRGIFARIQTANGQVMVISAREGRFFANRESPDTVILRLTDGQIVQDGP
FT                   GIASPRVLSFASHDLPIDLPRIEQFRQRGDADREYFLPELLQIGWNDRYSEEIRNQSKA
FT                   SLNYRLVEVVMMFLLPLLAVALAVPPKRSTSALGVFLSIVLVVAYHKVNQYGQDVAALG
FT                   RMDPVIALWGPFVVFAALIVWMYWRIAYVPGGQPIGALETVFSKISRAVRRLFKRKRLP
FT                   GEAATGATEEAANAA"
FT   sig_peptide     complement(538728..538808)
FT                   /locus_tag="Saro_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.911 at
FT                   residue 27"
FT   gene            539046..539477
FT                   /locus_tag="Saro_0497"
FT   CDS_pept        539046..539477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24945"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB28"
FT                   /protein_id="ABD24945.1"
FT                   /translation="MSYEQTGSAWLGGFAHDNANPDNLNQLALWCEELTSAEQRAGFER
FT                   ILREISDLASGRGEAASQWISLLADSGAFESAAIAMIPQSAIYTGGRMKDGSFVAQVIL
FT                   DGGVGAHSRNAQSISMAWLAALLRALARRSVENRTRNAH"
FT   gene            complement(539558..539938)
FT                   /locus_tag="Saro_0498"
FT   CDS_pept        complement(539558..539938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0498"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24946"
FT                   /db_xref="GOA:Q2GB27"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB27"
FT                   /protein_id="ABD24946.1"
FT                   /translation="MSIHRLALPDLSVPQRCAGDEDTRGPGGDEQIGIATKTRARPKKP
FT                   SQFKVLMLNDDYTPMEFVVMVLKRFFNMDLEQATRVMLHVHQRGVGVCGIFPYEIAETK
FT                   VNQVMDFARQNQHPLQCTLEKA"
FT   gene            complement(540114..540980)
FT                   /locus_tag="Saro_0499"
FT   CDS_pept        complement(540114..540980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0499"
FT                   /product="Phasin"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24947"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB26"
FT                   /protein_id="ABD24947.1"
FT                   /translation="MVDEVKDSLTEPAPVTEAPVALPEIPAIEAEAPVASAPAPAIKAV
FT                   PATKRKGNGRKASAKPAAKPAPVEASATVAETKVAKPAKAKPVRAIPAKPSKAGAAKQP
FT                   VAAAAKPAVKPANKRPFTATPRVKTIGAGKTAPRKELFAMATTTTEFTDKIQNAFKDAQ
FT                   EKAKAALEKSQAAFGDAGTFAKGNVEAVVESSKILASGLQEMTKGYVEETKSAFETMTA
FT                   DVKDLASVKSPTEFFEKQSALLRKNFDAAVAATSKNSEAMLKLANEAFQPISTRVSLAV
FT                   EKIKHAA"
FT   gene            complement(541124..543028)
FT                   /locus_tag="Saro_0500"
FT   CDS_pept        complement(541124..543028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0500"
FT                   /product="Poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24948"
FT                   /db_xref="GOA:Q2GB25"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB25"
FT                   /protein_id="ABD24948.1"
FT                   /translation="MTCIVEAAQRLGTRMTSETGTDSIVFEDLLRQQGEAFRAMFAPLA
FT                   PSMAATDPTEIQHWAMSAAKLQKMWLDFSAEQAGHVEPLLARMGDIGKWTQTFFSMAGQ
FT                   LPIAQAETQAKLWNDSMALWSTVMGQFAGGARPDGEGAELPRKDRRFSDKRWREQPAFA
FT                   LIHQTYLLLAERLQQMADEAQGLSPERKEQLRFATKVVTDALSPANFPLTNPVVIERTM
FT                   ETRGENLVKGVEHLLNDLRKGQLTHTDPAAFELGRNIAVTPGKVVYETPLFQLIQYTPT
FT                   TDEVFETPLVIFPPWINRFYILDLNPQKSFIRWAVAQGLTVFVVSWKSADASMADIVWD
FT                   DYVRAQIEAIDHVRQRLKVPAVHTIGYCVAGTTLAATLAVLARRDEADKVASATFFTAQ
FT                   VDFEDAGDLRNFIDDSQLKMLESLSTDGYLDGRYMAATFNALRGTDLIWNYVVNNYLLG
FT                   SEYPAFDLLHWNGDTTNLPTRWHQAYLCDLYRDNRLVMPDALTVDGTPVDLRRIATPCY
FT                   IQAGREDHIAPPQSVWKLTRHLSGSWKFVLAGSGHIAGVVNPPESGKYQYWLNPASPAT
FT                   LDEFVAGAKETKGSWWPDWIEWIAGQSDGKVRATGRRNPGGKGDKVIEDAPGRYVRSR"
FT   gene            543116..544357
FT                   /locus_tag="Saro_0501"
FT   CDS_pept        543116..544357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0501"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24949"
FT                   /db_xref="GOA:Q2GB24"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB24"
FT                   /protein_id="ABD24949.1"
FT                   /translation="MRRSCRVHSTSNQTVDEEFYRMKRLPPYVIAEVNGMRAAARAAGR
FT                   DIIDLGMGNPDLPPPQHVIDKLCEVAQKPDAHGYSASSGIPGVRKAQANYYGRRFNVDL
FT                   DPETEVVMTMGSKEGLASLATAITAPGDVVLAPNPSYPIHTFGFIIAGATIRSVPTTPD
FT                   ERYWDSLDRAMKYSVPRPSILIVNYPSNPTAETVDLAFYERLVAWAKENKVWILSDLAY
FT                   SELYYDGNPTRSILEVPGAKDVAVEFTSMSKTFSMAGWRVGFAVGNQRLIAALKRVKSY
FT                   LDYGAFTPIQAAACAALNGPQDIVVKNRELYQKRRDVMVEAFGRAGWEIPSPSASMFAW
FT                   APLPPALTHLGSLEFSKQLLTHAEVAVAPGVGYGEDGEGFVRIAMVENEQRLRQAARNI
FT                   KRYLQSMGVNASAA"
FT   gene            544498..545304
FT                   /locus_tag="Saro_0502"
FT   CDS_pept        544498..545304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0502"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24950"
FT                   /db_xref="GOA:Q2GB23"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:4OG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB23"
FT                   /protein_id="ABD24950.1"
FT                   /translation="MPNMNFHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGH
FT                   HLHSVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGNSLTERTHGNANRAQQAAMVWR
FT                   KLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNV
FT                   RDDVLRELTYTHREFSGEEAVRFGFATHVADDPLAGAMELARVVAEKSPNAVRGAKTLS
FT                   NRAPDLTVDDVLMAESIAQHELMYSRNQMEAVKAGMEKRAGDFVDP"
FT   gene            545339..546724
FT                   /locus_tag="Saro_0503"
FT   CDS_pept        545339..546724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0503"
FT                   /product="ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24951"
FT                   /db_xref="GOA:Q2GB22"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR040596"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB22"
FT                   /protein_id="ABD24951.1"
FT                   /translation="MRAIHDPHGALAGGLAAIRAQYQIPAGFTPEVLAAAEAAAQKAPA
FT                   GHADRTEIPFVTLDPASSTDLDQAFWIEPSGSDLVLRYAIADVAWFVSDGDAVDAEAWK
FT                   RGETIYLPEGKAGLYPPILSERAASLLPDGPRPAVVFTVRLGSDGECRLEGAERAIVRS
FT                   RAKLAYDNVRDEDMPAGFAEFAARVNAAEAARGAARVDPPEQEVEPLGDGRYALRLRPL
FT                   LLSERRNAALSLATNLAVADALQTAGTGLFRVMAGPSAKAMARLRSTAAGLGLDWPADI
FT                   DLKALERTLDQKNPHHAAFMLAVRRAGNGAGYAPWIPGVTPWHEAVAATYAHATAPLRR
FT                   LADRYVIRAALAVMAGRPVPAEVEDAFRRLPAVMAKAEATSGQIERAVIDLAEAVMLQG
FT                   REGERFAACVTDIDGDSARIHLADLPVVGRTRIPGATPGQRVDLRLDGVDLSTRRLTFS
FT                   AAD"
FT   gene            546809..546882
FT                   /locus_tag="Saro_R0007"
FT                   /note="tRNA-Cys1"
FT   tRNA            546809..546882
FT                   /locus_tag="Saro_R0007"
FT                   /product="tRNA-Cys"
FT   gene            547191..547607
FT                   /locus_tag="Saro_0504"
FT   CDS_pept        547191..547607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0504"
FT                   /product="Excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24952"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB21"
FT                   /protein_id="ABD24952.1"
FT                   /translation="MGAVRQLRRMDPKLNLNGAARRWNFDRIDPSPGMSMHRIAIASFA
FT                   ILQLASPAFAHGGGLNAQGCHNNRKTGDYHCHRSSSGAQAPRLPPVRSDRSSFRNCSEA
FT                   RAAGAAPVYRGDPGYGLNLDRDGDGVGCEPFRGR"
FT   gene            548331..548717
FT                   /locus_tag="Saro_0505"
FT   CDS_pept        548331..548717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24953"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB20"
FT                   /protein_id="ABD24953.1"
FT                   /translation="MTDDFEALTVDQYVREAARTDQRKGPGTIGFTMLGLVGETGSLLA
FT                   EAKKKQRDAASYLGYAEAVAEEIGDVLWYLAAVARRHRLALSDIAAAALITDGVYRAGD
FT                   NAALSLHALQPAHINCSSLPILTG"
FT   gene            complement(548866..549255)
FT                   /locus_tag="Saro_0506"
FT   CDS_pept        complement(548866..549255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0506"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24954"
FT                   /db_xref="GOA:Q2G854"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G854"
FT                   /protein_id="ABD24954.1"
FT                   /translation="MNTKLHAITDANGRPLSFFITAGQVSDYTGAAALLDDLPKAQWML
FT                   ADRGYDAEWFRDALEQKGIKPCIPGRKSRSIPVKYDKRRYKRRNRIEIMFGRLKDWRRV
FT                   ATRYDRCPTVFFSALALAATVLFWL"
FT   gene            complement(549276..549623)
FT                   /locus_tag="Saro_0507"
FT   CDS_pept        complement(549276..549623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0507"
FT                   /product="transposase, IS5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24955"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q2G853"
FT                   /protein_id="ABD24955.1"
FT                   /translation="MSDLYWLTDEQMARLAPYFPKSHGKPRVDDRRVLSGIIFVNRNGL
FT                   RWRDAPREYGPHKTLYNRWKRWGAMGVFGRMMEGLSAQRAEPQTVMIDATYLKAHRTAS
FT                   SLGVKKGISGV"
FT   gene            550095..550205
FT                   /pseudo
FT                   /locus_tag="Saro_0508"
FT   gene            complement(550240..550572)
FT                   /locus_tag="Saro_0509"
FT   CDS_pept        complement(550240..550572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0509"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24956"
FT                   /db_xref="GOA:Q2GB17"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB17"
FT                   /protein_id="ABD24956.1"
FT                   /translation="MSKHAMIDLKVVKRDGTKLTLQASPGMSVMEALRDNGLDELLALC
FT                   GGCCSCATCHIYVEAGPDGVDEVGGADEDDLLESSDHRRHNSRLSCQITLGSAMSGLVV
FT                   RVAPED"
FT   gene            complement(550605..552242)
FT                   /locus_tag="Saro_0510"
FT   CDS_pept        complement(550605..552242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0510"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24957"
FT                   /db_xref="GOA:Q2GB16"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB16"
FT                   /protein_id="ABD24957.1"
FT                   /translation="MSESGTPIVVDAVVVGAGVTGIYQTYLLDRNGMSVLGVDAADDVG
FT                   GTWYWNRYPGCRLDTESYAYGYFALTGIIPDWKWSERFAGQAEMLRYVNAAADAMDVRR
FT                   HYRFKTRVLSAHFLDDEKRWQITLDSGEIVHARFFISATGPLSASKMPDYKGIDLFKGE
FT                   AFHSSRWPRDDQGNLAGMNFAGKRVAVLGTGATGVQIIPIVAETAGELFVLQRNPNWCT
FT                   PLGNTPLSDEDMNLIRTRYPTILEYVKTTDTAFPYHRDPRKASQVSAEEREEFFERLYD
FT                   QPGYGIWLSGFRDLLLSRESNQFLADFVARKIRQRVKDQEVAEKLIPTDHPFGSKRVPM
FT                   ETNYYEAYNRENVHLVDLKAAPIDEFVENGVIIGGELLEVDVIIFATGFDGVTGSLDRI
FT                   DIRGRDGQRLIEAWADGPTTYLGLQTRNFPNFFALVGPHNGSAFCNVGVCGALQAEWVT
FT                   QMLLYMAARGFVVAEPTEEAEAAWTEAIYRDFERTLMAETNAWWIKVTHKPDGSVVRRT
FT                   LVYVGGGPEYRRRCEQVAYCDYEGFEMA"
FT   gene            complement(552466..553236)
FT                   /locus_tag="Saro_0511"
FT   CDS_pept        complement(552466..553236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0511"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24958"
FT                   /db_xref="GOA:Q2GB15"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB15"
FT                   /protein_id="ABD24958.1"
FT                   /translation="MASVETVASGRVGYVTLNRPESLNAIDDEMDRLLGDAWARLEADS
FT                   DVWVIVLRAKGERAFCAGGDMNAPPTGYEGLSFGGGLTGIGGQLRPVSKPLICAVHGHV
FT                   LGLGFELAMCADIIVAAKGTRFALPEARAGVIEHCGVVHRAIRQLPHHVAMAMIVAGEP
FT                   LDHEQAYQFGLVNEIVEFTQIDDAVERWTAKVLACSPLVTRAAKEAALTGLQAPLQAAV
FT                   SLSYPRIERYAHSRDRREASEAWAQRRQPNWTGE"
FT   gene            complement(553249..553995)
FT                   /locus_tag="Saro_0512"
FT   CDS_pept        complement(553249..553995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0512"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24959"
FT                   /db_xref="GOA:Q2GB14"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB14"
FT                   /protein_id="ABD24959.1"
FT                   /translation="MGRLNGKVAIITGAARGMGESHARTFVREGARVVLTDLSEEAGKA
FT                   LVAELGDNAVFLKQDVTDPQSWNAVVETAVREFGTIDILVNNAGILGPMAPTDSLDDEG
FT                   YRKVCAVNQDSVFFGMRAVLPVMVKARRGSIVNISSIAGMAANYGFPSLAYVASKFAVR
FT                   GMTKATAVEFGKHNIRVNSVHPGFIQTPMMVEATDEVGGEALAQIPLGRIADPSEVSNL
FT                   VLFLASDESSYITGSEHLVDAGMLAH"
FT   gene            554310..555392
FT                   /locus_tag="Saro_0513"
FT   CDS_pept        554310..555392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0513"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24960"
FT                   /db_xref="GOA:Q2GB13"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB13"
FT                   /protein_id="ABD24960.1"
FT                   /translation="MKGRATVLVGANRIETWEIDVHSPEPGGALVRTVLGGVCGSDVHI
FT                   MTGEAGEMPFPIILGHEGVGEIVELGAGVSTDYAGVPVKPGDLVVWSPIALCHRCYSCT
FT                   ILEETPCENSRFFEDASKPNWGSYADFAWLPNSMPFYRLPDGAIPEAVAALGCALPTVL
FT                   RGFDRCGPVRFGDSVVVQGAGPVGLSAVLVAAQAGAREVIVIDAAPARLEAAVKLGATA
FT                   TVSLGLPQDERKRMIYDRIGKQGPDIVIEAAGALPAFPEGVDISGIHSRYIILGLWGAI
FT                   GTQPISPRDLTLKNLTIGGASFPAPKNYYHAMQFAARVQHEVPLAELVSHRFGISQAAE
FT                   ALHATKTGTATKAVIDPSIS"
FT   gene            555434..556699
FT                   /locus_tag="Saro_0514"
FT   CDS_pept        555434..556699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0514"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24961"
FT                   /db_xref="GOA:Q2GB12"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:3LXH"
FT                   /db_xref="PDB:3LXI"
FT                   /db_xref="PDB:4C9K"
FT                   /db_xref="PDB:4C9L"
FT                   /db_xref="PDB:4C9M"
FT                   /db_xref="PDB:4C9N"
FT                   /db_xref="PDB:4C9O"
FT                   /db_xref="PDB:4C9P"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB12"
FT                   /protein_id="ABD24961.1"
FT                   /translation="MNAQTSTATQKHRVAPPPHVPGHLIREIDAYDLDGLEQGFHEAWK
FT                   RVQQPDTPPLVWTPFTGGHWIATRGTLIDEIYRSPERFSSRVIWVPREAGEAYDMVPTK
FT                   LDPPEHTPYRKAIDKGLNLAEIRKLEDQIRTIAVEIIEGFADRGHCEFGSEFSTVFPVR
FT                   VFLALAGLPVEDATKLGLLANEMTRPSGNTPEEQGRSLEAANKGFFEYVAPIIAARRGG
FT                   SGTDLITRILNVEIDGKPMPDDRALGLVSLLLLGGLDTVVNFLGFMMIYLSRHPETVAE
FT                   MRREPLKLQRGVEELFRRFAVVSDARYVVSDMEFHGTMLKEGDLILLPTALHGLDDRHH
FT                   DDPMTVDLSRRDVTHSTFAQGPHRCAGMHLARLEVTVMLQEWLARIPEFRLKDRAVPIY
FT                   HSGIVAAVENIPLEWEPQRVSA"
FT   gene            556696..557178
FT                   /locus_tag="Saro_0515"
FT   CDS_pept        556696..557178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0515"
FT                   /product="flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24962"
FT                   /db_xref="GOA:Q2GB11"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB11"
FT                   /protein_id="ABD24962.1"
FT                   /translation="MMDDEKAHFRKVLGHYPTGVCAITAKTPDGTATAMIVGSFTSVSL
FT                   DPPLVGFFPDKQSSSWSAISVCDGFCVNVLGSSQEALCRQLASKDPRKFEGVAHTLSPR
FT                   GAPLIDGALAWIDCSMHSVSEAGDHLLVLGAVESFEIATPGDPLLFHKGSYGKFTA"
FT   gene            complement(557175..557762)
FT                   /locus_tag="Saro_0516"
FT   CDS_pept        complement(557175..557762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0516"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24963"
FT                   /db_xref="GOA:Q2GB10"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB10"
FT                   /protein_id="ABD24963.1"
FT                   /translation="MAQVENGKTRILDSAATALRQKGLAGAKLTEIAAGAGMLAPSIYH
FT                   HFSSKDDLVEAVMMEGIYRNNRHIMAQVEVLGPSATALERLKAAIEAHIGFLLTGDDYS
FT                   SAVSRVFDDLPAEMKGRVLAAYSSFDNYWRDLIAAAQADGSARSGLDPTLVRKFLIAML
FT                   DSCATWYRPGKLSPAQIAEQAANLALHGFAKG"
FT   gene            complement(557813..558748)
FT                   /locus_tag="Saro_0517"
FT   CDS_pept        complement(557813..558748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0517"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24964"
FT                   /db_xref="GOA:Q2GB09"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR008367"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB09"
FT                   /protein_id="ABD24964.1"
FT                   /translation="MMEGDRWRCLWDAKAILGEGTIWDERDGCIYWVDIEAPSVNWFNL
FT                   ETGSKGTWVPPKWVSAIAPRSSGGFIASSADGFVHIDPHADIYHPLVHPISDPRIARLN
FT                   DGVVDRSGRYWSGSCDCSQWDESTTAEDKESTLGNLDARNTGELYRLAADGTVSSQEQN
FT                   IVTANGPAFSPDGKTAYVNDSMPLVSWAYDVDADGNLRNRRDFLRFKPEDGYPDGMAVD
FT                   VEGCIWMAFYESWMLRRFAPDGTLLEDRQLPVRRGLRPAFGGTDHSRLFLITGSQGYGA
FT                   EQFAQQPLAGGLFEILDPPAAGVPNVPFAG"
FT   gene            complement(558851..559693)
FT                   /locus_tag="Saro_0518"
FT   CDS_pept        complement(558851..559693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0518"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24965"
FT                   /db_xref="GOA:Q2GB08"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:4JYJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB08"
FT                   /protein_id="ABD24965.1"
FT                   /translation="MDAVDGVRLEEGDAIDWIVFDRPQAANSFSATLLEQFSALVKDRQ
FT                   ANGAPVLGIRGSGRGFSSGMDLGEYNATSGPTSDVLRLSSYVERWLDLWRHPKPVIVAV
FT                   HGYCIGVAAQLASFADILVVAEDAMISEPTIPIGGGFIAPTWVSHVGSRHAKEFAFLPG
FT                   NRIDGRMAAAWGWANCAVPASEVIACCESLAQRMKLMPPAVLAMKKRSINRAMEAAGFH
FT                   AAASAIAESDALLHLEPEVTAIRNRLRTEDLKAVVGSYAGESSQEIFQRHGGHRPDAS"
FT   gene            559882..561576
FT                   /locus_tag="Saro_0519"
FT   CDS_pept        559882..561576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0519"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24966"
FT                   /db_xref="GOA:Q2GB07"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB07"
FT                   /protein_id="ABD24966.1"
FT                   /translation="MYATSADERRHAIAVRHPAWIWNNLHSYLDWSLGDLADRPLVIAD
FT                   EGTLTYGDAARLSVELAGGLKARGIKKGERVGLIMANDPLTVPLLFAIWRAGAIAVPLN
FT                   TLYRPDEIRFALAEAGCALLIAMDRFASRNFAQELEEGLPGWQAGACHDLPELRGGLIF
FT                   DRAAPGRLVEKLSGQGGGAEDHERVEGGDTALILFTSGTTGSPKGVEISHDNLLRAMYA
FT                   GAYHQAFEDGRRAVFSLPLYHGFGLVVGLLSGMVSGGAIIPLLRFDPHQILAATERHRA
FT                   TYLMGVPTMTIALLEQAKRQHYDLSSLNAIHSAAAPTPSWVWEDIRATFGCEEIITSYG
FT                   QTEVTATVICTAPGDSIETVSETQGRIVEAGIAGMPDQGGRIAEFKIIDPETGADLPWG
FT                   ASGELCCRSPMNSKGYFRRPKATAALFLEGGWIRMGDLGQFRPDGNLFLTGRTKELYKS
FT                   KGELVSPKELEQILTANPGVSQAFFIGMPDDQFGECGCAWVVRAEGSGICEGEVMDYLR
FT                   ERIPAYKMPREVWFIEDEALPKTGTGKVQKAELRNMALAMLADQKAV"
FT   gene            561623..562768
FT                   /locus_tag="Saro_0520"
FT   CDS_pept        561623..562768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0520"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24967"
FT                   /db_xref="GOA:Q2GB06"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB06"
FT                   /protein_id="ABD24967.1"
FT                   /translation="MTPAEISPIEDIIREAVEGRPFILVDADDRENEGDIIIPAQFATP
FT                   AQISFMACHARGLICLAITQERSSQLQLRPMAPRNESGYGTAFTVSIEAKEGVTTGISA
FT                   HDRARTIAVAVDPTKGVDDLVTPGHVFPLTARDGGVLVRAGHTEAAVDISRLGGLTPAG
FT                   VICEVMNDDGTMARLPDLKIFAAKHGLKIGTIADLIAYRRSSEQLVEEMASAPFQSHFC
FT                   PSPMTVHVYRNKIDGGEHVALVKGEIRADQDTLVRVHQVDLTTDVLGWNTASPEYLRRA
FT                   LRFISDHSGPGVVVLVRDPDPESISRRVAGGRREYHEKNANRDYGIGAQILIDLGVRQM
FT                   TLLTSSKAKLAALQGFGLTINGRTELRENRPDSPIRVRSDF"
FT   gene            complement(562789..563454)
FT                   /locus_tag="Saro_0521"
FT   CDS_pept        complement(562789..563454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0521"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24968"
FT                   /db_xref="GOA:Q2GB05"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB05"
FT                   /protein_id="ABD24968.1"
FT                   /translation="MPQKAAPRSPAPLSSHLNQGPKVALILAAEVLFARDGIEGASLRE
FT                   IASQAGQRNHHAVQYHFGSRDSLVQAVFDYRMNQMEEMRGLMLSQAEAEGKLTDLRTIV
FT                   EVIFLPQIQLIDAFGDHSYAAFLTAYLQRYQAQQFGQFGDHVAPQLARTLALLRSCLAY
FT                   LSEAAAQRRLITACFMFLNILVIHTRGNGSNEERFEDAVEDTIGQIVAAFAAPVKAVA"
FT   gene            563635..564759
FT                   /locus_tag="Saro_0522"
FT   CDS_pept        563635..564759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0522"
FT                   /product="luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24969"
FT                   /db_xref="GOA:Q2GB04"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB04"
FT                   /protein_id="ABD24969.1"
FT                   /translation="MAMETGLIFHPYMRPGRTARQTFEWGVQSAVHCDKIGFSSMMISE
FT                   HASQIWENIPNPELIMAAAALQTTNIKFAPMAHILPHQHPAKLAMMVGWLSQILEGRYF
FT                   MGIGAGAYPLASYIHGIKNGQDTAFLNEMVRESLFIMEKIWKREPFFYEGKFWSAGFPE
FT                   EEPAQTEEDEQHMLANYAPYGGGFPEFAVTGFSYNSPSMKLAGERNFKPVSIFSGIDAL
FT                   KKHWETYSEANIKAGFTPDRQRHAVSQTVFCADTDAEAKRLVMEGPIGYCFERYLIPIW
FT                   RRFGMMDGFAKDAGIDPLDADLEFLVDNVFVVGSPDTIVDKLNTLFAKCGGWGTLQVEA
FT                   HDYYDDPSPWFNSLELLAKEVAPRVKLPEAMAAA"
FT   gene            564837..567248
FT                   /locus_tag="Saro_0523"
FT   CDS_pept        564837..567248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0523"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24970"
FT                   /db_xref="GOA:Q2GB03"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB03"
FT                   /protein_id="ABD24970.1"
FT                   /translation="MTKSDHRCAVRKSGVGYFGGASLVALASCFLLPSVAAAQAESAEP
FT                   QEEIATQDIVVTAQRREERLSKVPVSVVAFGAEALQNRNITSEQDIGTLVPGLQVKNGQ
FT                   NSNQLSYSMRGQSLDPFSGTSPAVLPYLNEAPYNPGNTATAFFDLGSIQVLKGPQGTLF
FT                   GRNATGGAVLYTTPMPGDTFGGYVTVRGASRDYGQMQAAVDLPIAEGKAALRLAFDATR
FT                   GNGYVTNINTGNTLGDKNSRSGRVTLLLTPTDTLRNVTIVQYDRVKGTEGVGGIYTYYS
FT                   ATDPQFVSDGTNHVPVSGLTNTLAAIYGTNDGPAAPGFWPGAVEGYTKFTRANPYKVWL
FT                   QYDLPHSAENVFVSNTTELEIGADTKLKNIFSYMNGKSNTPGNLGGGPFGSLWLFKLAG
FT                   INATGAPGGQTFESNTFSEELQIQGSLMEDRLNYTAGVFYSNQKRFEIVPINIGADVVP
FT                   GGIADISYAYRNRQESKAIFAQVSYKVTEQLTATLGGRYTWENVGIRQAPGNVFGVDPD
FT                   SPAADQSRKLSAPAWTASLQYQIDPNNMVYFNQRGSFRSGNLNGTVAPFTDPLTGQPAN
FT                   FFKNEKVHDFELGYKFNGRIGGAPVQFNVAAYKVIVKDAQRALYALVGGAPAGFTVNVP
FT                   QAETQGFEVDAFAGLTSWLDVGFNLAYTDAKYTKRSVPIPFVGNLLVDSYPDAPKWAGS
FT                   ANIEIKFPLPEEIGKISLRGDYYGQTGFFFSNTNGTSTPGTHLDGYWNVGARLNWKEIM
FT                   GSQVSAAVFVRNLTNESYYISGYALGASNGVNTAYPGEPRTIGAEISVKF"
FT   sig_peptide     564837..564953
FT                   /locus_tag="Saro_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.448 at
FT                   residue 39"
FT   gene            complement(567592..567765)
FT                   /locus_tag="Saro_0524"
FT   CDS_pept        complement(567592..567765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24971"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB02"
FT                   /protein_id="ABD24971.1"
FT                   /translation="MSAWPPTSGEVAISNRAFPKIEYVYTDYANAKFADEDVSLGIDYS
FT                   RHQLLVGVSMRF"
FT   gene            complement(567941..568564)
FT                   /locus_tag="Saro_0525"
FT   CDS_pept        complement(567941..568564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24972"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB01"
FT                   /protein_id="ABD24972.1"
FT                   /translation="MRKILPKKGRRLPMWKGALTGRVAYAETIAELLWREHGRDRGAVK
FT                   QIMKTTGASERTVKHWMSAQHGPETVFFLRLLTSSSVMKAFVLDLIQISQLAAIAPQLT
FT                   DYPARGPSMLLPSREPRHEKPPDDRTNVPISVPASDPIIDGLNYRQRWFLDRVGSGYPC
FT                   RAYDLSTHWQVSLKTARRDIAALCSAGKIRYVGARKNGKYDPVG"
FT   gene            568674..570248
FT                   /locus_tag="Saro_0526"
FT   CDS_pept        568674..570248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0526"
FT                   /product="Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24973"
FT                   /db_xref="GOA:Q2GB00"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GB00"
FT                   /protein_id="ABD24973.1"
FT                   /translation="MRDWSHEDSDDEGRQARGLVRAAEYVRMSTDHQKYSTENQADAIR
FT                   HYATPRGIEIVRTYADSGKSGLKLEGRDALKQLIDDVQTGVADFTMVLVYDISRWGRFQ
FT                   DADESAYYEYICKRAGIAVQYCTEQFENDGSPVSTMIKGVKRAMAGEYSRELSAKVFAG
FT                   QRRLIENGYRQGGAAGFGLRRTLVDERGETKGVLGRGEHKSIQTDRVILTRGPDEEIAI
FT                   VQEVYAAFVHGGQSESAIAEQLNARGIVTDLGRPWTRGTVHQLLINGKYVGDNVWNRQS
FT                   FKLKKKRVRNDPAMWIRSPGAFEEIVARDLFDAAQSIIGARSFRLSDAEMIEALRKVYE
FT                   TKGTLSGIIIDECDGVPSSSAYLSRFGSLLRAYSLVGYSPDRDYAYVEVNRELRRLHPE
FT                   VTQKVLEGLKCQGSVSWRDCTTDQIIVNDEFSLSVVIVRCTSTPTGLLRWKIRFDTSQM
FT                   PDITLVVRMDTNNRQPFDYYLFPRLDVAAERLRLAEDNDLLLDAYRFENLDFFYEIAAP
FT                   VSVAEAA"
FT   gene            570248..571147
FT                   /locus_tag="Saro_0527"
FT   CDS_pept        570248..571147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0527"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24974"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ9"
FT                   /protein_id="ABD24974.1"
FT                   /translation="MPVTHSQNIEMIPISRITVLNPRARNKRQHREIVNNIEKIGLKRP
FT                   ITVSRRQGPSGARYDLVCGEGRLEAFQMLGQTEIPAVVIEASESECLVMSLVENIARRV
FT                   QRPIDIMNEIGSLRRRGYTEAQISQKIGVTSSWVSMIATLLERGEERLLAAVETGLIPI
FT                   SLAMEISRAETEGAQGLLLDAYETGNLRGKKLASVRRLLEMRMRGRSKLMPACKLGRKV
FT                   TNRKLTASDLMQVYQREAEKQRLLVKKSDFTQTRLLFIVEAIKNLLGDDGFVALLRAEG
FT                   LETMPRALAMRIAGEYDD"
FT   gene            571140..572099
FT                   /locus_tag="Saro_0528"
FT   CDS_pept        571140..572099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0528"
FT                   /product="RepB plasmid partition"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24975"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ8"
FT                   /protein_id="ABD24975.1"
FT                   /translation="MTDWAALDRQLLDPSTEIRVRLGFEQHSVTLKVNQIVPLKSLREG
FT                   VRESRKYAQIVSSIKAIGLVEAPAVVPNPKTPGQYFLLDGHLRIEVLKQLGVDTVECLV
FT                   ANDDETYTYNKRINRLPPVQEHRMIVRAIERGVTEAVIADALGLEVHSIRARFRLLDGI
FT                   CAEAADMLKETNCSMLVFDILRRMSTLRQIEAADLMIGQNNYSAIFARALLAATPYDQL
FT                   SAPAKKARKNDISGPTSQQISRMERELATLQAQVKSVEDSYGIDNLHLTFARGYIAKLL
FT                   DNARIVRWLSNHRQEYLSEFQRIAGIETIGSLSASTQE"
FT   gene            complement(572780..573094)
FT                   /locus_tag="Saro_0529"
FT   CDS_pept        complement(572780..573094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24976"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ7"
FT                   /protein_id="ABD24976.1"
FT                   /translation="MLYFLATAIGGRDLRNKTARGQGRPELLENGSVPTARKHVQVLKR
FT                   VIQVNSNNAETKVVSHVQRSRNGLAQCVQLLQCRATAILVIFHYDLPPTLSRLTFAKNP
FT                   "
FT   gene            573909..575255
FT                   /locus_tag="Saro_0530"
FT   CDS_pept        573909..575255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0530"
FT                   /product="TM1410 hypothetical-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24977"
FT                   /db_xref="GOA:Q2GAZ6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016062"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ6"
FT                   /protein_id="ABD24977.1"
FT                   /translation="MARTGMYVLQGVDPAAIAEAPFDVKVVDIYNDSGAMFTPTQVAQM
FT                   GGGPGSALLLGYFSIGEAEVYRDYFSSIPKSALGPENPQWKGNYEVAFWTQEWRTVATT
FT                   YLDKVIAAGYDGIYFDVVDEYQQAWAQANCPGGAAGAEQAMADLVAYLADYAHAKNPAF
FT                   KIWANNAEELLTNQTYFSHLDGMFKENLFYTDSGSAQPKSETSYSLQMMQSMLAAGKDV
FT                   IAIEYVSDPAKVTDVEAKAAAAGVGYYTADIDLNGISYTGVLPGQVIHEDWSGLTPTTT
FT                   TTTTTTAPPPADLVLNGTSYADTLTGQGGNDKLFGFAGKDVLAGNGGNDWLEGGNGNDR
FT                   LTGGAGADSFVFRASGSKHMDTITDFQPGIDHIVLDRAVFTKVGAAGALADAAFWEGSK
FT                   AHDASDRITYDSVTGTISYDSDGTGWHSAVVVATLAPGLHLTASDFIVI"
FT   gene            complement(575338..576366)
FT                   /locus_tag="Saro_0531"
FT   CDS_pept        complement(575338..576366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0531"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24978"
FT                   /db_xref="GOA:Q2GAZ5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ5"
FT                   /protein_id="ABD24978.1"
FT                   /translation="MNHSPRLFQLDALRGLAAMAIMLFHLDLVYRIHGPFVRGYLFVDM
FT                   FFLLSGFVLAVSTERKLKAGIGALAFTRDRFVRLWPLVAVGAGVATARAFAIGMADPLT
FT                   LLLWLALDLAMIPSFSGTGPFYRYNGPQWTLFYELLANFLHALVLRKVPTRWMLALALA
FT                   LGVALIVTVRMHGSDTMGVDAPTWDTWWMGLPRVGWSYVLGVWMGRKYKDGVRGPALPW
FT                   WLTLALPVVAIALVPRLPLRVAHGDLVFVMGFLPLAVWAVAQSRPPKALKPAFEWFGNY
FT                   SLPLYCVHLTVLVWISELLGRAAWVQATAVGAAMLLAFVFSRLISFKGRPTRGKPDLAP
FT                   TG"
FT   gene            complement(576491..577765)
FT                   /locus_tag="Saro_0532"
FT   CDS_pept        complement(576491..577765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0532"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24979"
FT                   /db_xref="GOA:Q2GAZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ4"
FT                   /protein_id="ABD24979.1"
FT                   /translation="MRAMSLADVPDVARALPDPRSRILAAAGEIFRREGFAGTTVDAVA
FT                   AIARMSKESIYDLFPTKSALFEAAVRASIDKHVYHGPAEGPAESVDAFLAHMGTSMFER
FT                   YVEPMNFGLFRNNIEAANHFPELASTLHEHRRQASQANAVHLQPWIDRGCLQTTDALAT
FT                   VIRFSSLCIGGSRYFLGHPLPSKGERRQLVERTVSLFLDGYGSVTSGTPAAFAPPQPRS
FT                   HHPATTVRMSTARIREMLDAIEDEFLRHGYRSASIDRAVSVVKVGKTTVYRQFGNKEGV
FT                   FRHIIEDRIVAEAERTYDTAPDAATLEDALASLARQALDNHCEGDNIHLHRLLIQESEA
FT                   FPDLARAFYDAKIHALSKGLCAVTDRFGAPKPDQASIEDFHNLATSALRYVTTKDLPSR
FT                   EERTVDAAEVSRLFVRGMRSPPRLP"
FT   gene            complement(577801..580191)
FT                   /locus_tag="Saro_0533"
FT   CDS_pept        complement(577801..580191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0533"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24980"
FT                   /db_xref="GOA:Q2GAZ3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ3"
FT                   /protein_id="ABD24980.1"
FT                   /translation="MFIYKFAMSRRNRHKMRALRIFTAISSPLALWSSTATGQEALPQA
FT                   PQPFAGSIGRTYVDSVPSFPKPVTAPAGAPNVVLIMTDDVGFGAASTFGGPVPTPNLDR
FT                   LASRGIVFNRFHTKAMCSPTRASLLTGRNHHAVDNGTVANLSTGFPGYDNNLPKSAATV
FT                   AEILRQHGWNTAMIGKHHNTPEPFVSPAGPFDLWPTGLGFEYFYGFMAASTNQFSPALY
FT                   RNTSPIPTLRDGVLDKALADDAIGWIHAQKAAAPDKPFFLYYATGSAHNPLQAPADWIA
FT                   KFRGRFDNGWDAVRKGTVDRQRKLGIVPRTTKDTTRPDEIPAWSTLTPEQRRVNARLME
FT                   VYAGMLSYQDAQIGRMLDELDRMGEADNTLVMFIEGDNGAAPEAGPDGQSNPMAVFANG
FT                   FKEDASSLAAQLDKLGGPDAVAGMGWGWAWATNAPFKWFKQYGSHLGGTRNPLVVSWPK
FT                   GISGRGIRSQFTDVVDVMPTILDLAGVQIPDSVNGVKQQAVDGISFRYTLDAPDAPERR
FT                   HTQYFEMMGNHGIYHDGWMASTTPVNRLRSKPDHPVLPTDYKWELYNLTRDYSQANDLA
FT                   AKHPEKLAELKALFEVEARRNNVYPLDDRLDMARFSASAALVPKRKRYVYWGEVTLPAA
FT                   TSAPIFNRGFTLDAQVDVASSQGTGPLLAIGGKFAGWSFYLVDGRPAVTVATSQRPEDH
FT                   FRVVASQPVAPGASRIGFSFRYDGGHNAGGEMIITANGKEIGRGRIPRTLSKLVEMTDT
FT                   FDIGFDADTPVTDDYPKGSHFPGTIARLEIVPGDAGAPTPVER"
FT   sig_peptide     complement(580075..580191)
FT                   /locus_tag="Saro_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 39"
FT   gene            580304..582577
FT                   /locus_tag="Saro_0534"
FT   CDS_pept        580304..582577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0534"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24981"
FT                   /db_xref="GOA:Q2GAZ2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ2"
FT                   /protein_id="ABD24981.1"
FT                   /translation="MISALGASALALMASAAFGQAVVPAPATVPAYQIKAPAGAPNVVV
FT                   ILLDDVGFGAASTFGGPIETPALGRLAADGLRYNRFHTTGICSPTRASLLTGRNPHSTG
FT                   IGAVENSSDERPGYSGFHSKDTASIATVLRQNGYNTAAFGKWHQVPDWEASPSGPFDRW
FT                   PTGEGFERFYGFIGGETDQFDPSLFEGTTPVMRPDVPNYHLTEDLADKSIAWLRTQHSV
FT                   TPDKPFFLYFAPGATHAPLQVPRGWSERYKGKFDQGWDKVREETFVRQKRLGVIPANAR
FT                   LTPRPDGLPAWDSLTPDQKRFAARTMEVYAGFLAHTDAQVGKLLDSLAANGERQNTMVF
FT                   YVFGDNGASGEGGLSGSANYFANIQGLPETDQIRAAHLDALGGPDAYAHYPAGWAWAMN
FT                   APLPWMKTVASHLGGTRNAMVFDWPGHVADKGGIRTQFSHVNDIVPTILEAAGITAPST
FT                   VDGIAQKPMDGVSLLYSLKDPKAPERHLTQYFEVFGHRAIYHDGWMASAFHSRLPWSVM
FT                   GFGDKKFEDDRWALYDLGKDFSQARDVADRNPAKLADLKALFDAEAARNQVLPLRNTTL
FT                   GNNKVPSIAAGRTTMTFHEGAVGVPETALPRAMNRSWSVDAAIDIADGAEGVVATLGGR
FT                   SAGWSLYLDRGGKPTFSYRVFDIEAVTLRAAQSLAPGKHALRFDFDYAGPGYGKGARLR
FT                   LMVDGAVVDTGEVKSSPTAFYTIDESFDVGLDHGSPAGSYPAGTAPGFAFQKGRIEQVT
FT                   FSAR"
FT   sig_peptide     580304..580363
FT                   /locus_tag="Saro_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.909 at
FT                   residue 20"
FT   gene            582643..585204
FT                   /locus_tag="Saro_0535"
FT   CDS_pept        582643..585204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0535"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24982"
FT                   /db_xref="GOA:Q2GAZ1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ1"
FT                   /protein_id="ABD24982.1"
FT                   /translation="MHSRTTAAVWLAGAAICGLAAPAFAQGAEQSVGDAAEQGVGEIVV
FT                   TAQKRSESLQRTPIAISAIPAAQLDLQGIAEAKDLSAIAPNLSVVGATTNATAAVISIR
FT                   GIPTSADETQGYDSSIGVYVDGIYMARSSAATFEVADIERVEVLRGPQGTLFGRNTTGG
FT                   AVNFITRAPSSEAGLSLRAGIGNYDMRTARAVFNTGTLADSLRMSFSYLYKQRDGIVDN
FT                   LLAAENRDPGSSLIHSARWSAQLDLGDRVKITNIFDWTRVEGVAGYQQLSAVGNGNTTD
FT                   FPSTLSLGGNVFPVVQPANVLGYLNEATSLDARCGTPVSQISTERRTRVCNNSAQPSVD
FT                   KLWGNMTRVEADLDWLTIRSTTAARWWRNHIAGSDLDGMGAISGPAFSQASLLNGMPLQ
FT                   VLDLIPTLSPAARTALAAAPVPTTTQDLFSTRNDRRQKQFSQELEFVSNSGGAFEWVLG
FT                   AFYFKESGAEFNPQSYAFVIDTNAAVFNAGNFGALAPLLQAGNPARYRALAVQSALGYT
FT                   SDSESFAVYGQGTLRPGGPDGRLGITLGLRYSWDSKDFQVYQNGATPFTDAQLPNNTSS
FT                   KKFSAPTGNLTVDYRASDDVNLYARVARGYRSGGFNARQNTSSIPLTPFNKETIWSYEL
FT                   GIKTQFNNRVRLNAAVFYNEYKDQLVTLPVPVGEGQSFGNITVNAGKTRYYGAEIEGRF
FT                   VVDDHLSLDAAAGYVKTDPRDFPAGDVNNVIRNVASIQHLGYAPEFTGNVGATYRRPIG
FT                   SQDLTARVGYNYTSSFWMFGNPLTAPFGRQTKGDARGLLDAQIRLDRIAMGSAEASLTL
FT                   WGKNITNKSYVVRAVDFGQLGFATTIYGDPRTYGLTLDVKF"
FT   sig_peptide     582643..582720
FT                   /locus_tag="Saro_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.886 at
FT                   residue 26"
FT   gene            585343..586290
FT                   /locus_tag="Saro_0536"
FT   CDS_pept        585343..586290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0536"
FT                   /product="protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24983"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAZ0"
FT                   /protein_id="ABD24983.1"
FT                   /translation="MSREAEQRHAGMRLIEGGTFLMGSEAFYPEEAPVRRVRVDSFWID
FT                   ETPVTNFQFAAFIEATGYVTVAEVAPDPKDYPGMIPGMDRAGSLVFQKTSGPVDMADAS
FT                   NWWRFTFGACWKHPLGPGSDLAGLEDHPVVHVAYPDAEAYATWAGKCLPTEAEFEFAAR
FT                   GGLDGQDYAWGSELAPDGRMMANYWQGLFPFANQCLDGWERTSPVRSFPPNGHGVYDMI
FT                   GNTWEWTSDWWTAKPMPPKAKRSCCPIDNPRGGRLRESFDPDHPGVRIGRKVIKGGSHL
FT                   CAANYCQRYRPAARHPEMVDTATSHIGFRCVVRG"
FT   gene            complement(586351..587277)
FT                   /locus_tag="Saro_0537"
FT   CDS_pept        complement(586351..587277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0537"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24984"
FT                   /db_xref="GOA:Q2GAY9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY9"
FT                   /protein_id="ABD24984.1"
FT                   /translation="MDLRQLRQFLAVANARSFSRAAETLNIAQPPLSRTIRHLEEEIGG
FT                   ALFDRTARPLAMTPLGQLLHEQARQILDRMGDMHDMMKAAAATERRRFTIGFVASTIYA
FT                   RLPELIRAFRKRAPDVELTLVESSTLEQLAALKDGRIDVGFGRIRFEDPAIKRIILRNE
FT                   RLAVALPRDHPLALDDRPLTLKQVAAEPQILYPRAPRPSYADQVISLFRDHGLEPRIAH
FT                   EARELQIAIGLVAAEEGLAIIPESISRSRSHDVVYRELAEAATSPIIMSHRMNDSSAEL
FT                   RLMAQVIASEYAAWGYPVPEILAHSAP"
FT   gene            587562..588896
FT                   /locus_tag="Saro_0538"
FT   CDS_pept        587562..588896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0538"
FT                   /product="benzoate 1,2-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24985"
FT                   /db_xref="GOA:Q2GAY8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY8"
FT                   /protein_id="ABD24985.1"
FT                   /translation="MSAALKTRIETAVVDDAETGQFRCRRDIFTDPDLFELEMKHIFEG
FT                   NWVYLAHESQIPAANDWFAVTVGRTPVVITRTKDGSFNAFINACSHRGAMLCRRKRGNG
FT                   RVMVCPFHGWSFTNDGKLLKAKDEGSGAYPESFNRDGSHDLARLARFESYRGFLFGSVN
FT                   PDVAPLAEYLGETRVIIDQIVDQAPEGIEVLAGSSSYIFDGNWKLQMENGCDGYHVSSV
FT                   HYNYARTMGRRAEGGTKAVDANGWSKAVSGVYGFDNGHILLWTRVLNPEVRPVWSRKDE
FT                   LEQRLGKERTRFIVEQSRNLALYPNVFLMDQFSTQIRVVRPIDADHTEVTIYCFAPKGE
FT                   SPELRAVRIRQYEDFFNVSGMGTPDDLEEFRTCQASYAGAGGLWNDLSRGARRWIAGPD
FT                   ENAREMGLNPLLSSERSEDEGLFVRQHEYWAKTLLEGLARQEEMA"
FT   gene            588893..589378
FT                   /locus_tag="Saro_0539"
FT   CDS_pept        588893..589378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0539"
FT                   /product="2-chlorobenzoate 1,2-dioxygenase"
FT                   /EC_number="1.14.12.13"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24986"
FT                   /db_xref="GOA:Q2GAY7"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR017641"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY7"
FT                   /protein_id="ABD24986.1"
FT                   /translation="MSALDEVCAFLHREARLLDDRQLDVWLECYAPDCTYWMPAWTDDD
FT                   ELVTDPQSQISLIYYANRQGLEDRVYRLETERSSASTPEPRTVHMLANIELLEDRGDEL
FT                   DVRYNWHTLSHRFKVTSQFFGVTFCTLRRSMDGFSIGSKKVVLKNDYIHQVIDVYHV"
FT   gene            589371..590162
FT                   /locus_tag="Saro_0540"
FT   CDS_pept        589371..590162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0540"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24987"
FT                   /db_xref="GOA:Q2GAY6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY6"
FT                   /protein_id="ABD24987.1"
FT                   /translation="MSEYGAHFAGRFDGKVMVVTGAAQGIGRGVAERAAAEGAQVLLVD
FT                   RADFVTDVAAAIGPKAHAFVADLEGHAGAAAAVAHGLAVFGRIDILINNVGGAIRMRPY
FT                   DQFTSEQIDAEIRRSLMPTLYCCHAVLPPMLAQGAGTIVNVSSNATRGIRRGPYSAAKG
FT                   GINALTQSLAMEYGEQGIRVVATAPGGTSAPARKVPRNAEGDSAQEQAWMAEAVEQVTR
FT                   STFMKRYGTLEEQIAPILFLASDEASYITGTVLPVAGGDLG"
FT   gene            590232..591146
FT                   /locus_tag="Saro_0541"
FT   CDS_pept        590232..591146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0541"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24988"
FT                   /db_xref="GOA:Q2GAY5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY5"
FT                   /protein_id="ABD24988.1"
FT                   /translation="MSDAPQHRLKIDPRAVSTFWKVCETGSISGAARALNLSQPSVSNT
FT                   IALLEHRLGVTLFARSRSGIVLTPEGLALRDRAEAMVRLLETAVVEVDHAARNIAGPLR
FT                   IGGTPGALVSILPEAVARIEAQVGPFALSVVERPDPQLGDLLRKGTIDLACVTTEIEEC
FT                   PPDLAEITVSRDPFALVVGRRHDGLGGRVSLRDVAGLPWVLPEAQGAFRRQVDALFLAA
FT                   GVPVPRNVIRCDSLLTTKAIVRHGDRVTILPRTVAAAELTIGVLRAIAIEEATFERSVG
FT                   IRYPVDRGLPPLGRAFVEALSNP"
FT   gene            591233..592552
FT                   /locus_tag="Saro_0542"
FT   CDS_pept        591233..592552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0542"
FT                   /product="aryl-beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24989"
FT                   /db_xref="GOA:Q2GAY4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY4"
FT                   /protein_id="ABD24989.1"
FT                   /translation="MIDRRSVLAGSVALAATPALAGVKTRRHPDPVFPKGFLWGASTAP
FT                   HQIEGNNTASDLWFLENQQPTVFAEPSGDAANSLLLWERDLDLARDIGLNTYRFGVEWA
FT                   RIEPEKGRFSQAMLDHYRRVVDGCRARGLVPIVTYSHFTAPRWFSAQGGWTNPESAELF
FT                   ARYCTKVTQAIGDAIHSAITLNEPNILLILKPMLPQAVWDIQKLTLETAGRRLGVEKFV
FT                   CANVAAFEDLPALQHGLLAAHKAGRAAIKAVRPALPVGVSIAMLDDQAVGRNSIRDRIR
FT                   SELYGAWLDVAKADDFIGVQNYERALWGDKGRLPAPQDAPRNWSGTEIWPGSLAGAVRY
FT                   AHAMTGRPVLVSEHGVGTDDDAVRAALIPPALGALKQAMDDGVPVLGYCHWSLVDNFEW
FT                   IFGYKPRFGLATFDPVTFERKAKPSARVYGAIARANALTA"
FT   sig_peptide     591233..591298
FT                   /locus_tag="Saro_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            592634..593659
FT                   /locus_tag="Saro_0543"
FT   CDS_pept        592634..593659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0543"
FT                   /product="UTP-hexose-1-phosphate uridylyltransferase /
FT                   UDP-glucose-hexose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /EC_number="2.7.7.10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24990"
FT                   /db_xref="GOA:Q2GAY3"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY3"
FT                   /protein_id="ABD24990.1"
FT                   /translation="MTRFSTDDHPHRRQNLLTGKWVLVSPHRAKRPWQGETGDPAPTGG
FT                   PSHDPGCYLCPGNARTSGERNPDYPGAFAFDNDFPALMPDNPAPEGGDPVFRVAEARGT
FT                   ARVICYSPDHSKTMPDMDVAAIRSLVNCWAQESETLGAHFANVQIFENKGAMMGCSSPH
FT                   PHGQIWASDFIPTEVADEDREQAAWHASRGRVLLDEVAERELASGERVVEANEHWLAVV
FT                   PWWATWPFEILLVARDGVGRIEELSDASRDALASILRAVTRRYDALFNASFPYSMGWHQ
FT                   RPAGSSDPAAWRLHAHFNPPLLRSATVRKFMVGFEMFGESQRDITPETAAARLRALEID
FT                   A"
FT   gene            593656..594798
FT                   /locus_tag="Saro_0544"
FT   CDS_pept        593656..594798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0544"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24991"
FT                   /db_xref="GOA:Q2GAY2"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY2"
FT                   /protein_id="ABD24991.1"
FT                   /translation="MTALHDRLLAGFAQAFGGEPELVVRAPGRVNLIGEHTDYNDGFAM
FT                   PVAIGQETRVAFRPGGTGLRVAALDFAEDDAFDSAAPQRAGGGWRDYVRGVVDELVRAG
FT                   ISVPPGQLAIAGSIAKGTGLSSSASLEVAVARVLLDAAGERMDPVSLALLAQRAECDFV
FT                   GVRCGNLDQIASAATTRGHALLIDCRTLALRQIAMPADVAVMIVQSGVVRGLVDGEYNQ
FT                   RRQECERAARTLGVPALRDVDEGMLDEACGRLDDLAFLRARHVCGDNRRTREAARALAS
FT                   GDLVAMGALMRESHVSQGRDFGITVPHTDVLAALMNEAIGEDGGARQTGGGFGGAVVGL
FT                   MRQDRVAAVREAVLAVYRTPAGDVPEICIEVPSDGAGPVG"
FT   gene            complement(594815..597991)
FT                   /locus_tag="Saro_0545"
FT   CDS_pept        complement(594815..597991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0545"
FT                   /product="Outer membrane autotransporter barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24992"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY1"
FT                   /protein_id="ABD24992.1"
FT                   /translation="MDRLRTTTILSTLAGTPVALALLVPQAANAATSITTSQTTPVKTS
FT                   TAGDLTIGDDGKITLETGEPAVTIDSNNTVTIDSGGAIKNVEGEDGAIGIAVDAGKTTT
FT                   ITNDGTITITETFTVSDDDSNGIADGPISSASDRYGILVRSGSTTKASIENTGTITVEG
FT                   LNSGGIVVKSDLDGSIENTGTIKVLGDNGVGISTQGVTGDVTIEGTVAVVGKGAQGVVL
FT                   GGDVGGTFRIQGAIAQSSSYTTDDGTSQTLSRTDLRTGKAAVEVTGNVAGGILLDAAPY
FT                   NRDSSNTDEDGDGVADASEETGSIASVGNSPALLIGGTSDITIGKVTGRDGDFSLAIDG
FT                   NITASSVYSNTNAYAVVIGGQGGSVTMANGIGVSGSVIATTVDETAIAVLINEGSTVPT
FT                   LSNSGTIKANISSPGEGAAYAIQDKSGTLTTIENTGFITVTGSSTDDMRAIDVSANTTG
FT                   VTIKQYLNDLDELAQENEQEEDGYDASNPTIYAAITGNIYTGSGNDVLDIATGRIYGNS
FT                   YLNAGNDQVLLSGDSGYEGKIYFGSGTATMTMSDTAYFVGNLDLAGNAGTLTMSDSSSF
FT                   SGTISNGANLDVTVNGGTFGASSATTLSFDTLTVKSGGALNVYIDGSEGTASLIDVNTA
FT                   TFASGSKVSATISSLENAEGSYTILKADSLEGTPSFDSTTTELPVLFNGDVSVVGETLV
FT                   LDVTRKTASELGLTAPQSAAYEAIYSQAVAIDDLGTSLLQVEDVAALQEQFNQLLPDYA
FT                   GGVFDFVTRSGRLASRHLMDDSSLFDISNAGGWLEPIWFRGSKDDTGTAGFKVKGWGIS
FT                   SGIERITGIGNVGLSFAYTKGSISTGSYQKTDASNYELGAFWRTGTGPFYAYAKISVGR
FT                   VSLNSTRTFTGEVDSDSLSYSANGQWKGWTFGGQGGASYKLALGGGLALKPMARFDWYR
FT                   LNEKGYTESGDDEIYLTVAKRNSSLLSGTGSLTASWSAGESTRESRPLTVELEGGYRSR
FT                   LAGKLGTTVANFEDGDQFRLTPDAMKSGWTTEARILAGGLDYTWQLAGGAEQIQGSVDY
FT                   SVRGSLSIAF"
FT   sig_peptide     complement(597899..597991)
FT                   /locus_tag="Saro_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            598289..598936
FT                   /locus_tag="Saro_0546"
FT   CDS_pept        598289..598936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0546"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24993"
FT                   /db_xref="GOA:Q2GAY0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAY0"
FT                   /protein_id="ABD24993.1"
FT                   /translation="MTFYGDVRSEAVAGDDVLLCPADPIHREALHDAALMSEVARGSVE
FT                   AFSVLVDRHSPALYRVAMRMLSDGAEAEDVVQDCFTRLWQNAPRWKPSGAGLVGWLHRV
FT                   TMNLCFDRKRRFRVVTVETLPDPADDSPLPDRRIEADQAARGVADALADLPERYRAALV
FT                   LCYYEGFTNALAAEVLDLNIKAMESLLFRARRQMRGLLEARDISTGDLEAQA"
FT   gene            598936..599712
FT                   /locus_tag="Saro_0547"
FT   CDS_pept        598936..599712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24994"
FT                   /db_xref="GOA:Q2GAX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX9"
FT                   /protein_id="ABD24994.1"
FT                   /translation="MARAVPRSPALQEAALDAALARAATPSMPAGLAARIVTRATALPQ
FT                   IPADPLPEPEVVEAAPVTEAEVIRLAPAAPLPQQPRRIGRFAIAGLGAIAAGIAAIALV
FT                   GQPSPQSGAPTGPAQAPALVAAPAPASVSGPTAPPAERLAAAPRQAVPTATGVKASSPA
FT                   PVAAPEAPVRPEAATPEVQLATSGQRTAADPAGPRDEPGAAPRVVPHGGLMGPPAPQQG
FT                   WGFAGGAPGGALPGGQPLPSQTTGTMPPPPPPGGHP"
FT   gene            599767..600258
FT                   /locus_tag="Saro_0548"
FT   CDS_pept        599767..600258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0548"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24995"
FT                   /db_xref="GOA:Q2GAX8"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX8"
FT                   /protein_id="ABD24995.1"
FT                   /translation="MQHQPILVLTTGGTIDKAYFDALSEYQIVESGIPALIAEARVALP
FT                   FRIVELMRKDSLELTDADRALIAAAVREAPETHIVITHGTDTMTDTAKALAPIEGKTIV
FT                   LTGALSPARFAETDAPFNLGMAFATAQVAAPGIWIAMSGQVFDGLKVRKDRAAGKFVAV
FT                   "
FT   gene            complement(600266..600691)
FT                   /locus_tag="Saro_0549"
FT   CDS_pept        complement(600266..600691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0549"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24996"
FT                   /db_xref="GOA:Q2GAX7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX7"
FT                   /protein_id="ABD24996.1"
FT                   /translation="MGVTIRAADPADREATVALWEAAGLTRPWNDPRADFDLALSTPTS
FT                   VVLLAEAGRDLHGSVMVGFDGHRGWVYYLATSPDRRGQGIGRQLMLAAEDWLKAHGSPK
FT                   IQLMVRGDNLAARGFYDALGYEVQDVVTIGKRFAPNP"
FT   gene            complement(600682..602304)
FT                   /locus_tag="Saro_0550"
FT   CDS_pept        complement(600682..602304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0550"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24997"
FT                   /db_xref="GOA:Q2GAX6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX6"
FT                   /protein_id="ABD24997.1"
FT                   /translation="MQLSHLSLHLDRNGQCAYRPAMSIQPSESILIVDFGSQVTQLIAR
FT                   RVREAGVYSEIAPFSQAEAAFHRMKPKGIILSGSPASVPADGSPRAPQVLFDSGLPILG
FT                   ICYGQQVMSEQLGGKVEPGDSGEFGRAFLTVTEPCVLFDGLWAVGERHQVWMSHGDKVT
FT                   QFAPGFRIVAVSDGAPFAVIANDEKKYYGTQFHPEVVHTPDGGKLIANFVRHVCGCAGD
FT                   WSMAEFRRTKIAEIREQVGDSRVICGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLMR
FT                   MGEAEQVVSLFRNHYNIPLVHKDVSALFLGGLAGVTDPEAKRKFIGKTFIDVFEAEARQ
FT                   VGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEV
FT                   RALGRELGLPEIFVGRHPFPGPGLAIRIPGEVTKERCDILRKADAIYLEEIRNAGLYDA
FT                   IWQAFAVLLPVKTVGVMGDGRTYDSVCALRAVTSTDGMTADIYPFDAGFLSRVATRIVN
FT                   EVKGINRVVYDYTSKPPGTIEWE"
FT   gene            602665..603510
FT                   /locus_tag="Saro_0551"
FT   CDS_pept        602665..603510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0551"
FT                   /product="glutamyl-tRNA synthetase, class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24998"
FT                   /db_xref="GOA:Q2GAX5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX5"
FT                   /protein_id="ABD24998.1"
FT                   /translation="MTVTRFAPSPNGPLHLGHAYSAIVAHDRAKRDNGEFLLRIEDIDG
FT                   ARSRPDLADEFRADLQWLRLDYREVAPQSQRIASYRTAANELRAMGILYPCTCTRAEIA
FT                   AAAVAQGPDGPLYPGTCLRRGPVPGPDVAWRLDMEQATLIAGPLEWTDERHGVQQARPE
FT                   MFGDVVLWRKDAPASYHLAATLDDATDGITHVTRGVDLFRATHVHRLLQHLLGLPVPVW
FT                   YHHPVLVEADGRKLAKRRDAPALADRRRAGEDGRAVAAEVRATLFDTGISLSDTIDQSA
FT                   "
FT   gene            603507..603737
FT                   /locus_tag="Saro_0552"
FT   CDS_pept        603507..603737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD24999"
FT                   /db_xref="GOA:Q2GAX4"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX4"
FT                   /protein_id="ABD24999.1"
FT                   /translation="MNYVLIPLIIIFTVMTVVSLVRGIIAFLHSTREDLNRDPAAGATA
FT                   NQLLQNKMMFNRIKFQGLAVVTVAILLAFSR"
FT   gene            603757..604317
FT                   /locus_tag="Saro_0553"
FT   CDS_pept        603757..604317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0553"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25000"
FT                   /db_xref="GOA:Q2GAX3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX3"
FT                   /protein_id="ABD25000.1"
FT                   /translation="MVKLNKIYTRTGDDGTTGLVDGSRRAKHDARMQAIGDVDEANSLI
FT                   GLAAVASPVATARDLQRIQNDLFDLGADLATPGEDFAPSEMVLRVVPSQVAWLETAIDA
FT                   LNEALPPLTSFILPGGSEVAARVHVARAVVRRAERSAVALASVEPVNAQALAYLNRLSD
FT                   YLFVLARATNAGGDPLWVPGASR"
FT   gene            604391..605263
FT                   /locus_tag="Saro_0554"
FT   CDS_pept        604391..605263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0554"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25001"
FT                   /db_xref="GOA:Q2GAX2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX2"
FT                   /protein_id="ABD25001.1"
FT                   /translation="MIKTVAVIGAGQMGSGIAQVSAQAGMKVLLGDVSIELADKARDKI
FT                   AKGLSKLVEKGKVDATLAASTVANLHTFSDHAALAEADLVIEAATEREDIKHKIFESAG
FT                   RHLAAHAIMASNTSSIPITRMAVSSPDPERFIGIHFFNPVPLMKLVEVIPGLATSVPTI
FT                   EAVRDYVANIGKEIVLSQDEPGFIVNRIFVPFINEAAFVLGSGTGSIVDIDKGVKLGLN
FT                   HPMGPLELADFIGLDTLLEIMKIYLASTGDPKYRPAPLLQKYVEAGWLGRKTGRGFYDY
FT                   SGEVPVPTR"
FT   sig_peptide     604391..604459
FT                   /locus_tag="Saro_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.869) with cleavage site probability 0.476 at
FT                   residue 23"
FT   gene            605322..605684
FT                   /locus_tag="Saro_0555"
FT   CDS_pept        605322..605684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25002"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX1"
FT                   /protein_id="ABD25002.1"
FT                   /translation="MNDPERPDPASAPEAVNLEQQDADAQAQTVAEEALGRATSVLGEQ
FT                   DLGERVSGQADEGGSAPDLVDHMRRMVSSGRIDMSAYRGERSDDDEEGMYGEAGIDDET
FT                   PRGAYTAEDLEDDEPI"
FT   gene            complement(605947..606336)
FT                   /locus_tag="Saro_0556"
FT   CDS_pept        complement(605947..606336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25003"
FT                   /db_xref="GOA:Q2GAX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAX0"
FT                   /protein_id="ABD25003.1"
FT                   /translation="MSIHGRSRRQRSHDAKETPMTSPSSRNRIAAWVFGASVLLTAALI
FT                   ASQVASEDKVAPEPSATAEAAAGPVFDEWAKDAPDPDEGKGKLIGHVERDGQMIEVRQL
FT                   PPDQDPDAADDPALVEPGSADQPSP"
FT   sig_peptide     complement(606181..606336)
FT                   /locus_tag="Saro_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.611 at
FT                   residue 52"
FT   gene            606585..607016
FT                   /locus_tag="Saro_0557"
FT   CDS_pept        606585..607016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0557"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25004"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW9"
FT                   /protein_id="ABD25004.1"
FT                   /translation="MKTLLPVLSLALLSLQPGISHAGAVDPERASFAQCGVGKRITCVV
FT                   DGDTFWYEGAKIRMADINTPETSGPSCAAEAVLGARATRRLTQLLNDGPFTLEVRGRET
FT                   DRFGRALRVVTRQGKSLGAILEAEGLAEYWKGRRSDWCA"
FT   sig_peptide     606585..606653
FT                   /locus_tag="Saro_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(607023..607658)
FT                   /locus_tag="Saro_0558"
FT   CDS_pept        complement(607023..607658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0558"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25005"
FT                   /db_xref="GOA:Q2GAW8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="PDB:2RAS"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW8"
FT                   /protein_id="ABD25005.1"
FT                   /translation="MASSGTEHDAMRARLVDVAQAIVEERGGAGLTLSELAARAGISQA
FT                   NLSRYFETREDLMEAIADYWFHPMVEIMEDVLASDLPPRRKMYEFFARRFVVMRRKWEA
FT                   DPVKLQTYIEVGNDYFEQVRSYIDLADHYLGEIIGEAMSDGAFSGLEVDETISLVNQMC
FT                   APYCALNTMTTFMERLSEDKLARIVDAVFDGLSAQDRGARSLTGLRAA"
FT   gene            607830..609581
FT                   /locus_tag="Saro_0559"
FT   CDS_pept        607830..609581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0559"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25006"
FT                   /db_xref="GOA:Q2GAW7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW7"
FT                   /protein_id="ABD25006.1"
FT                   /translation="MISRFRPALALLLSGCLGACAAPMAEGGHGEPVEVGIVAINDFHG
FT                   ALEPPRQSVNVTDAAGNILPVPAGGAAWLASAVDSVRAAHPHSLTVSAGDMISASQLAS
FT                   SLYLDEPAIGVMNRIGVDFNAVGNHEFDRGQDELLRMQNGGCEKFTARQPCALEPFAGA
FT                   TFRYLAASTRRADGSTLFPATGLRTFGSGRRAVTVGVIGLTLKGTPNLVNPTGIKGLTF
FT                   EDEADTINAAVPVLKAKGADAIVVLIHEGGRTKGNPDPQGCNDFAGDIRPILDRLDTRV
FT                   DVVVSGHTHWAYVCDYAALNPAKPILLTSAGVFGELVTDISLKIDPVAGRVVSKQARNV
FT                   IVQSVPYTATRGPISNTPLFPQFQPRADVAAYVAKYVEASKEYTQRPVGRIDRAAPKNE
FT                   GAEGGAGGPLGNLIADAQLGATRDAGAQIAFMNPFGIRAPLVPAADGTLTFGDIYLCQP
FT                   FGNNVVTETMTGAEIKAVLEEGLDDNGPRQALAPSTGFEFRYDPARTSGDRIVSITLDG
FT                   QPLDMTRTYRVTVNGFLGLGGDGFSGFVGKPDTVTGPTDIDALESWIKAVPVRNVPQEV
FT                   RALVVKG"
FT   sig_peptide     607830..607907
FT                   /locus_tag="Saro_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.567 at
FT                   residue 26"
FT   gene            complement(609600..610397)
FT                   /locus_tag="Saro_0560"
FT   CDS_pept        complement(609600..610397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0560"
FT                   /product="protein of unknown function DUF1295"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25007"
FT                   /db_xref="GOA:Q2GAW6"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW6"
FT                   /protein_id="ABD25007.1"
FT                   /translation="MAEALLVNLVVLVLGMLALWRVAVRIDDVSFIDAVWGGGMGVLAL
FT                   VSWLHVPGGPGVRAHLIAAMAAIWAARLAWHLYTRWRANGEDPRYARILGKARARGQYG
FT                   SAALKVVFAPQAVLLFLTCLPAQLGVLASTAPAPLGPLAVAGAAVWLVGILFEAVGDEQ
FT                   LKRFLADPASKGKVLDTGLWRFTRHPNYFGDACVWWGIWLAAADAGLWVALASLVGPVF
FT                   LTFTLTRWSGKPLLERGMAERRPGYAEYVRRTSGFVPWWPKSG"
FT   gene            complement(610390..611001)
FT                   /locus_tag="Saro_0561"
FT   CDS_pept        complement(610390..611001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0561"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25008"
FT                   /db_xref="GOA:Q2GAW5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW5"
FT                   /protein_id="ABD25008.1"
FT                   /translation="MAGAIEDRRPSLLSQAVRKALVLFYRMRGWKAVGTPPEDGRCIII
FT                   AAPHTSNWDFLYFIGLTEDLGLRPHFMAKDSLFRWPLGGFMRDMGGVAIDRSARRNVVD
FT                   AMVAEFARRDRFMLTIAPEGTRGKVGEWRTGFYQIALRAKVPMYVGLMDYGTKTGGLGP
FT                   AIWPTGDYDADMARIFEVYRSVTPKHPERGLTKLPEKADG"
FT   gene            complement(611046..611723)
FT                   /locus_tag="Saro_0562"
FT   CDS_pept        complement(611046..611723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW4"
FT                   /protein_id="ABD25009.1"
FT                   /translation="MRSPIDLFRRRFLDVLASIYIYNEHRGYTSLDRVLEAVRVRCPDD
FT                   PDFIAAIEKHRADERKHYVMFRRWFELQGRMPLAVDSTCGHIDRFIHKVFGCTIDELDT
FT                   QGVIDSPEAFERLCRVIMLTEQRGMRQVEILLENRHVRADRAMKRIFEVVERDEPDHWM
FT                   PYAAWLDTQGRAKARWRERWADYWIHKSLMLVKLPSLFFNPASRRMAAWPDAGEEAATP
FT                   MGS"
FT   gene            611833..612276
FT                   /locus_tag="Saro_0563"
FT   CDS_pept        611833..612276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0563"
FT                   /product="protein of unknown function DUF983"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25010"
FT                   /db_xref="GOA:Q2GAW3"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW3"
FT                   /protein_id="ABD25010.1"
FT                   /translation="MAIFTDNPKFDWILRCGWKGLCPRCGKGPMFRGWLKLQKTCPECG
FT                   LDYDFANADDGPAFFALCITAFPLTFIAVWLEVAYAPPWWVHVLTSVPILAIGCLATLR
FT                   PFKGWLVASQYVNKAVEAGTENLWAKLNAREKDGANGPGPSES"
FT   gene            complement(612277..612960)
FT                   /locus_tag="Saro_0564"
FT   CDS_pept        complement(612277..612960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0564"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25011"
FT                   /db_xref="GOA:Q2GAW2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW2"
FT                   /protein_id="ABD25011.1"
FT                   /translation="MSYVLVTANRNYSSWSLRPWVLMKALGIPFEDRVEPFTRPVNYDE
FT                   FRAFSPTGQVPVLIDGTRTVWDSLGIALYLAERHGGVWPQDEEARAFAFCAVAEMHGGF
FT                   SALRNDCTMNVGVRVKPRPMRPALVRDIARVREIFEEGLARFGGPWLAGDNFTALDAFF
FT                   APVAFRIRTYGLDVGKGQAWVDRVLAHPAMLQWEAEALEESWREEGHEAELAECGEIVA
FT                   DFRKR"
FT   gene            complement(612965..613513)
FT                   /locus_tag="Saro_0565"
FT   CDS_pept        complement(612965..613513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0565"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25012"
FT                   /db_xref="GOA:Q2GAW1"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW1"
FT                   /protein_id="ABD25012.1"
FT                   /translation="MPDTLAAIPLTRIDGTADSLANHAGKVLLVVNVASKCGLTPQYEG
FT                   LEALYKARKDEGLEVLGFPANDFGAQEPGSHEEIAEFCKLNYGVSFPLFAKADVTGPGK
FT                   QPLYAALTEAAPTKQGPAQEFRDRLKGYGMTPTEDPEVLWNFEKFVIGRDGEVAARFAP
FT                   GVTPDDPALLAAIDAELAK"
FT   gene            complement(613531..614190)
FT                   /locus_tag="Saro_0566"
FT   CDS_pept        complement(613531..614190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0566"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25013"
FT                   /db_xref="GOA:Q2GAW0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAW0"
FT                   /protein_id="ABD25013.1"
FT                   /translation="MSTQDGQKAGWSRDQMAARAAKELRDGYYVNLGIGIPTLVANHVP
FT                   EGMTVTLQSENGMLGIGPFPYDDEVDPDLINAGKQTISELPQSAYFDSATSFAMIRGGK
FT                   IDLTVLGAMEVAENGDIANWMVPGKMIKGMGGAMDLVAGVKKIIVVMEHVAKDGSPKFI
FT                   PTCTLPLTGRNVVDMIVTDLAVFQRPDHNSPFRLVELAPGVTADEVRARTTAHYVE"
FT   gene            complement(614213..615109)
FT                   /locus_tag="Saro_0567"
FT   CDS_pept        complement(614213..615109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25014"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV9"
FT                   /protein_id="ABD25014.1"
FT                   /translation="MRLRALPLAAVLAMAATQLGGCVAAAALVPLAAGGTMVGKRAGGT
FT                   KGTAGQTAAAPGAPVGEVAVGEVTVGRGVAVPPPDIAPPVEDEPEQPGPVDPPALSAAA
FT                   ILPQAEVQDDGYAAMTAFVLAAAEAPKGKKERRSALLDQKSLAGVPRMTDCAGQRGALL
FT                   VDLDPGEKPFDLTDPPAPAPGLADRLRAIRGTGTAVVWIATLPESASRDLANLLAATGL
FT                   DPLGIDGMLLLRGRETRKQELLNRAGEDWCVLAIAGDRKADFDEVFDYLRNPDGPVALA
FT                   LEQHIGAGWFLVPPPIR"
FT   sig_peptide     complement(615029..615109)
FT                   /locus_tag="Saro_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.367 at
FT                   residue 27"
FT   gene            complement(615106..615816)
FT                   /locus_tag="Saro_0568"
FT   CDS_pept        complement(615106..615816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0568"
FT                   /product="3-oxoacid CoA-transferase, subunit A"
FT                   /EC_number="2.8.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25015"
FT                   /db_xref="GOA:Q2GAV8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV8"
FT                   /protein_id="ABD25015.1"
FT                   /translation="MSNKLYPDAAAALEGLLRDGLLIACGGFGLCGIPERLLDAVRDSG
FT                   VKDLTFASNNAGIDNEGIGKLLRTRQVKKMISSYVGENKEFERQYLSGELEVEFCPQGT
FT                   LAERMRAGGAGIPGFYTKTGVGTLVAEGKETKLFDGQEYVLERGIFADLALVKAWKADE
FT                   TGNVVFRKTARNFNVPAATCGKVCVVEVEEVVPAGSLDPDSIHLPGVYVQRMIVGAPYD
FT                   KKIEFRTVREREAA"
FT   gene            615911..616783
FT                   /locus_tag="Saro_0569"
FT   CDS_pept        615911..616783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0569"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25016"
FT                   /db_xref="GOA:Q2GAV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV7"
FT                   /protein_id="ABD25016.1"
FT                   /translation="MKRIALYHLETLMWIARLGTFRAAAERLNTTQPAISARVREIEDQ
FT                   LGISIFRREGRNMVLTARGRRLVQECEPLWAGFEKALLTASGFEGATGVVRIGSGEIAA
FT                   ASCLPGFVNTVERDLPGVTLELELDLTARMFQQLLGGTIDLAFLAGPVASPGIRTAPIG
FT                   SVGLVWAASSATAAAGGFARPLPVWSIPDHSPLHGVTVESLAANGVAPRSIATCNNVRT
FT                   LIEIVIGGGGAAVFPEPMVRAELEAGRLVEVLPRPGRTVRFEAAIRSTESDPLVLELFR
FT                   RAGDLRIDG"
FT   gene            complement(616832..617476)
FT                   /locus_tag="Saro_0570"
FT   CDS_pept        complement(616832..617476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0570"
FT                   /product="Epoxide hydrolase N-terminal domain-like
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25017"
FT                   /db_xref="GOA:Q2GAV6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011945"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV6"
FT                   /protein_id="ABD25017.1"
FT                   /translation="MTYAAVIFDFGGVITSSPFEAFNRLEAERGLPRDLVRRINALNPD
FT                   TNAWALFERAEIGAAEFDRLFSEEARALGHELDGASVLAVLAGAVRPAMVSALDRLAAE
FT                   GYRLGCITNNVPAGHGAGMARSADAHDELEQIFARFEHVIESSKAGVRKPDPRIYLMMC
FT                   DALGLEPRQCVYLDDLGINCKPAAGLGMHAIKVTGGDQALADLGAVLGLAF"
FT   gene            617619..618398
FT                   /locus_tag="Saro_0571"
FT   CDS_pept        617619..618398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0571"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25018"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV5"
FT                   /protein_id="ABD25018.1"
FT                   /translation="MRSILCPVDASETLDDRVETALALARATKGHVTFQISTPFAQMAV
FT                   WEPFGGATISAAAIADAREGDEKLQRQLDARMASQDVPFDVTIEDSGHVEAAAAAARFA
FT                   DIVVDTLDHPSLEELVLGLRSPVLAVPRGVPMLTFDAPVLVAWDGGHESANALRASLPF
FT                   LRMASAVHLVTVREKADTFPASEAACYLSRHDLHAEVHERERNGSIAFTLEECAREVGA
FT                   GLIVMGLFGHSRLRELLVGGVSREMLDRSQIPLLLAH"
FT   gene            618437..618913
FT                   /locus_tag="Saro_0572"
FT   CDS_pept        618437..618913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0572"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV4"
FT                   /protein_id="ABD25019.1"
FT                   /translation="MKILFPSLALVLLAACSQPSDPEPVGEPSGTAIPQPAPASSLDAL
FT                   PASPASASANDSASVLPATVPPAFRALGTEPFWSASVKGATLTYSTPESPDGIAIPVRR
FT                   TERDGKAVFAGTLDGKPLELEVGAGNCSDGMSDTVYPLTVVRRIGPDIQRGCAR"
FT   sig_peptide     618437..618490
FT                   /locus_tag="Saro_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.733 at
FT                   residue 18"
FT   gene            619329..621647
FT                   /locus_tag="Saro_0573"
FT   CDS_pept        619329..621647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0573"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25020"
FT                   /db_xref="GOA:Q2GAV3"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV3"
FT                   /protein_id="ABD25020.1"
FT                   /translation="MADAATEARTEGRTVRLQVAGARQEESGHGIARISRHVMSQLGVT
FT                   EGDVIEIVGKRATAARVIQPYPEDEGLELIRLDGLQRANADVGSGEHVEVRKIDSRPAQ
FT                   RVVFAPAQKDLRLQGPAVALKRNFAGRPLVTGDLVATAGQQQVNRTDMPPQLRQMLNAP
FT                   AFALTQIRLTVVSTSPKGVVHIDENTEVELRPEYEEPRSSRADVNYDDVGGMGDTIRQL
FT                   REMVELPLRYPELFTRLGVDPPKGVLLHGPPGTGKTRLARAVANESDASFFTINGPEIM
FT                   GSAYGESEKRLREVFEEATANSPSIIFIDEIDSIAPKRSEVHGEAEKRLVAQLLTLMDG
FT                   LHSRSNLVVIAATNRPDAIDEALRRPGRFDREIVVGVPDESGRREILGIHTRGMPLAED
FT                   VDLQELARTTHGFVGADLAALAREAAIEAVRRIMPRLDFEQQTIPQDVLDSLRVERDDF
FT                   LEALKRVQPSAMREVMVQAPTIGWADIGGLDEAQEKLREGVELPLKNPEAFHRLGIRPA
FT                   KGFLLYGPPGTGKTLLAKAVAKEAEANFIAIKSSDLLSKWYGESEQQIARLFARARQVA
FT                   PCVVFIDEIDSLVPARGSGQGEPNVTARVVNTILAEMDGLEELQSVVLIGATNRPNLVD
FT                   PALLRPGRFDELVYVGTPSMSGREHILGIHTRNMPLAPDVDLALVARATDRFTGADLED
FT                   VVRRAGLNAIRRGGGNVDQVKASDFDEALEDSRATVTEQMEEEYGRMKGELKKRAMNPG
FT                   PLGFIVPGMVQPTRESKHG"
FT   gene            complement(621723..623030)
FT                   /locus_tag="Saro_0574"
FT   CDS_pept        complement(621723..623030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0574"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25021"
FT                   /db_xref="GOA:Q2GAV2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV2"
FT                   /protein_id="ABD25021.1"
FT                   /translation="MKRETQSRVLWWQRAPRIPTLALFAVVALALLGTFSLIIATVEAE
FT                   RTQREQAARTSGILASLDEIIRATMNGETGQRGYFITSDTRYLAPYREGQERYSIEIRR
FT                   LREKMGGELPEEQALLVGEISRLGDAKWAEMAGVVRLVEERRIPDAHARLLSDEGQLAM
FT                   NGLRRAVAKLEDIERIRLEQAVQRAAAAEAKILPSLAALFVVIVCALALGLWQAIRKAE
FT                   AEALAEGAAAIAEARDRADLLAKELNHRVKNLFAVILAIVKMSARGDAAAAPAVDRIAK
FT                   RIHALVTAHEVTQGTGKDQTVDFADLVGKAIAPYRSSSERCELAGEELVLPGKHAVPLG
FT                   LVLHELVTNAVKYGAWSQPGGLVRVRWSREGSRAKVLWEELAAGESATAAKPGREGFGS
FT                   ALIRSSERQLGGTIARRFDVRGIVVEMDFALEGAED"
FT   sig_peptide     complement(622896..623030)
FT                   /locus_tag="Saro_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.665 at
FT                   residue 45"
FT   gene            623203..623337
FT                   /locus_tag="Saro_0575"
FT   CDS_pept        623203..623337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0575"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25022"
FT                   /db_xref="GOA:Q2GAV1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAV1"
FT                   /protein_id="ABD25022.1"
FT                   /translation="MKRTFQPSRLVRARRHGFRARTATVGGRKVLAARRARGRKKLSA"
FT   gene            623374..623862
FT                   /locus_tag="Saro_0576"
FT   CDS_pept        623374..623862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0576"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25023"
FT                   /db_xref="GOA:Q2GAV0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAV0"
FT                   /protein_id="ABD25023.1"
FT                   /translation="MTRIATIRKRADFVAANRGIRVARPGFVLLVNRVAKPGDDASVAD
FT                   AEMRFGVTVTKKIGNAVVRNRMKRRFRALLREALPTGGIPGADHVMIGREGGVERDFAL
FT                   LREELAVALSRAAAGKGDPPRKRSGPRVHHGRGKGEGQGQGQGQRQDQGQSQGPGPNK"
FT   gene            623859..624068
FT                   /locus_tag="Saro_0577"
FT   CDS_pept        623859..624068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0577"
FT                   /product="protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25024"
FT                   /db_xref="GOA:Q2GAU9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAU9"
FT                   /protein_id="ABD25024.1"
FT                   /translation="MKRLLILIARAWQLGPSRVLPPSCRYSPSCSQYAIEALEKHGAIK
FT                   GGWLAAKRLLRCHPWGGHGYDPVP"
FT   gene            624133..625935
FT                   /locus_tag="Saro_0578"
FT   CDS_pept        624133..625935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0578"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25025"
FT                   /db_xref="GOA:Q2GAU8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU8"
FT                   /protein_id="ABD25025.1"
FT                   /translation="MQNQRNLIMAVVLTGILLLGWDVAMRWFYPQPAQKPKVEAAASAE
FT                   PANGEKPKRTREGGLQNAGDIALEKKDLAQELAAGHRIAIDAPGLKGSINLKGALVDDV
FT                   TLARHREGVDRNSAPVRLFSPAGTPAQHFAQIGWVGEGVAAPDANTMWQADGAKLTPQT
FT                   PVTLRWTNASGQTYSIRYAIDGDYMITATQGVANTGPAPVVVRPFALVNRTDKTASLDT
FT                   WNVHSGPIGAFDGSVNFDNNYSTVAEAEGGAIPFKGTANWIGFTDIYWLSALIPDANAK
FT                   AEAAFRSLGQGVYRADLIYPSVSIAPGKALSQTVRLFAGGKENAVLEKYEAAGVTNFSL
FT                   SIDWGWFRWFEKPIFWLLDSIFKKVGNFGVAIILLTLIVRGVMFPIAQRQFASMAAMRA
FT                   LQPKMKAIQERYKDDKQKQQQEIMELYKREKVNPLAGCLPIFLQIPVFFALYKVLVLTI
FT                   EMRHQPFALWIKDLSAPDPLHVLNLFGLLPFDPPSFLGIGVLAILLGITMWLQFKLQPA
FT                   AMDPAQQQVFAFMPWIMMFVMAPFAAGLLIYWITSNLLTIAQQKYLYSRHPQLKAQADK
FT                   DQVDIDRAVTREKKATSTRKPKAR"
FT   gene            625932..626585
FT                   /locus_tag="Saro_0579"
FT   CDS_pept        625932..626585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0579"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25026"
FT                   /db_xref="GOA:Q2GAU7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAU7"
FT                   /protein_id="ABD25026.1"
FT                   /translation="MTPEEQAAHQELIEQARLLFAGRVEFLKSAPALKFLPDPDVPEIA
FT                   FAGRSNVGKSSLLNALTGRKSLARTSVTPGRTQELNYFEVGEPTRLRLVDMPGYGFAKA
FT                   PPKVVETWRRLVRDFLRGRVVLKRTLLLIDSRHGVKPVDDDMMQMLDEAGVGYRIVLTK
FT                   ADKIKASELEKVTAETIAAARKRTAAYPEIIVTSSEKKMGIEELRAAVLQDAMG"
FT   gene            626906..627580
FT                   /locus_tag="Saro_0580"
FT   CDS_pept        626906..627580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0580"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25027"
FT                   /db_xref="GOA:Q2GAU6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU6"
FT                   /protein_id="ABD25027.1"
FT                   /translation="MKLIIGNKNYSSWSLRGWLAAKQSGLHFEEITVPLYGEDWDEARR
FT                   ADDLAPSSGKVPILWDGEGPDAPVVWDSLAIIDYLADKVGRDRFWPKDETARAMARSMV
FT                   AEMHSSYLPLRRNLPMNIRKRVEAIEIKPEVRADIVRILSLWAEARARFGKGGPFLFGT
FT                   FCAADIIYAPVVSRFMTYGVPVPGFAMTYMEAVWTHDWMQAWIEAAEHEDWTIEQFEEP
FT                   AR"
FT   gene            627580..628707
FT                   /locus_tag="Saro_0581"
FT   CDS_pept        627580..628707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0581"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25028"
FT                   /db_xref="GOA:Q2GAU5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAU5"
FT                   /protein_id="ABD25028.1"
FT                   /translation="MTDLDPVVLAERLIDCPSITPATGAVFDCLQAMLEPLGFAIHRFV
FT                   AGEAPDGPVENLFAIRKGPEGARHFAFAGHLDVVPPGEGWTSGPFKAERRGELLYGRGA
FT                   VDMKGSIAAMVAAVAEIPADAGTLSFIITGDEEGPARYGTVPLIDLIRQLGAEPDLCLV
FT                   GEPTSVHRLGDMVKIGRRGSVNMWIACKGAQGHVAYPHLADNPIPRLVALLADLDALVL
FT                   DGGTEWFQPSNLEITDLEVGNPATNVIPAEARARISIRFNDRHTGAELVARVEEIAHRH
FT                   KGEVRAVISGESFITLPGAFSAMIADAVKAETGLDPELSTSGGTSDARFLRAVCPVVEF
FT                   GLCNATMHKKDEAVAMEDLRVLQRIYRRIALSALS"
FT   gene            complement(628691..629263)
FT                   /locus_tag="Saro_0582"
FT   CDS_pept        complement(628691..629263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0582"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25029"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU4"
FT                   /protein_id="ABD25029.1"
FT                   /translation="MRAPRGLSPDEAELWEKVAATIKPMHPARPKARAVAAVPATDVAV
FT                   AAPPARRIKGRVPPPLPAPAPTPIKRPLESHGLDSSWDRKLARGAIVPDVTIDLHGLGL
FT                   DAAHARLTGGIAQALAMGARVILLIAGKHRPHDEHDLRGSRRGAIRAKLLDWLAHSAHA
FT                   SNIAAVRPAQPRHGGAGAVYIVLRKGR"
FT   gene            complement(629263..630486)
FT                   /locus_tag="Saro_0583"
FT   CDS_pept        complement(629263..630486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0583"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25030"
FT                   /db_xref="GOA:Q2GAU3"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU3"
FT                   /protein_id="ABD25030.1"
FT                   /translation="MSGGQSTARSTTSVGLLLGLTLLGGCVRLVPESGGPRPVTPPSPP
FT                   QAAKPATAALTGVTRGPIAAGLGFKPDNTAAALRSFVQSCPRLTKRTDNSGLTVPADWA
FT                   PACAAAPGWPEGEAARFFSTYFETAEVGDGNAFVTGYFEPEIAGVRTRQPGYDIPVYAM
FT                   PPDLVRARPGDAQPLPDGKMPLGRYDDAGVFVPYYDRGQIEDGALAEKGLEIAWAADPV
FT                   ELFFLQIQGSGRLRAPDGSVIRIGFAAQNGHPYSGIGSLMRERGLIGSQPGQYPGSMQG
FT                   IQQYLRDYPEAGRALMRQNRSYVFFRELTGPGPVGALNVPISGRSTVAVDPAFVPLGAP
FT                   VWLQLDRTEASGLWVAQDTGGAIQGANRFDSFWGAGAEARQVAGGMSARGRALLLLPKG
FT                   TLERLNQR"
FT   gene            complement(630495..631238)
FT                   /locus_tag="Saro_0584"
FT   CDS_pept        complement(630495..631238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0584"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25031"
FT                   /db_xref="GOA:Q2GAU2"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU2"
FT                   /protein_id="ABD25031.1"
FT                   /translation="MTPCDREKPRPVSGNLLVIVQIVILAMIAAFLGLRLYSVLGRRPE
FT                   RDEEPMRRRIEQPDPSAKPHQPGSMGNARSAETGALAPRPRELAAPEAQTFDNSAEAGV
FT                   RAIIAADRRFDVAQFLAGAKGAYGMILEAFWRGDKEELAQLCDADVYEGFASAIDARAN
FT                   AGETIDARLIRIEEARIIGASIEGTTARIAVRFLADIASVTRNAEGHVVAGSLDDAIDA
FT                   RDLWTFRRDLTSRDPDWLLDETDEA"
FT   gene            631271..631513
FT                   /locus_tag="Saro_0585"
FT   CDS_pept        631271..631513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAU1"
FT                   /protein_id="ABD25032.1"
FT                   /translation="MNNAWMTLWADHVGKNLAGALRISLAPAAAAVGTVLRRGAKSKAH
FT                   CPFPAMMLGAPVKGNPIRKQSYHGRRRQHHLESEP"
FT   gene            631524..631994
FT                   /locus_tag="Saro_0586"
FT   CDS_pept        631524..631994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0586"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25033"
FT                   /db_xref="GOA:Q2GAU0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAU0"
FT                   /protein_id="ABD25033.1"
FT                   /translation="MPNGADTSPAIGLISQYVKDLSVENPNAPESYQWAEAPDMAVDFN
FT                   ISARAIQPEIHEIELKINVTSKGAQGTAFIVELAYCGLIGMRNVPDDQAHPFLFAEGPR
FT                   ILFPFARRIIADAVRDAGYPPLMLEPIDFNGLYMQQLAQAQATAEATPAGEA"
FT   gene            632025..633596
FT                   /locus_tag="Saro_0587"
FT   CDS_pept        632025..633596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0587"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25034"
FT                   /db_xref="GOA:Q2GAT9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT9"
FT                   /protein_id="ABD25034.1"
FT                   /translation="MNLLKATGTIGGLTLLSRVLGLVRDSLFARFIGASFASDAFLVAF
FT                   RLPNMFRALFAEGAFASAFIPMFNKRVADPEGNGLRDGLDFAEAALAVLLPVLIVMTVL
FT                   LEVFAWPVTFVLSGKFNGVSADQFAYAVELSRWTIPYLMLISLVSLFGGILNSLHKFWV
FT                   NAAAPILLNLTLIAALLGFHSDDPLVTARNQAIAVSVSGALQLFWLAWACRRNGVRLRL
FT                   RRPRLSPEVKQLLKLIWPAAAGAGAVQINLVISTALAASLLDHGSVTYIYMADRLNQLP
FT                   LGLIGIGLGTVLLPTISRQLGGGEDAAAMETQNRGMELALLLTLPATVALVLCGEPIAA
FT                   ALFGYGKFDALDTHYTAQALAAFSIGLPSYILVKVLTPGFYARQDTKTPVRFATISMVV
FT                   NLVGNLALIVPLRHMGPPLATAIASTVNVWLLYRTLVKRGHFVADARLRRRAWRLALAA
FT                   AAMGGMLWAGQGLVMPWVHGTWTVRIAAMGGLVTAGVVVYGLAAVLTGAFRAGDLKLLL
FT                   RRGRTN"
FT   gene            633608..634627
FT                   /locus_tag="Saro_0588"
FT   CDS_pept        633608..634627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0588"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25035"
FT                   /db_xref="GOA:Q2GAT8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT8"
FT                   /protein_id="ABD25035.1"
FT                   /translation="MRIVSGIQPTGNLHLGNYLGAIRNWVRMQDEWSAKGGECLYFLAD
FT                   LHAISMPHSPAELAANTREMVAALVSCGIDPDKSVLFNQAQVPAHAEMQWLLNGTARMG
FT                   WLNRMTQWKDKAGKNREGASVALFTYPVLQAADVLLYQATHVPVGEDQKQHLELARDVA
FT                   QKFNNDFASEDAPVFTLPDPIIPPEAARIMSLRDGSAKMSKSDPSDMSRINLTDDADAI
FT                   MQKVRKAKTDPEPLPGTMEGLAGRPEANNLVGIYAAMAGISPADVLARFEGQGFGQFKP
FT                   ALGELLVEKLSPMAARYRELREDRAALDAILAKGAEKARALAAPTLARTYDALGLVRG"
FT   gene            634798..635496
FT                   /locus_tag="Saro_0589"
FT   CDS_pept        634798..635496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25036"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT7"
FT                   /protein_id="ABD25036.1"
FT                   /translation="MKSLLQNKRRRLVGMVAVPLMLAALGGCASPFNANVKRFQTQLPA
FT                   PQGQTFAVVAEDPKDAGGLEFSQYASLVAGQMQKLGYSPASPESADLIVRFDYGVDQGR
FT                   DRLRETGFNDPFWGPWYGPGYNGYWGRPAFYGRRGWGYGWYDPFFWGPGNSGVEVTTVY
FT                   TSGIDMKIDRRVDGQRLFEGKAEAASQSNRLSYLVPNLVEAMFTDFPGHNGETVRISIA
FT                   PEKKTVKKVN"
FT   sig_peptide     634798..634887
FT                   /locus_tag="Saro_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.564 at
FT                   residue 30"
FT   gene            complement(635565..636038)
FT                   /locus_tag="Saro_0590"
FT   CDS_pept        complement(635565..636038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0590"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25037"
FT                   /db_xref="GOA:Q2GAT6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT6"
FT                   /protein_id="ABD25037.1"
FT                   /translation="MPMSSPEIPVLVKRLPHGQDLPLPAYATEGAAGMDVVSAEDVDLA
FT                   PGGRHAVATGLSVAIPHGYEIQVRPRSGLALKHGVTVPNTPGTIDSDYRGELKVIMINL
FT                   GAETFSIRRGDRVAQLVVAPVTRGSWVEVDELDATQRGEGGFGSTGGLAALKG"
FT   gene            complement(636019..637206)
FT                   /locus_tag="Saro_0591"
FT   CDS_pept        complement(636019..637206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0591"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25038"
FT                   /db_xref="GOA:Q2GAT5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT5"
FT                   /protein_id="ABD25038.1"
FT                   /translation="MKGKRILLIVGGGIAAYKACELVRLIRKEGAEVTCVLTEGGAHFV
FT                   TAMTLAALSENPVHTTLWDLKNEVEMGHIQLSRQADLVVVCPATADLMARMAAGIADDL
FT                   ATTLLLATDKPVLAVPAMNVRMWQHPATRRNVATLRGDGIAVMEPGEGAMACGEFGPGR
FT                   LPEPADILAEIARMSGTAGRLSGRHVLVTAGPTHEPIDPVRYIANRSSGKQGFAIAAAA
FT                   ARAGARVTLVAGPVNLPTPQGVTRIDVETARQMAAAVDAALPADVAIMVAAVADWRSAG
FT                   EAAQKIKKDGSGAVPPLQLVENPDILATLCKSGRRPPLVVGFAAETNDVLDHARAKLAR
FT                   KGADWIVANDVATHAMGGEINGLHIVSSSGVESLPEMPKDAAAAALIERIADVLS"
FT   gene            637311..637709
FT                   /locus_tag="Saro_0592"
FT   CDS_pept        637311..637709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25039"
FT                   /db_xref="GOA:Q2GAT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT4"
FT                   /protein_id="ABD25039.1"
FT                   /translation="MRLVLTALVFLAGLFDLFLAIGFLTGPEQAATGFGIAATGTGGIS
FT                   TIRADFTSFFGVAAFCMMWGAWRRNADLLLVPALLFGTSFVGRAIDLVASGAYPGWQLP
FT                   MLVEAGHVVLLLAAWRMLPHHRLDEIAA"
FT   sig_peptide     637311..637403
FT                   /locus_tag="Saro_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.802) with cleavage site probability 0.776 at
FT                   residue 31"
FT   gene            complement(637714..638733)
FT                   /locus_tag="Saro_0593"
FT   CDS_pept        complement(637714..638733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0593"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25040"
FT                   /db_xref="GOA:Q2GAT3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT3"
FT                   /protein_id="ABD25040.1"
FT                   /translation="MVLFWHYQHFFVPPVERHFNVNRKIEPWYDALGWFYDHGHVAVQY
FT                   FWAVSGFVFAHVYLADASAKSRFWPARIARLWPLHLLTLGLMALLQAAYVAQHGTEFVY
FT                   HTNDLKHFLLSIPLMQYWGWQEDQSFNGPSWSLSTEILAYLVFWLVLPWLRRAPLLLAL
FT                   PLGTLLLGLMLDEAPNKDVLACIGYFFLGCATYAAALKGWLRPASLLPLGMALVAIAFA
FT                   LKASYRGGDAATVAGTFAVLFLALAADLSDERGWLRFGQKLGDASYGIYLWHIPIQLAL
FT                   VLLIDATLGSRDIAREPLFMLAYVAMAIAAGFVSHARFERPAQRAVFALWGRWKDRRA"
FT   gene            complement(638968..640527)
FT                   /locus_tag="Saro_0594"
FT   CDS_pept        complement(638968..640527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0594"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25041"
FT                   /db_xref="GOA:Q2GAT2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT2"
FT                   /protein_id="ABD25041.1"
FT                   /translation="MTLPATHIRRLLGWGRTLARHGALRGIENDPNTPSPVRTLCRIAR
FT                   LGTIQPRDPDYAGAFRAIGPAAIKLGQTLATRPDLVGEDAAHNLLALQDNLPPVDYRLI
FT                   RAEIERTFEKPLEALFAQFDPEPIGAASIAQVHRAVTTEGHKVAVKVLRPGVRDKLARD
FT                   IDTYEWAAAHLEAFGGEAERLRPRLVIANFKRWTVRELDLRREAASASELADVMKAHAG
FT                   YRVPAIDWDRTNGRVMTLDWIDGIKISDTAALEAAGHDRKALASRLVLAFLTQAISGGF
FT                   FHADMHQGNLFVQPDGTIAAIDFGIMGRIDRRARQWLAEILYGLTTGNYRRVAEIHFEA
FT                   QYVPSYHSVDEFATALRAVGEPMRGKPVSELSVGQMLDGLFAITRDFDMQTQPHLLLLQ
FT                   KTMVMVEGIATQLDPTINMWDVSAPFVRNWIRDELGPEAAIAERIREDTQTLLRIPDLI
FT                   RRIEDRFPAKGGAPEAPPLPRIELMWQRKRRKRGSGLSGQFLAFLAGGALVIGTHALGW
FT                   WG"
FT   gene            complement(640532..641269)
FT                   /locus_tag="Saro_0595"
FT   CDS_pept        complement(640532..641269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0595"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone
FT                   methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25042"
FT                   /db_xref="GOA:Q2GAT1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAT1"
FT                   /protein_id="ABD25042.1"
FT                   /translation="MTSPETASFGYEDIPAEEKEARVGAIFSNVARKYDVMNDAMSVGM
FT                   HRLWKDKFVRRVRPRAGEAILDMAGGTGDIAFRMAPSGAAITVSDINQDMLNVGMERAE
FT                   KRGLTGLEWSRQNAEELTFPDRAFDAYTIAFGIRNVTHVDRALAEAYRVLKFGGRFFCL
FT                   EFSTTEWPGFAEVYDAYSHKLVPRIGQMIAGDADSYRYLIESIRRFPPMPEFERMIRAA
FT                   GFTRTKVEPILGGLVAIHSGWKA"
FT   gene            641330..642142
FT                   /locus_tag="Saro_0596"
FT   CDS_pept        641330..642142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0596"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25043"
FT                   /db_xref="GOA:Q2GAT0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2GAT0"
FT                   /protein_id="ABD25043.1"
FT                   /translation="MPELPEVETTVRGLATVLDGQVIRRVAVNRADLRRPFPEDLAQAL
FT                   TGARVTGMGRRAKYGLIHTDRERTMVFHLGMSGRWRIDPEDIGKHDHLVLETGEGRVLS
FT                   LNDARRFGSVDLVDTGRLEEWPPFAALGPEPLGPGLKARHLAKAFEGRIAAVKLLLLDQ
FT                   QIVAGLGNIYVCEALYRARIHPEREGGKVSARALGLLVPAIRAVLEESIAAGGSTLRDY
FT                   ARPDGELGYFAKDWRVYGREGEPCQCGGVVKRIVQGGRSTFFCPRCQK"
FT   gene            complement(642174..643286)
FT                   /locus_tag="Saro_0597"
FT   CDS_pept        complement(642174..643286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0597"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25044"
FT                   /db_xref="GOA:Q2GAS9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS9"
FT                   /protein_id="ABD25044.1"
FT                   /translation="MSIQTKGQTDLFENPLGLDGFEFIEFSAPEAGSLEPVFARMGFTH
FT                   IANHRSKQVQLWRQGGINLIANHEPRSPAAYFAAEHGPSACGMGWRVRNAAKAYATAIE
FT                   RGAEPVEVRTGPMELRLPAIRGIGGSIIYLIDRYEGGQFGDLSIYDIDFEYLPGVDRHP
FT                   VGAGFHTIDHLTHNVYGGRMAHWASFYERVFGFREIRYFDIKGEYTGLTSRAMTAPDGK
FT                   IRIPLNEEAKAGGGQIEEFLRAYNGEGIQHIAFACDDLLGGWDKLKAIGTPFMSPPPAT
FT                   YYEMLDERLPGHGEPVAELQKRGILLDGSTEEGDPRLLLQIFSETQIGPVFFEFIQRKR
FT                   DEGFGEGNFTALFKSMERDQLRRGVLKTEA"
FT   gene            643385..643897
FT                   /locus_tag="Saro_0598"
FT   CDS_pept        643385..643897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0598"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25045"
FT                   /db_xref="GOA:Q2GAS8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS8"
FT                   /protein_id="ABD25045.1"
FT                   /translation="MGRANAASYRSNARIFCMDEIDRNILAQLQMDSGRSHADLAEVVH
FT                   LSASQVSRRISRLQAEGVIRGQVALLDEQALGLQVEAFVAVAMASYAPDAVRAFHDRIS
FT                   ALEEVLDCCATTGASDYLLRVVARDLRAYSRLMNEEILGHGDVASVRSSVVLDRIKRTT
FT                   ALPLGGP"
FT   gene            644032..644970
FT                   /locus_tag="Saro_0599"
FT   CDS_pept        644032..644970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0599"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25046"
FT                   /db_xref="GOA:Q2GAS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS7"
FT                   /protein_id="ABD25046.1"
FT                   /translation="MSDRAPLIDRKFASRVDWNLMRTFVDIVRAGGIGAAARQLNRQQP
FT                   SISAALKRLEDHVGASLLVRTATGVEMTPAGKAMMALCEDMLETARMVPHQIAQATRRV
FT                   DGFVRIQIVSGLVSAEFDEAIASFHRRNPAIHIEIRVSPWRQVLDALEQGEVEIGVGYD
FT                   GSVRGSLTYEPLLVERQQLYCSRSSPYFGYRVSRLHELKDEGFVLTGDDEIELITNLRR
FT                   RYRLGSNVGGMAEDINEARRLIKLGVGIGFLPVPAAEAEVARGTLWPMLHADFEPSYDV
FT                   YLLARAEPARDTATQLFWDEVFRRVRASSRA"
FT   gene            645059..645979
FT                   /locus_tag="Saro_0600"
FT   CDS_pept        645059..645979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0600"
FT                   /product="Sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25047"
FT                   /db_xref="GOA:Q2GAS6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS6"
FT                   /protein_id="ABD25047.1"
FT                   /translation="MSTSHKKTSPVDLIPPAMIAVVLLFWAFAPKAILDNPWTLVVTSP
FT                   LIVIVVLLLEFVFERHEGWRINRQEFLTDLYYSVLSATVISWLTQKLAEDPLLAVKSSL
FT                   GITTQWAAQMPWLAQVALVIFLIEFGQYWMHRLMHNSTPFWLTHAPHHHITQLNAAKGA
FT                   VGNPIELFLISLSVVALFDLDKTAIFAALNTTGVISTFAHANVRANPPIWYSFFFTTIR
FT                   HHSLHHSTDYESTRCNYGNSLILLDRIFGTYREGEGVLVGQDDRRRLSILEQTLFPFQP
FT                   LIDRFKARRRERDGAAGDAGGPAAA"
FT   sig_peptide     645059..645163
FT                   /locus_tag="Saro_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.610) with cleavage site probability 0.469 at
FT                   residue 35"
FT   gene            645976..647553
FT                   /locus_tag="Saro_0601"
FT   CDS_pept        645976..647553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0601"
FT                   /product="sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25048"
FT                   /db_xref="GOA:Q2GAS5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS5"
FT                   /protein_id="ABD25048.1"
FT                   /translation="MTTAPSGLVDAARGALVRGDLEATNRAAAAMVAASPGDAEGHFLL
FT                   GVAEAGVGRIKAGIGHIERAVTLDPRGEYLAHLAKFYCLVRRDRDAANALRRAEAAPPA
FT                   DALGRDTMGCVFARLGDHAAALPHFAEAVRLRPDIAEYRYNEAVTLNFLGRVDEAEAAI
FT                   EALLAQAPGHARAHHLLAGLRRQSAERNHVARLGQARARARGGRDRLLLGYALAKELED
FT                   IGEYDHALDTLCEANAEHRRNLPYAFERDAAIFDAIEESWPMLRDAAPTAPSKASPIFV
FT                   IGMPRTGTTLVDRILGSHPEVESAGELQAMPLAVKRAAATNSATVMDPETIRAATGADM
FT                   AAVGRDYLERARHHLRGGAARFTDKFPGNFHYAGFIARALPEARIVCLRRHPMDTVLSN
FT                   FRNLFAVGSRYYDYSYDLLDIAAYYARFDRLMAFWREALPGRVLELRYEDLVADQEGQT
FT                   RRLLEHCGLGWSETCLEFHSNAAPVSTPSAAQVRRPIYADSVARWKRHGEVLGPVARFF
FT                   EQTGIAID"
FT   gene            647570..647929
FT                   /locus_tag="Saro_0602"
FT   CDS_pept        647570..647929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25049"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS4"
FT                   /protein_id="ABD25049.1"
FT                   /translation="MPRLFLFFAVAIGAGLVQPALAVEEPAARVAKCGTTSCLIVSGRR
FT                   ADEALPVRVNGHEVQAEGGRRWRVRVPVATVRAWSEPLARTIAVSVGETWQEVALPIGL
FT                   LGHSHDLAMLVVRVK"
FT   sig_peptide     647570..647638
FT                   /locus_tag="Saro_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            648031..648384
FT                   /locus_tag="Saro_0603"
FT   CDS_pept        648031..648384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25050"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS3"
FT                   /protein_id="ABD25050.1"
FT                   /translation="MPKAQEMNLKAALVAIATLSIATTAHAEGANPFAKDQAVLDLKGL
FT                   DLSTADGQQRLAIRMDQAARAVCGDRLASVHLALESKARECRSAVVADVRAQIEARMAA
FT                   TGGTANVKLASLR"
FT   sig_peptide     648031..648114
FT                   /locus_tag="Saro_0603"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(648439..649371)
FT                   /locus_tag="Saro_0604"
FT   CDS_pept        complement(648439..649371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25051"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS2"
FT                   /protein_id="ABD25051.1"
FT                   /translation="MRKLSIPLAVIGAALASTPLLAAPAKEQVIEVPGFADFLAVDGDT
FT                   VWATNAGRVERWSRKGRLAEVPMGKPCGAMAVHGGSLWVADCKENALVRIDTRTARKIA
FT                   TIPTGIANRDGELNVVAGAGSIWIASDNDDGAVSRVDPATNAVVATIPVDPGTWYLSFG
FT                   HGALWAVSAKGQSLQRIDPAANAVTKRTALGKQPGFLVAGEAAVWVQEQGDGTVARVDP
FT                   QTGEVTGRAKVGPVLKWGDIDTGGGLVWLRTTEDQTLVVIDPKTLAIRARIGKAEGSGA
FT                   LRYTKKGLWTSAHDVHTLTWWPGRMLPRR"
FT   sig_peptide     complement(649303..649371)
FT                   /locus_tag="Saro_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(649374..651143)
FT                   /locus_tag="Saro_0605"
FT   CDS_pept        complement(649374..651143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0605"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25052"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS1"
FT                   /protein_id="ABD25052.1"
FT                   /translation="MTAAPRPTARAIAAAVNSGQTTALAVAEATLLRLAAYDAVQPQIW
FT                   ISRASPEALLAAARAIDVRLAAGEDLPLAGVPFAVKDNIDVAGFHTTAACPAFAYRPAT
FT                   SATVVERLLAAGALCVGKTNLDQFATGLNGTRSPYGAPRNAHNLAYVSGGSSSGSASAV
FT                   AAGLVAFALGTDTAGSGRVPAAFQHLVGFKPSKGRWSNRGLVPACRTLDCITVFAHDTA
FT                   DARIVDGIVAGFDPADAFSKPLADRPRKMRAIGVPRRDQRAFFGDVEAEHLYDRALDRL
FT                   STLGRIVEIDYAPLQEAAQLLYGGPWVAERTAALAGLLADNPDALDPTVREVVAPGQDI
FT                   GAVDLFNGIYRLAELKRHADTLWESIDLLAFPTTGTTYRVAELLAAPIALNSALGYYTN
FT                   FVNLLDMAALAVPAGSRANATGFGVTLIGPADTDLALLDAAEAYLSVADLPPPPPLDLE
FT                   GKMQTVKLAVVGAHLKDMPLHWQLTSRDAKFVGAFETAPNYRLYAMADSVPPKPALIHS
FT                   EDGGAIAIEVYELGVAEFGSFVAEVPPPLAIGTVTLADGSSVKGFVAEPRALVGARDIT
FT                   HLGGWRAFVAAGA"
FT   sig_peptide     complement(651066..651143)
FT                   /locus_tag="Saro_0605"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.609) with cleavage site probability 0.377 at
FT                   residue 26"
FT   gene            complement(651140..654733)
FT                   /locus_tag="Saro_0606"
FT   CDS_pept        complement(651140..654733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0606"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25053"
FT                   /db_xref="GOA:Q2GAS0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAS0"
FT                   /protein_id="ABD25053.1"
FT                   /translation="MNFDTVLIANRGAIATRIIRTLRRMGLRSVAVYSEADKDSLHVVL
FT                   ADEAICIGAARAAESYLNIPAILDAARRTGAGAIHPGYGFLAENVEFAEACEKEGIVFI
FT                   GPTPNNIRTFGLKHSARALAAAHGVPLAPGTDLLTDETEAVQAANGIGYPVMLKATAGG
FT                   GGIGMRVCEDEADVREGFSAVARQGLGNFGDAGVFLERYIRQARHIEVQIFGDGRGRIV
FT                   ALGERDCSLQRRNQKVVEEAPAPLLPPAVRSELIAAAIRLGQAAGYRSAGTVEFLYDAE
FT                   REEFFFLEMNTRLQVEHGVTEEVMGVDLVEWMVRGGGGDFGFLDDDPPRPSGHSIQVRL
FT                   YAEDPALDYRPTSGTLTAVTFPEGVRTETWCMAGTTVSTWYDPMLAKLIVHAESREAAV
FT                   AAMQDALDRSRIDGFETNLRWLRDVVRSPAFTSGEVSTRALSHVAHVPRSITVVSGGTA
FT                   TMAQDWPGRQRLWAVGVPPSGPMDDLSFRLGNRLLGNPEGTAGLEVAITGPTLTFNTAA
FT                   RVCVTGADFGARLDGQPVPRGMAIDIAAGQTLALGRASGGGMRGYILFAGGLDIAPYLG
FT                   SRSTFELGQFGGHAARRLLAGDTLHLGDEPAQPALPAANLPELSNEWALRVMYGPHGAP
FT                   DFFTREDIDTLVAAEWQVHYNSNRTGIRLVGPKPQWAREDGGEAGLHPSNIHDNPYAIG
FT                   AVDFTGDMPIILGPDGPSLGGFVCPFVVIAADRWKIGQLTPGDKLRFVPVNCADAAAAN
FT                   DQQRRFLETGKPAQGCPGRPMETLSPILAVIDESPRSPRTVYRQQGDRNILVEYGPIVL
FT                   DIELRIRVQALMTELERLALPGVIDIVPGIRSLQFHFDGDAMTQEAALSVLIAAEERLG
FT                   DLEDFTIPSRIVHLPLSWRDPATIETIEKYMGAVRDDAPWCPDNIEFIRRINGLPDVAA
FT                   VENLIFEANYLVLGLGDVYLGAPVATPVDPRHRLVTTKYNPARTWTPPNVVGIGGAYMC
FT                   IYGMEGPGGYQLFGRTIQVWNTHRQTDAFIDGKPWLLRFFDQIRFYPVSAEELEEWRRD
FT                   FPAGRRSIRIEPSEFRLADYRRYLADNAEGIAEFEARRQAAFDEERAEWQRRGEFDRTD
FT                   LVEPEAAEAGTVEVPDGADLVEAPFGGSVWKMLVSVGDEVEAGETIAIIEAMKMECRVE
FT                   SPGAGTVAALYAQERQSVQPGTPMLALTRHA"
FT   gene            complement(654730..655365)
FT                   /locus_tag="Saro_0607"
FT   CDS_pept        complement(654730..655365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25054"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR9"
FT                   /protein_id="ABD25054.1"
FT                   /translation="MSVDPHLSGLSGTVLHDVVVPARAPWLHHVKAGQTLRIVDLEGNQ
FT                   AVDFLLYATADDAERYSAQDTVAAQGNLFLREGTVLRSNEGRAMMTITATSVDYHDTIG
FT                   GACSCESNTLRYGHHTKSEHACVENFLEANLLEGRGKRDIVSNINFFMNVPVEPDGSLG
FT                   IVDGISAPGLTVDLRAEMDVTVVVSNCPQINNPCNGFNPTPARMVVTA"
FT   gene            complement(655382..656206)
FT                   /locus_tag="Saro_0608"
FT   CDS_pept        complement(655382..656206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25055"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR8"
FT                   /protein_id="ABD25055.1"
FT                   /translation="MSATLANPLAARDHARAMAGTVVEAMPVLPPVAKDTPAGVAADDL
FT                   VWEETIAAGGYATRRLSRGTRLRLVDIKGDACASLLLFNAEMPTERLNVADTVKVQWNA
FT                   YLGQGKLLLSDMGRVLMSIVEDDAGTHDAFCGTSNAASNAARYGDGRNSGSFPNGRDRL
FT                   LLGAAKHGLQRRDVHPCVNLFKGAAIEADGTIVPDVGPFPAGRRMVLRAEMDVIVVIAN
FT                   CPHVLDPRPEWTSTPLRATAWRGPVTPQDDPIRTATPEGLRAYLNVEDYFRR"
FT   gene            complement(656203..656679)
FT                   /locus_tag="Saro_0609"
FT   CDS_pept        complement(656203..656679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0609"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25056"
FT                   /db_xref="GOA:Q2GAR7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR7"
FT                   /protein_id="ABD25056.1"
FT                   /translation="MTTEPSSLARLSMSLPGELFRQLDMMVEERGLPSRSQLIAELIRH
FT                   ALAEHEAYTRPDEMLAGTITIVYRGDRGRVRHQLAQTQADYLKEVISSQHVFLEDDQSL
FT                   EVLLVQGPAVRLKELCDALRRVRGVHQLKLVTTTALLPPLYEPDAGESSNGAAA"
FT   gene            complement(656681..657487)
FT                   /locus_tag="Saro_0610"
FT   CDS_pept        complement(656681..657487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0610"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25057"
FT                   /db_xref="GOA:Q2GAR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR6"
FT                   /protein_id="ABD25057.1"
FT                   /translation="MSAVANPILRLSDVWVEYGDKIVLEKVGLDIEAGSFVSIVGPSGA
FT                   GKSSLLRIILGQERPTRGQILLDGAPLAPECGPDRGVVFQRYSVFPHLTALDNTMFGLE
FT                   CEKAPFMARLFGRARQEAAARAAEMLQAVGLGDSMDLYPAQMSGGMQQRLAIAQALIKR
FT                   PRILLLDEPFGALDPGIRADMHALIRQLWQDRALTIIMVTHDLREAFTLGTRVIALDKR
FT                   RHDPHAPHRFGATAVYDLALRKDTDAAPGAAAPAIPAQDVHIHEGA"
FT   gene            complement(657484..658299)
FT                   /locus_tag="Saro_0611"
FT   CDS_pept        complement(657484..658299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0611"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25058"
FT                   /db_xref="GOA:Q2GAR5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR5"
FT                   /protein_id="ABD25058.1"
FT                   /translation="MRWVNRHVRRNDGLLLGALPILALVLIYLFVAAQRHAANPMDKIL
FT                   PLPAGMASAMSSLLFEVDPLSGQYLFWADTLASLQRLGLGLGIATAMALLVGLVLGVLP
FT                   PLRATIGPLVTGIAVIPPIALLPILFIALGLGETAKVALIVIGIAPVMVRDIASHVGDL
FT                   PREQIVKALTLGASSWQIMIRVALPQAMPRLIHAVRLALGPAWVFLISAEAIASDVGLG
FT                   YRIFLVRRYLSMDVIIPYVAWIALLAIVMDVALARLSRRAFPWAHGAGR"
FT   sig_peptide     complement(658186..658299)
FT                   /locus_tag="Saro_0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.991 at
FT                   residue 38"
FT   gene            complement(658339..659421)
FT                   /locus_tag="Saro_0612"
FT   CDS_pept        complement(658339..659421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0612"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25059"
FT                   /db_xref="InterPro:IPR017793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR4"
FT                   /protein_id="ABD25059.1"
FT                   /translation="MVTLIGKLGMTGLFAGALLIASCSPSGAPHAEPRKEFSIGWSIYA
FT                   GWMPWPYAQQAGIVKKWGDKYGIRINVVQVNDYVESVNQYTAGKFDGVTVTNMDALTIP
FT                   AAGGKDTSAIIVGDYSNGNDGILLKGGNSLADIKGRETYLVELSVSHYLLARGLEKAGL
FT                   KPTDVRTVNTSDADLVSAFSAPDVTAAVTWNPQLSVMKAQPGVTQVFSSADIPGEIVDL
FT                   LVVDTATLKANPDLGKALAGIWYETVALMQRQDEQGKAARAAMAKLSGSTPQAFDSQLK
FT                   TTFLYGEPKAAVDAATAPALVTTMTKVRDFSFSKGLFKGAASADAVGMAFPGGKTLGDP
FT                   QHVTLRFDESFMKLAADGKL"
FT   sig_peptide     complement(659326..659421)
FT                   /locus_tag="Saro_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            660041..662467
FT                   /locus_tag="Saro_0613"
FT   CDS_pept        660041..662467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0613"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25060"
FT                   /db_xref="GOA:Q2GAR3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR3"
FT                   /protein_id="ABD25060.1"
FT                   /translation="MKMIRNTLLGATILMGVGTSSAWAQEPAAEGEPAGGSGEIVVTAT
FT                   RRATSLQDVPINISAVGAEQLSRQRIDDVRDIADFTPGMTISDTGPGSTGTIVLRGLNA
FT                   SDTDTTGASYDDSLGVYLGEVPIYYDFKMLDIARVETLLGPQGTLYGLGTLAGAIRNIP
FT                   NRPDLTAYQAEAHGRAYGKSHSSQVGYQADGMINIPLVTDHIAFRSATGYFYDPGFIDY
FT                   PLLLQTPGVSLPQPSGPDGVTEADYAANLKRRKDLNFERTFTTRNQLLFQLNEDLKVNF
FT                   TYAYQQTKTDGGQYNSNGVLGTGKYESAGRYVEPVNRHAHLGSMEVNANLGGIADLVAT
FT                   TAYTTVKNRAQSDNTDLLLDLDYGYETFPAFSSWNESEDERKQFNQEVRLVSRHGGPFS
FT                   WVLGGFYNQQKRHRDYIEHVPNHPWVEFGTQPNPDEVEYASYVTSKVTEKAIFGEGTFR
FT                   VTPAWQVTAGARYFGYNSKIAGALVVPLIGDPVSPYDLTPAGGTAKKTGWVWKFNSSFN
FT                   FTPDIMLYGTYSKGYRIGGPNSVAPCPNPLPNDPDGDNINNTQLPCGLPNEVQYGPDTT
FT                   RNAEIGLRAQLFERKLTFNFNVFQIKWDGIQVDSATLNGIVGITVNGGKAKSEGFETSF
FT                   QLRPVDRLSIQGTYSYVNARLTEDVPDNIPVNDPAGTYPSAPTKLDALAGDRLPGSAKN
FT                   SGSLGVTYTMPFKDGQLVADWTATYRGNVVTRLGWDRAYGDKLPGYVLHRASLTYDTDR
FT                   YSIGLFANNIFDKYAVASVANDRSRVGLNDGVVLRYYKRTVINPRTVGIEARFRY"
FT   sig_peptide     660041..660115
FT                   /locus_tag="Saro_0613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            662553..663497
FT                   /locus_tag="Saro_0614"
FT   CDS_pept        662553..663497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0614"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25061"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR2"
FT                   /protein_id="ABD25061.1"
FT                   /translation="MACLVPSCRRHQPARLLAAIALALGLSATPAAAVGSAQSPPLFAE
FT                   RWIDGTNGAEPATQVQALDADTFVIRQSVHSNFEAPFLYLLFGRDRALLVDTGAEGGSI
FT                   RPTVDRLVDEWLAAHKRKRIALVVAHSHSHGDHVAGDAAFQARPDTTVVGLKPADVAAF
FT                   FGIGHWPDEVVRFDLGGRALSILPTPGHQAAAIMVYDPRLKMLLSGDTLYPGRLYVPVN
FT                   FLVDNRASVDRLAKFAARHPIRAVLGAHIEMSRTAGRDYPHEAATHPDEHLLELPASAI
FT                   AELDAGLRASLDVPEKPQVHDHFIIYPVAPRPE"
FT   sig_peptide     662553..662654
FT                   /locus_tag="Saro_0614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.875 at
FT                   residue 34"
FT   gene            663645..664640
FT                   /locus_tag="Saro_0615"
FT   CDS_pept        663645..664640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0615"
FT                   /product="Sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25062"
FT                   /db_xref="GOA:Q2GAR1"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR1"
FT                   /protein_id="ABD25062.1"
FT                   /translation="MNGVRVGNRIIGADSPVTIGWENIPRVEGGPIRRFVFTWFQPAVL
FT                   FALILFWYYAPNSIAKASTAIGIGIGFKVLLLVLEWVNPRYASWRLTWKELMTDLFYVG
FT                   LGYTVLDLVEHYIGSGAVIAAVRHSFDWDKLSWFTGWPLLVQAFVISFMFDFGQYWMHR
FT                   GMHNWYPLWLTHSVHHYITQLNINKGAVGNPVELFLIGLGIGGFFDFLPRAALLAGAIG
FT                   MAVGTYQHINVRFNTPRWWRFLFNTTEHHSLHHSRDFEASRSNYAGTYIFIDRMFGTCV
FT                   DGEAELLGMEGGRRMSIREQMTFPFTEAWKTMKERFGRGNYSGPEAVPAE"
FT   gene            664669..665286
FT                   /locus_tag="Saro_0616"
FT   CDS_pept        664669..665286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25063"
FT                   /db_xref="GOA:Q2GAR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAR0"
FT                   /protein_id="ABD25063.1"
FT                   /translation="MKLHFIDWIWNVRGRIPLAPGQTAEMAIGRLDPLFHEPGTTHACA
FT                   DRMLTFSKKDPAAQDRMSVFDSGVLVVEHDAAGPVLSYRLASRALLFCFLAPLLFLAFS
FT                   QLTILAGKLERPAAEAAAGAKDAKKKEDAVPRLNPVDKFLGAPAPEMPKAEAAGKAKEK
FT                   DKMPSPTPAYVFATLFAVLYAVGRILEAKLVHRLFSKRLQES"
FT   gene            complement(665380..665453)
FT                   /locus_tag="Saro_R0008"
FT                   /note="tRNA-Gly2"
FT   tRNA            complement(665380..665453)
FT                   /locus_tag="Saro_R0008"
FT                   /product="tRNA-Gly"
FT   gene            complement(665462..666613)
FT                   /locus_tag="Saro_0617"
FT   CDS_pept        complement(665462..666613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0617"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25064"
FT                   /db_xref="GOA:Q2GAQ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ9"
FT                   /protein_id="ABD25064.1"
FT                   /translation="MSVAGVHFVRSAKSGKPIRWYIYAWRGGPRIRVAEQATQPRLTKA
FT                   DIAAIAAAQQASDEPADTVKGLSTRWQRSREWKAFAESTRSLWGDCCTKIEEKWGKVPL
FT                   RVFGDPRTTSKIVKWRDEMADANGLRTADEHVKVLSMMAKYGLLQGLMACNPAQPVPRL
FT                   WKGGNREEIIWLPEDCAAFDAVAPQWLVDARKLAEFTGMRRADLCALRRDEVFDTHIGR
FT                   TAKKKSAGKRQRTVMPIIPGLRELLEELRARTRKPGIETVLVGAHGNPVQPATLSAQFN
FT                   KYRSLANDGQGIVHRAAYDDEADKAKHLHDLRGTFATKLMTLPGGGLTDDQIASVMGWS
FT                   SDQVATIRKRYVDEAAIVVAIGKRIAEAAVKQPVKRQGKQARK"
FT   gene            complement(666617..666838)
FT                   /locus_tag="Saro_0618"
FT   CDS_pept        complement(666617..666838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ8"
FT                   /protein_id="ABD25065.1"
FT                   /translation="MASQATRNVDREPKGYPQKAKVRAAVEYAREAGLDVCSIKVSPDG
FT                   SIQVFDTRAFPAVPRDEWEAWEQSGKLG"
FT   gene            complement(666842..667162)
FT                   /locus_tag="Saro_0619"
FT   CDS_pept        complement(666842..667162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ7"
FT                   /protein_id="ABD25066.1"
FT                   /translation="MILEPILDSRVVDWGEQQRAYDRALRQHLADVPDPEEYAICLPQD
FT                   VRCALAAAVMRHEGCYAYPQDIALLRPLGLCDFSSDRHRGRLLTAFGMQVRKAVLAMMM
FT                   GD"
FT   gene            complement(667159..667779)
FT                   /locus_tag="Saro_0620"
FT   CDS_pept        complement(667159..667779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0620"
FT                   /product="MT-A70 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25067"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ6"
FT                   /protein_id="ABD25067.1"
FT                   /translation="MDTPFASLAGKRFQLLYADPAWQTVLWSGAQRTPTQKQGEDHYPT
FT                   MSIDDMKALPVAEISASNAVLVMWAIGSHLDQAIELGRAWGFVYVTDLFYWAKQRQLRP
FT                   NQADLFTDDVPPCPIGMGKYTRKQVEPCLLFKRGKGLRVLDHGVPQLIVEPKREHSRKP
FT                   DRVYSDLESLFGFFPRIELFARSTREGWSSWGNQVGKHGEVTA"
FT   gene            complement(667779..668300)
FT                   /locus_tag="Saro_0621"
FT   CDS_pept        complement(667779..668300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25068"
FT                   /db_xref="GOA:Q2GAQ5"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ5"
FT                   /protein_id="ABD25068.1"
FT                   /translation="MTADDILAALIKRAGDDIFATELSMSGRDRRCDFWTISANGSAGF
FT                   HAIAYEIKVSRQDFMRDHAVKQREARLYSDRFFYVTPAALVRKDEVPDWAGLIELDGDK
FT                   LRTIVPAPIRDKDAPSWQFVVSLIRNSGQLHRDQDTLKKRMLNAERQVRDATKLLREAG
FT                   LEPWKFGIFG"
FT   gene            complement(668297..668983)
FT                   /locus_tag="Saro_0622"
FT   CDS_pept        complement(668297..668983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ4"
FT                   /protein_id="ABD25069.1"
FT                   /translation="MADKGIIFSDAMVRALLDGTKTQTRRLCAWPNNPNTPQLTYIVAC
FT                   DEPGWFGDEEGEVQFRVPHAQGDRLYVREAWSVRGTYTDVVEVGYRASANRSHTEFVEQ
FT                   WPVGDAIPGKGSWPQWPKYGPSIHMPRWASRMWLQITDVRVQRLQEISAADCRAEGLER
FT                   GAVGGLLPAYRGSADLEWRIYADDAYHDLWDSLHGESGTRWADNPWVTVYTFDVHKGNI
FT                   GKAARG"
FT   gene            complement(668987..669502)
FT                   /locus_tag="Saro_0623"
FT   CDS_pept        complement(668987..669502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25070"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ3"
FT                   /protein_id="ABD25070.1"
FT                   /translation="MSYARIDHAAWVEDNNRGYNQMYAKRRSWKPAPEKLTDFQAKVMD
FT                   ICGMVGGGIYNAPINWEKVSWGVGHNHSGIFVPWRDGRMSTFDFYPLTLLVLLCHEARI
FT                   RCEIRAKSAGHFELSFFQRSHEGGMALRHPNIDEAVAVFREYLPDDHRIRYRLPEVQSE
FT                   PALAVAEG"
FT   gene            complement(669506..669823)
FT                   /locus_tag="Saro_0624"
FT   CDS_pept        complement(669506..669823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0624"
FT                   /product="GP46 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25071"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ2"
FT                   /protein_id="ABD25071.1"
FT                   /translation="MADFTPSKALADVTTERQRQIEVEGYTAQHDDEHDCDGALSRAAA
FT                   CYALAGIEGGSGPFYVTHLQTPRQVWPYRWEWKPSDRRRNLVKAAALILAEIERLDRKE
FT                   G"
FT   gene            complement(669827..671284)
FT                   /locus_tag="Saro_0625"
FT   CDS_pept        complement(669827..671284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0625"
FT                   /product="ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25072"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ1"
FT                   /protein_id="ABD25072.1"
FT                   /translation="MSITTLPLSSLILSKLNVRHTERDADIAALADDIAARGLKQNLVV
FT                   IPAHFLTGEAEADWDSKWEVIAGGRRFQAMQLLVADGRLPADHEVPCLLEDRDDASETS
FT                   LSENLHKVAMNPADEFGAFKAIVDQRMSPKHGESEATAIAYTAKRFGKTVSYVEGRMRL
FT                   ADLCPDVLEALRTDKIGLEAAKAYAATTDHALQLKVFKEREKDTWNGHKPSTIRDAIRN
FT                   RTLPLDHALVEFVGLVTYQAEGGRIEGEMFMGAEGQQRVVDVTLLESLARKIAEAAIPA
FT                   LIKEHGFKEGLYAPGQGIGYYAKWPKAPSGYMKNWGDVEGLSKAKRKQLVGVYALDKDR
FT                   EDGVTKVSLIGTYKPEEKQAPREERDWEAERAASQRAYQVGILAARLAVPQLTGGLLKD
FT                   TELDGRTFWPKYSPRLVDEDPDDENFKLVAMMIRVPVADIEANRAEAERLYDEELAAEE
FT                   AARAAPQSQDDDEDDGADELVTDEAEG"
FT   gene            complement(671305..672378)
FT                   /locus_tag="Saro_0626"
FT   CDS_pept        complement(671305..672378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25073"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAQ0"
FT                   /protein_id="ABD25073.1"
FT                   /translation="MIAPVQNRVPCGPQVGAPPSLEQIPVDRLAVDPTYQRATDSPASR
FT                   RIIVGMVKRWDWSLCQPLVVSRRSDGSLLILDGQHRHAGAIERGDIHFLPCVILSALGL
FT                   EGEAKTFVELNTKRQRLTQAEVFHGMLAAGDPQAKAVADLIAQTGWTVRKGSNTAAYKA
FT                   GDLECAPMLVKVYAFKGEAPVQFALTALRAAYPDTPVRQSATLLKALVDVFDTMLDDPL
FT                   PTTKLIAAIGAVQPDTWISRGIIHRESFPAMSHIAAIAATMVAAAKGQEPPSARPLPTK
FT                   ATPVAPVAAPRTAPTPAPAPKPATLAPAPRPRAATKKLATVFGTSGKGWCEQCDQLVSR
FT                   EKARACTDRFCTARADA"
FT   gene            complement(672375..672731)
FT                   /locus_tag="Saro_0627"
FT   CDS_pept        complement(672375..672731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25074"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP9"
FT                   /protein_id="ABD25074.1"
FT                   /translation="MAEPHCPRCDDTGFCHHASFRMYPCAPRQEARVAIAAAEAAANAA
FT                   AELLRFAREGEDSSCFAFAEETVALLASAMQAALRLEYPRACILAAEHEDQTSPEAINQ
FT                   MLGALTRFLEVFEP"
FT   gene            complement(672976..673221)
FT                   /locus_tag="Saro_0628"
FT   CDS_pept        complement(672976..673221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25075"
FT                   /db_xref="GOA:Q2GAP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP8"
FT                   /protein_id="ABD25075.1"
FT                   /translation="MMLDSPSFGTARSTLDAVAHTREPALRVASAEPAPVLCETHGITD
FT                   RDRRDFRILLLAMPALAAIAASLSAICAAVISGQPA"
FT   gene            complement(673218..673670)
FT                   /locus_tag="Saro_0629"
FT   CDS_pept        complement(673218..673670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP7"
FT                   /protein_id="ABD25076.1"
FT                   /translation="MTPVTRLPLAALAAAEFRKRQQRAREIVRNGGMRALQADKHLRPW
FT                   LAVACLCGADLPELEEPLRVRRQDGNEGEARWLAADDICPRAHWVPVLASARDEAFNRW
FT                   LADSQNAALAQVASGIQRIALHLRHDINGVHVPPYPGFAPPEKAAA"
FT   gene            673769..674125
FT                   /locus_tag="Saro_0630"
FT   CDS_pept        673769..674125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25077"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP6"
FT                   /protein_id="ABD25077.1"
FT                   /translation="MLGNVTPAMKAADGLIGAWCTDADGVRDGFVMEPVCAITTGVKLI
FT                   ALASGELARASSEEGPPTIMNVPIDCWIADPVREDMAARLVFDFDGAPVAIGLDAHQLI
FT                   KLAAALGALARKVG"
FT   gene            complement(674200..674433)
FT                   /locus_tag="Saro_0631"
FT   CDS_pept        complement(674200..674433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25078"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP5"
FT                   /protein_id="ABD25078.1"
FT                   /translation="MLRTPTDFPYVGSTAFVSPNADQVRILQHNANGTVLVAFVRHPAD
FT                   RSASDTRTVDRNEIFASVEAALGKRPRRRKAA"
FT   gene            complement(674523..675179)
FT                   /locus_tag="Saro_0632"
FT   CDS_pept        complement(674523..675179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25079"
FT                   /db_xref="GOA:Q2GAP4"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP4"
FT                   /protein_id="ABD25079.1"
FT                   /translation="MKIYPVGLAGEVNYQEGILRSHPGEAVRVYHERDNPYDSRALRVE
FT                   NNVGDVIGYIPRSSWLQRAVHEDGLGIAATIKAISDGDGHGVFGVVLDVTLTDDPIFIR
FT                   EFSSSPRKRGKSDAKSRAIEPTGDERALALATGLIAMATVPLNCDCGRSYSHNYKGLRD
FT                   DSVLKCPSCDTLADVSEAVLFRLDAELHALLLQMLAHEGLPPVDADTVRALRLGA"
FT   gene            complement(675176..675802)
FT                   /locus_tag="Saro_0633"
FT   CDS_pept        complement(675176..675802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0633"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25080"
FT                   /db_xref="GOA:Q2GAP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP3"
FT                   /protein_id="ABD25080.1"
FT                   /translation="MCDTSHMSKFDIDAFRTRLQSLMDEHKIKRKPLAKAAGLGETSIR
FT                   DIFDSSRNDVRIGTLVRLADYFQMSVDELIEEPEMRLAGRVGAGGQVLFEAEDSHSGPT
FT                   VPKPPGASAAVMALEVVGTSMLPKYEDGDIVYVRRDVDGIPRSAIGEYCAVRTAEGGTY
FT                   LKILAKGSEPGRFTLRSLNAPDMENEEVVWAAPVLWVRQRPARAI"
FT   gene            complement(675882..676229)
FT                   /locus_tag="Saro_0634"
FT   CDS_pept        complement(675882..676229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25081"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP2"
FT                   /protein_id="ABD25081.1"
FT                   /translation="MIAPELLQGSPRIGASTACKRRRRSSLGPPLGRAPLGQVVDLSGG
FT                   GLVRWSSINTGMFTVPAILIHEPAHTLDRAHPHVASSAQLSDEMTIAKCLLPQSGRAQR
FT                   VSLEELLNVIQ"
FT   gene            complement(676226..676456)
FT                   /locus_tag="Saro_0635"
FT   CDS_pept        complement(676226..676456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP1"
FT                   /protein_id="ABD25082.1"
FT                   /translation="MDIDNCDIEFTCQCGHEFTEKLGALKAENGLRCPACNLEVTATDE
FT                   SFAKTRQDIEAATQSLAKQLGKALGKGFKPR"
FT   gene            676570..677037
FT                   /locus_tag="Saro_0636"
FT   CDS_pept        676570..677037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAP0"
FT                   /protein_id="ABD25083.1"
FT                   /translation="MSALARLKRAVRAAISSCSGVDGAAATTDRSRSVAGDWNNLNHAA
FT                   FPPLDKALAMDEVAMAKGELPPIACAYARELGGMFVPHIDPHADEGTAPWLVMKLAQEV
FT                   GEVSGLTSEAIANDGHIDPTEAEGILRQLDQHDRASAHYRAVLMKIREKGQ"
FT   sig_peptide     676570..676644
FT                   /locus_tag="Saro_0636"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.776) with cleavage site probability 0.592 at
FT                   residue 25"
FT   gene            677034..677600
FT                   /locus_tag="Saro_0637"
FT   CDS_pept        677034..677600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25084"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN9"
FT                   /protein_id="ABD25084.1"
FT                   /translation="MSHVSGRKVAPAHSTLYVPKDQLEAWFLKASEGAKRVYARGPGLD
FT                   QKEAVCILVRDWASTGEVDLVQMRDQETRELLYYVRRKRPVVREAGADRRRVQVDDQFR
FT                   ETPEGRIFLMLVRAANLGRPCPSNAELAEFAGLETAEQARYLLREKLVKPGLVELHHVG
FT                   AGNAQRRAKIVETGRWTADIKENGR"
FT   gene            677597..677956
FT                   /locus_tag="Saro_0638"
FT   CDS_pept        677597..677956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25085"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN8"
FT                   /protein_id="ABD25085.1"
FT                   /translation="MSNDRKALAAAVRARVSGLLGDGVHSGAVVSTAVDMVAELAAMGG
FT                   VSPIEAVVMGRIQERADILAFLAGRRTAALTIADKHPEMGEGADTHARAKWAAEQIAIE
FT                   IEAFEQGLHEGRAAQ"
FT   gene            677953..679200
FT                   /locus_tag="Saro_0639"
FT   CDS_pept        677953..679200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0639"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25086"
FT                   /db_xref="GOA:Q2GAN7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN7"
FT                   /protein_id="ABD25086.1"
FT                   /translation="MIATDKRKPAFRIAAKAMAKALADVVEVTPAGGKDTIPILNTVRM
FT                   EASDGVLTLTGCDLDQWIIRSLPTSDREPNSAEWLASIRPFATCVPARALLAIVKQIDA
FT                   DAMVTVAGPTDKESRVTITAGRSRFRVACLPVDDFPFPTRPDFEHSFSIAAGALRDVFA
FT                   RVEHAISTEETRYYLNGVYMHPQDLDQRFAATDGHRLARLVQDGPDGAASFPAVIIGRR
FT                   TVAVLDKLLDAAGKVDTSTSDDADKACSRPMVEVDSDSNGRVIYWAMPAPDGGEVTLIA
FT                   KTVDGTFPDYARVIPSAPSSFLTVDREALLAAIKRVAAVCSDKTRAVKLELDGAEKAIV
FT                   STASPEIGDAMEEIACEYAGEPLTIGFNGDYWRSCLSAVATDKVLMKFTDAGGPCRIEA
FT                   EGGESALVQVLMPLRV"
FT   gene            679217..679414
FT                   /locus_tag="Saro_0640"
FT   CDS_pept        679217..679414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25087"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN6"
FT                   /protein_id="ABD25087.1"
FT                   /translation="MSVQSDIGPARGGVPRWKTYAQAREIAALAQLAMECAADTPRADL
FT                   PRALAQFDRIRAILGTQSAE"
FT   gene            679419..681137
FT                   /locus_tag="Saro_0641"
FT   CDS_pept        679419..681137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0641"
FT                   /product="plasmid and phage DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25088"
FT                   /db_xref="GOA:Q2GAN5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN5"
FT                   /protein_id="ABD25088.1"
FT                   /translation="MAIPHQFLDELRSRTTLSALIAQTLKIDKAGREFKACCPFHGEKT
FT                   PSFTINDAKGFYHCFGCGAHGDAIRWMIDQRGLQFIDAVSELASAAGMKVPAPTPQERE
FT                   RSAKIETVREALDIAQGIFVGQLREAGAVMQYLERRGMTPMDLEIFGIGYARGMDGSLR
FT                   GSGIGRQIGQAAGLLSQREDGSLREMFHDRVTVPIHDARGRLVGFGGRVWPGRRRDTPK
FT                   FVNSPDSPIFDKGRTLFNLHRAAPAARPGAENRLIVVEGYFDVVSMARAGFAACVAPMG
FT                   TALTEEQLVRCWRLHHRPVLLFDGDSAGQKAAVRACRTAIPGIGPGRELAIALLPDGKD
FT                   PDELLYMDATGMGRRAIEAIVTEALPLHTFLFDAIVAEAGANPTPEQTAAVWAELAALA
FT                   GEIADEETRCQYLGTWRARFEREISALPQVHEAEPLHAVVAAEDGEYVFPESESDSQRR
FT                   LIALVRAVLKKREERREINEEIADLMKMAELAGFQKKAISAAVADIESDMKHGPAKREE
FT                   DEMQRVLYRRVLGIRGPMTEAMMPQLIDGTPRGASAQVKRRATVHALIDARASAV"
FT   gene            681134..682756
FT                   /locus_tag="Saro_0642"
FT   CDS_pept        681134..682756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0642"
FT                   /product="Phage or plasmid primase P4-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25089"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN4"
FT                   /protein_id="ABD25089.1"
FT                   /translation="MKRLSLLERSRLPTNDLGNARRLFEAANGRLLWLADGAGGKGCWI
FT                   AFDGIRWSADEGPMRALAFAQKAAVEICDEAHALRECTADELAEVYGRKFSKEMAEERA
FT                   GQLWTWSIKSGDSAKTTAMQNQFKGLRDGDEGPFVTQVWQRDFDAQPMAYHCSNGTLRF
FT                   VQDDAGTWSHVFEKGHRPDDRFMQVANVAYDAAAKAKAWIERMEVMHHDPVQRTALQRI
FT                   YGMTLTALISDQAFYIFQGKGQDGKSVTNDVVCQLHGMYARKADPKTFLEGPTQQSSGP
FT                   QSDIVRLAGDVRLVVMDEPKKNSTWDGQKIKQATGSEMIARGVHATTELSFTPHWQLIA
FT                   ECNGLPKAPSDDRGFRRRFKLYPWVVQFGVTPGVADEPVHLVKARLIGEGSGVLNWMIK
FT                   GCVEWLNERVVPEPEAAKRATASFWSASSAMGEWIASHCDLSDPEAREEATPLYKAFRQ
FT                   FCIDRGDDETKIITQTTFGRQLNDAQIYRVPNNSTGKVERVGIRLKRVDELGGGALSTS
FT                   GRDTFDDDVARFDADNRDPFGAP"
FT   gene            683070..683543
FT                   /locus_tag="Saro_0643"
FT   CDS_pept        683070..683543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN3"
FT                   /protein_id="ABD25090.1"
FT                   /translation="MGRRDPEIEATEEMLLEAWQLLMRSPDQERGWLISGQRSWWPQII
FT                   RDKVMDYADEDARPRQQLGRREVALRDRVFVDVGCLAEEIAPQIRPLVAVVLTMKTWRD
FT                   VGGFRWERVWEALGGRESGTTSDGLKVRYQRTLKQLGAIEAARRDRVGDGERL"
FT   gene            683751..684059
FT                   /locus_tag="Saro_0644"
FT   CDS_pept        683751..684059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0644"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25091"
FT                   /db_xref="GOA:Q2GAN2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN2"
FT                   /protein_id="ABD25091.1"
FT                   /translation="MRRQERIAPRPPRIAPRAKKTLPFYQSAEWKALVAQVIKLRGRRC
FT                   QDCGSGSGRIYADHVKELRDGGAPLNPMNIWLRCSPCHGAKTEARRRERAGLRPVQD"
FT   gene            684152..684628
FT                   /locus_tag="Saro_0645"
FT   CDS_pept        684152..684628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25092"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN1"
FT                   /protein_id="ABD25092.1"
FT                   /translation="MSCGSSDDAPGLFGWTPAPPRGQGRPPYVWSREKSNKLMVLFASG
FT                   YRQRDAAAVLGCDVKTLRKVFPQECKHQAQAELITRSGLMAKLVELAESGNVSAIRQFD
FT                   KMLTAERLKSVAGTIVERRKEKPEKLGKKDQAKLAAHEMGGKFGARTPPPRLIN"
FT   gene            684636..686372
FT                   /locus_tag="Saro_0646"
FT   CDS_pept        684636..686372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0646"
FT                   /product="phage Terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25093"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAN0"
FT                   /protein_id="ABD25093.1"
FT                   /translation="MARPVWSTACQDWRERIVARESIAPCGPLFPAKAADALGVFKSLQ
FT                   VTDLPKRENGTHPTLGEVCDQFVFDLVAAIFGAEDPETGERLIKEFMLLISKKNGKSMI
FT                   AAGIMVTALILNWRPNAILQILAPTIEVANNSFEPAMGMVRADAELAIVLKVVEHQRQI
FT                   KHLTTGAVLRVIAADSDTVAGGKAAMTLIEELWLFGKKAKAAAMLREALGGGSARPEGF
FT                   TLYITTHSDEPPAGVFKTKLSYFRDVRDGEIEDPATFPMLYEWPEDLLECESYLDPEFF
FT                   YVTNPHVGRSVSIEWLKSELQKEQIGEGEGLQIFLAKHLNVEIGLRLRRDRWGGAELWL
FT                   DAANDDLDLDQLLERCEVAIVGLDMGGRDDLAGAGVVGREKGTGIWLGWAHAWAQRVAL
FT                   ERRKQVAPTLQGFAAEGDLTFTDSGEEIVSAMARLAIRVRDSGKMPADGGVAVDAWGIG
FT                   PLVDALVQAGFDPGDEAMKRAGHIASIRQGVGLSSAIYTLEFKLGDGMFRHDGSNMMAW
FT                   CVSNALVKLRGSALYVDKETSGAGKIDPFVALLNAVKRMEEGPVAVAGGVDSWLASLRG
FT                   AA"
FT   gene            686369..687673
FT                   /locus_tag="Saro_0647"
FT   CDS_pept        686369..687673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0647"
FT                   /product="Phage portal protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25094"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM9"
FT                   /protein_id="ABD25094.1"
FT                   /translation="MSSLAPRTSWLAKATTALRDWLVLGPDPKIRDPQNSSRGGNGAGV
FT                   TVNDQAAMRLSAFWGCVRLISSTIGSLPVPVYTVDQRGVRSVARESALYRVLHDSPNAD
FT                   QTPVDYMECAVISLLLRGNHYARKLMEGGRLVGLEPINPAIVSVRRRSDGRIGYRWTEG
FT                   GENFDLTEDEVFHVRGFGGGPLGGLSTVEFARESLGVAIAADRAASAIFANGVNPTGIM
FT                   STDMPLTAAQQAEAEELIVKKYQGAHRMGVPMVLGHGLKWNSITMKADDAQLLQSRGWS
FT                   VEEICRWFGVPPFMIGHNEKTTSWGTGIEQMLLGFQKFTLNPYLRRIEQAVRKQLITPI
FT                   ERARGLTAEFNLEGLLRADSAGRASFYDKALKSKWMVINEVRAKENLAPVPWGDEPIVQ
FT                   QQDVPLSDQLDALREAIKNAQDVAGLFQKGNANAA"
FT   gene            687663..688358
FT                   /locus_tag="Saro_0648"
FT   CDS_pept        687663..688358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0648"
FT                   /product="prohead peptidase, Unknown type peptidase, MEROPS
FT                   family U35"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25095"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM8"
FT                   /protein_id="ABD25095.1"
FT                   /translation="MQRKSGGLKLRDFHLSVKAQDIGDDGSFTGYGSVFGVVDSYQEVV
FT                   AKGAFTASLAELSSKNRKVPVLWQHRQSEPIGVYDMLEEDDLGLKVAGKLLVNDVNQAK
FT                   ESLALMKAGAVTGLSIGYFVRKSSYDEKTGIRTLLELDLVEVSLVTFPANDEARIDAVK
FT                   MKLAHGELPTLPEFERLLREAGFSKTKAAVVAAHGLPHLLRSESGSAMANEGLKSLSDA
FT                   LAGLKLPTF"
FT   gene            688371..689768
FT                   /locus_tag="Saro_0649"
FT   CDS_pept        688371..689768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0649"
FT                   /product="Phage major capsid protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25096"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM7"
FT                   /protein_id="ABD25096.1"
FT                   /translation="MKKNLIAAALVVAVSLVLAPSAAFAATFAQQIHPSLDINGALAAI
FT                   GMLAAVGSISEFGRKQAGEGEGELKQLAVDLKSATDQVKTFAEKADAEMKRLGTVTEET
FT                   KKSADEALIKMNETTARIDAIEQKLARRGEEGEKRRAKTAGQEVTESEEFKAWLGGNRK
FT                   NTFSMQVKAIISSLTTDADGSAGDLIVPQRQPGIIGLPQRRMTIRDLLTPGNTGSNAIQ
FT                   YVKETGFTNNAATVTETAGTAKPQSEIKFDIVTSSVTTIAHWVLATKQILDDVPQLRSY
FT                   IDGRLRYGLEYVEEGQLLNGGGTGTDLNGIYTQATAFAAPITPTAAGMMTKIDIIRLAI
FT                   LQAALAELPANGIVMHPSDWADIELTKTDDGAYLFANPQGGSEARLWRLPVVETQAMTV
FT                   DKFLTGAFQMGAQVFDREEANVEISTEDSDNFRKNLVTIRAEERLALAVYRPEAFIKGD
FT                   FSDALAL"
FT   sig_peptide     688371..688448
FT                   /locus_tag="Saro_0649"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            689768..690067
FT                   /locus_tag="Saro_0650"
FT   CDS_pept        689768..690067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM6"
FT                   /protein_id="ABD25097.1"
FT                   /translation="MKREGRLRAALFPSGPDGPFRKRRFQMKLKVLEQIHVSAVSSDTL
FT                   RRGQEIEVSNAAGEDLLKFHPDKFEQVAGKCGGAKKAAVPENKQAPKPDNKFGA"
FT   gene            690125..690487
FT                   /locus_tag="Saro_0651"
FT   CDS_pept        690125..690487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM5"
FT                   /protein_id="ABD25098.1"
FT                   /translation="MRRYKVTVTTAADGTATAYTPRLSGKIQQIEYVKTDFASGVDFTI
FT                   TGEATGINLWTESDVNASAVRAPRQACHSQVGAAQLYASGGTAVTDRIGLSGDRVKIAI
FT                   AQGGATKIGTFHVIVD"
FT   gene            690557..691102
FT                   /locus_tag="Saro_0652"
FT   CDS_pept        690557..691102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0652"
FT                   /product="Phage conserved hypothetical protein, phiE125
FT                   gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25099"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM4"
FT                   /protein_id="ABD25099.1"
FT                   /translation="MGLTLIAASAAAPVDLEEVKRWCKIEVDDDDAIVEMLIAAASELV
FT                   QNFIGKAITEQLWLITLPAFADTVELEPGPVVEVTAVRYLDEDRIEQILDPAIYIEDTI
FT                   SAPARLVRDPDQSWPATASPTVPNVVSIEFTTGPEEADPRVKAAIMATVAQWYDNRIPG
FT                   ALPAGVTAMLQPMRRMVL"
FT   gene            691102..691452
FT                   /locus_tag="Saro_0653"
FT   CDS_pept        691102..691452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0653"
FT                   /product="Phage head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25100"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM3"
FT                   /protein_id="ABD25100.1"
FT                   /translation="MAEFDPGRFKDRITILQPGRAQQGKYGTHAVAWTEMVTVWGEVRD
FT                   MLPSRAERIAEGLEISRRPCRVRIRHRGDVRTDMRLRFLGRTLRIVAIAEVGRREVLEI
FT                   AAEELSTEGQDS"
FT   gene            691488..692093
FT                   /locus_tag="Saro_0654"
FT   CDS_pept        691488..692093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0654"
FT                   /product="Phage protein, HK97, gp10"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25101"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM2"
FT                   /protein_id="ABD25101.1"
FT                   /translation="MAFLEAFPARLQKNALKSAMIAGARVVRDEARANVPVKSGKLRKA
FT                   IKTSSPRAFKGGAASVKVKVLGEHSFIGHFIEYGVRPHLITAGDSKLTVRTLNKRASRG
FT                   EGIRETETGLIRVGGYEGTRTTQTSDGPREDTFKINAAFIRGAIVHPGFPAHPFLRPAL
FT                   DRTASQVVDAIGSRLREYLKDRTSFTAPITIEADVEDE"
FT   gene            692086..692493
FT                   /locus_tag="Saro_0655"
FT   CDS_pept        692086..692493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25102"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM1"
FT                   /protein_id="ABD25102.1"
FT                   /translation="MSDGVATMVQLLHESAAVTGLVPAGSIGAGVLPLGTPLPYLSLSL
FT                   VSSSDMNMPAPGAKRRVLDRVQVTIAAATYDELREISKAVKSAGADQVPDVDGISQVTV
FT                   HSLGAGPDFMDETASIYLGSRDFRVWYNEVR"
FT   gene            692508..692723
FT                   /locus_tag="Saro_0656"
FT   CDS_pept        692508..692723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAM0"
FT                   /protein_id="ABD25103.1"
FT                   /translation="MSKKNAIVIRKRGVNHGDDHFPAGTVIRDMPEGQFKDWSDIGIVR
FT                   EASDAEVAAGGPGKQSKPRRSDEAAE"
FT   gene            692812..693273
FT                   /locus_tag="Saro_0657"
FT   CDS_pept        692812..693273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25104"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL9"
FT                   /protein_id="ABD25104.1"
FT                   /translation="MSIFATAGSTISLSAGVPATFNTAGYSALTYTIVGEVTDLGEFGR
FT                   EYALITHNPIGSRGTVKKKGSFNEGQLTVQMALDTDDAGQILAKAAELSDNPYAVKIAL
FT                   ASGDAYYAQALVMSFKVTGGGVDTITSATMVLELTTSTGGVGIVEALAA"
FT   sig_peptide     692812..692895
FT                   /locus_tag="Saro_0657"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.704) with cleavage site probability 0.187 at
FT                   residue 28"
FT   gene            693380..693796
FT                   /locus_tag="Saro_0658"
FT   CDS_pept        693380..693796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25105"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL8"
FT                   /protein_id="ABD25105.1"
FT                   /translation="MAFDITRRRALETATIDLKNGDDSPLTDDDGKVLSVTVHGPGSKV
FT                   WRQASAEINRRKAERLQKAGGKLAASLDSAKEDQVEFLSRVTISFNGWEYPGTGNDREM
FT                   FAAAYADDSLGFIRDHVHAEVHSWEAFTKGSAAS"
FT   gene            693814..694263
FT                   /locus_tag="Saro_0659"
FT   CDS_pept        693814..694263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25106"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL7"
FT                   /protein_id="ABD25106.1"
FT                   /translation="MAWLSVAPKDKSKRPLKGSTARRDTPVKRADAMRAAGLEVRLPPN
FT                   PAPYLIDWLMEIGPTAPGAMSHVAVGWRDIAAWQEAMGVDLLPWEAALVRQLSADFANQ
FT                   LHDAEDQACPAPWSEQKAVEDNREAVSRKLEMTFKALIAAQNPKR"
FT   gene            694266..697238
FT                   /locus_tag="Saro_0660"
FT   CDS_pept        694266..697238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25107"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL6"
FT                   /protein_id="ABD25107.1"
FT                   /translation="MAGVKAGTLEIEILTNMARLQEEMRQIEKSVGNMSTGVARSTKAA
FT                   NDNIGSIGKTSGLAKHHVQNLAFQFQDLGIQLTAAAQSSKPFQGAMMALFQQGTQIQGV
FT                   MSQAGIGVGGLIAQIGRFVLAAAPAIAAIGAISAAVGLVTSEINENSKVTVTWQDTLLG
FT                   TYDALKKYLTDQLTGAFKAFGLETSNVWKDVVNAAKWGINWIIGAMTVVPRVLRDTWSL
FT                   IPAGVADIFVTAANGAIRAVNAMVAKTVEILNGFISSANVILGKVGLDLPKLAAPQIGE
FT                   LQNSYAGAGAKLGTAFMGAIRDTVTRDYLGDAAAAISPFAQARAVERMKKDAKKAGKEA
FT                   GKALRDGAEDELKKLLASLEGTFAIYRDAAKTTGKMLDKQLDRDWQRMFDEMADKQRKA
FT                   SQAAVDAADANAAWNDELRRTIELLDQIGGFASILANIGAVIEGFSSGDFSGVRGPLGG
FT                   LLGLVGSTDEGKQAIKDLGVVFRDALDGVFGGEGSFTKALKAASVGVAAGQMVFGSKNS
FT                   GIGSAVGGVLGEVAGKAIGKSVGGLLGKVGGPLGSIVGGILGGALGSLFKTVKTGFAVV
FT                   SNTGVTSGGSSSELASSSKSSGTGIQAAIQNIADQLGGSVGNYSVSIGKRSSGWISVSA
FT                   SGSSQVADKNWKKRNVGGDLIYDGKDEAEALRVALLNAIRDGAIQGVRAGTAALLKKDG
FT                   DIETQLNKALKFEGVFTSLKQMTDPVGYALQQLTKEFEGLKKIFDEAGATAAEYADLEK
FT                   LLNLQKQEAIDKAAAEVRQKALEAVNDPLKLQIRILELLGKGEDAVAAARIMELASLKS
FT                   SLQPLQAMVYQLEDAKAVIDQFGPLADDLRAYRKELLGGSTTMGLAYLAGQFRSTAASA
FT                   AGGDATALGQLRSVSGQYLDAAKENAASALDYQRAVSEVLAAVDRGLFAADAQVDYAQA
FT                   QIDAIENTANIMQSMKTELVTLQKQVADTSATTLKLWQRFEINGLPVNNDAGPVQVEVV
FT                   S"
FT   gene            697235..698281
FT                   /locus_tag="Saro_0661"
FT   CDS_pept        697235..698281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL5"
FT                   /protein_id="ABD25108.1"
FT                   /translation="MRIVRPISVTNTNLLSSNVPETPPAAYDAGATYALDALVSVLTGT
FT                   VAIVYRSLQAGNTGNTPGSSPDWWLALGTAYLAYDSGTTYALDDIVFSAATNHTYQSLQ
FT                   AANTGHALDDPSWWLDLGPTNRYRMFDQANSSQTTNAESIIVEVQVTGRADAVSLLNIA
FT                   GASAQVVAETVEDGEIYNETFNLVSPSGINDWYQYFFEPIVRQGDLTVYDLPLNANPVI
FT                   TVTLIEPGATAKIGSLVIGQSQFLGDTIHPAKLGIQDFSRKETDEFGNFTIIERSFARR
FT                   ATFKVAIDEARMDAISTALTNYRAEAIVWLGVDSYASSWIYGFYRDWEFDLSAPEETYL
FT                   NIELEGLT"
FT   gene            698281..699117
FT                   /locus_tag="Saro_0662"
FT   CDS_pept        698281..699117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL4"
FT                   /protein_id="ABD25109.1"
FT                   /translation="MPLQDIAVLPDPPARSDPPEDFIAKADALLSSLPAFVDQLNILAT
FT                   QLEATAALINVAPAYADAGLRALTGKTPAANKLPYYTGTAASALADFTAAARSFLAAAD
FT                   ASAQLDALGVSAFMKSLLNDADAAAAQDTLELVPGTDVQAFDADLAAIAALATTAFGRS
FT                   VLTIADGAGGRTLFGSNGSLGYGSNASGKYFSVPIQDRTYYLQIMTGSTPSNGWSSAIN
FT                   LPVAFTTEGWIVAGANSLNTGATEGNKIAADLVGLDKFKVGSDDSPTDYTCIAWGY"
FT   gene            699121..700221
FT                   /locus_tag="Saro_0663"
FT   CDS_pept        699121..700221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saro_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saro_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABD25110"
FT                   /db_xref="UniProtKB/TrEMBL:Q2GAL3"
FT                   /protein_id="ABD25110.1"
FT                   /translation="MPVPEISALPTAPSRLDEPGAFVARADEFLGALSPFGMQANDLAT
FT                   WMDTTAAAVSSDKSLVLSTAEAVGTIAGQVAENAALVAEVLAAMGRFYATRSSGVAATS
FT                   VGELFTSNEGGTLAVYQRTATTPFYSTISVVGYAGGIGSSLLTMASARLLGRTTGSTGP
FT                   IEELSAAGLLSLSGGTLRGLHAAHGLFGKGVTGEYVSPQINNAAPTTVTLTTGGIHYTP
FT                   LRVMRDLAFDRLEVEVTSNPAAGTTIHLAIYPDNGGVPDGSTALART