(data stored in ACNUC7421 zone)

EMBL: CP000250

ID   CP000250; SV 1; circular; genomic DNA; STD; PRO; 5331656 BP.
XX
AC   CP000250; AALQ01000000-AALQ01000013;
XX
PR   Project:PRJNA15747;
XX
DT   07-FEB-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Rhodopseudomonas palustris HaA2, complete genome.
XX
KW   .
XX
OS   Rhodopseudomonas palustris HaA2
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Rhodopseudomonas.
XX
RN   [1]
RP   1-5331656
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Pelletier D.A.,
RA   Kyrpides N., Anderson I., Oda Y., Harwood C.S., Richardson P.;
RT   "Complete sequence of Rhodopseudomonas palustris HaA2";
RL   Unpublished.
XX
RN   [2]
RP   1-5331656
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Pelletier D.A.,
RA   Kyrpides N., Anderson I., Oda Y., Harwood C.S., Richardson P.;
RT   ;
RL   Submitted (20-JAN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; feddab1bf875df0110fdddb4aca552a3.
DR   BioSample; SAMN02598335.
DR   EnsemblGenomes-Gn; EBG00001028872.
DR   EnsemblGenomes-Gn; EBG00001028873.
DR   EnsemblGenomes-Gn; EBG00001028874.
DR   EnsemblGenomes-Gn; EBG00001028875.
DR   EnsemblGenomes-Gn; EBG00001028876.
DR   EnsemblGenomes-Gn; EBG00001028877.
DR   EnsemblGenomes-Gn; EBG00001028878.
DR   EnsemblGenomes-Gn; EBG00001028879.
DR   EnsemblGenomes-Gn; EBG00001028880.
DR   EnsemblGenomes-Gn; EBG00001028881.
DR   EnsemblGenomes-Gn; EBG00001028882.
DR   EnsemblGenomes-Gn; EBG00001028883.
DR   EnsemblGenomes-Gn; EBG00001028884.
DR   EnsemblGenomes-Gn; EBG00001028885.
DR   EnsemblGenomes-Gn; EBG00001028886.
DR   EnsemblGenomes-Gn; EBG00001028887.
DR   EnsemblGenomes-Gn; EBG00001028888.
DR   EnsemblGenomes-Gn; EBG00001028889.
DR   EnsemblGenomes-Gn; EBG00001028890.
DR   EnsemblGenomes-Gn; EBG00001028891.
DR   EnsemblGenomes-Gn; EBG00001028892.
DR   EnsemblGenomes-Gn; EBG00001028893.
DR   EnsemblGenomes-Gn; EBG00001028894.
DR   EnsemblGenomes-Gn; EBG00001028895.
DR   EnsemblGenomes-Gn; EBG00001028896.
DR   EnsemblGenomes-Gn; EBG00001028897.
DR   EnsemblGenomes-Gn; EBG00001028898.
DR   EnsemblGenomes-Gn; EBG00001028899.
DR   EnsemblGenomes-Gn; EBG00001028900.
DR   EnsemblGenomes-Gn; EBG00001028901.
DR   EnsemblGenomes-Gn; EBG00001028902.
DR   EnsemblGenomes-Gn; EBG00001028903.
DR   EnsemblGenomes-Gn; EBG00001028904.
DR   EnsemblGenomes-Gn; EBG00001028905.
DR   EnsemblGenomes-Gn; EBG00001028906.
DR   EnsemblGenomes-Gn; EBG00001028907.
DR   EnsemblGenomes-Gn; EBG00001028908.
DR   EnsemblGenomes-Gn; EBG00001028909.
DR   EnsemblGenomes-Gn; EBG00001028910.
DR   EnsemblGenomes-Gn; EBG00001028911.
DR   EnsemblGenomes-Gn; EBG00001028912.
DR   EnsemblGenomes-Gn; EBG00001028913.
DR   EnsemblGenomes-Gn; EBG00001028914.
DR   EnsemblGenomes-Gn; EBG00001028915.
DR   EnsemblGenomes-Gn; EBG00001028916.
DR   EnsemblGenomes-Gn; EBG00001028917.
DR   EnsemblGenomes-Gn; EBG00001028918.
DR   EnsemblGenomes-Gn; EBG00001028919.
DR   EnsemblGenomes-Gn; EBG00001028920.
DR   EnsemblGenomes-Gn; EBG00001028921.
DR   EnsemblGenomes-Gn; EBG00001028922.
DR   EnsemblGenomes-Gn; EBG00001028923.
DR   EnsemblGenomes-Gn; EBG00001028924.
DR   EnsemblGenomes-Gn; EBG00001028925.
DR   EnsemblGenomes-Gn; EBG00001028926.
DR   EnsemblGenomes-Gn; EBG00001028927.
DR   EnsemblGenomes-Gn; EBG00001028928.
DR   EnsemblGenomes-Gn; EBG00001028929.
DR   EnsemblGenomes-Gn; EBG00001028930.
DR   EnsemblGenomes-Gn; EBG00001028931.
DR   EnsemblGenomes-Gn; EBG00001028932.
DR   EnsemblGenomes-Gn; EBG00001028933.
DR   EnsemblGenomes-Gn; EBG00001028934.
DR   EnsemblGenomes-Gn; EBG00001028935.
DR   EnsemblGenomes-Gn; EBG00001028936.
DR   EnsemblGenomes-Gn; EBG00001028937.
DR   EnsemblGenomes-Gn; EBG00001028938.
DR   EnsemblGenomes-Gn; EBG00001028939.
DR   EnsemblGenomes-Gn; EBG00001028940.
DR   EnsemblGenomes-Gn; EBG00001028941.
DR   EnsemblGenomes-Gn; RPB_R0001.
DR   EnsemblGenomes-Gn; RPB_R0002.
DR   EnsemblGenomes-Gn; RPB_R0003.
DR   EnsemblGenomes-Gn; RPB_R0004.
DR   EnsemblGenomes-Gn; RPB_R0005.
DR   EnsemblGenomes-Gn; RPB_R0006.
DR   EnsemblGenomes-Gn; RPB_R0007.
DR   EnsemblGenomes-Gn; RPB_R0008.
DR   EnsemblGenomes-Gn; RPB_R0009.
DR   EnsemblGenomes-Gn; RPB_R0010.
DR   EnsemblGenomes-Gn; RPB_R0012.
DR   EnsemblGenomes-Gn; RPB_R0013.
DR   EnsemblGenomes-Gn; RPB_R0014.
DR   EnsemblGenomes-Gn; RPB_R0015.
DR   EnsemblGenomes-Gn; RPB_R0018.
DR   EnsemblGenomes-Gn; RPB_R0019.
DR   EnsemblGenomes-Gn; RPB_R0020.
DR   EnsemblGenomes-Gn; RPB_R0023.
DR   EnsemblGenomes-Gn; RPB_R0024.
DR   EnsemblGenomes-Gn; RPB_R0025.
DR   EnsemblGenomes-Gn; RPB_R0026.
DR   EnsemblGenomes-Gn; RPB_R0027.
DR   EnsemblGenomes-Gn; RPB_R0028.
DR   EnsemblGenomes-Gn; RPB_R0029.
DR   EnsemblGenomes-Gn; RPB_R0030.
DR   EnsemblGenomes-Gn; RPB_R0031.
DR   EnsemblGenomes-Gn; RPB_R0032.
DR   EnsemblGenomes-Gn; RPB_R0033.
DR   EnsemblGenomes-Gn; RPB_R0034.
DR   EnsemblGenomes-Gn; RPB_R0035.
DR   EnsemblGenomes-Gn; RPB_R0036.
DR   EnsemblGenomes-Gn; RPB_R0037.
DR   EnsemblGenomes-Gn; RPB_R0038.
DR   EnsemblGenomes-Gn; RPB_R0039.
DR   EnsemblGenomes-Gn; RPB_R0040.
DR   EnsemblGenomes-Gn; RPB_R0041.
DR   EnsemblGenomes-Gn; RPB_R0042.
DR   EnsemblGenomes-Gn; RPB_R0043.
DR   EnsemblGenomes-Gn; RPB_R0044.
DR   EnsemblGenomes-Gn; RPB_R0046.
DR   EnsemblGenomes-Gn; RPB_R0047.
DR   EnsemblGenomes-Gn; RPB_R0048.
DR   EnsemblGenomes-Gn; RPB_R0049.
DR   EnsemblGenomes-Gn; RPB_R0050.
DR   EnsemblGenomes-Gn; RPB_R0051.
DR   EnsemblGenomes-Gn; RPB_R0052.
DR   EnsemblGenomes-Gn; RPB_R0053.
DR   EnsemblGenomes-Gn; RPB_R0054.
DR   EnsemblGenomes-Gn; RPB_R0055.
DR   EnsemblGenomes-Gn; RPB_R0056.
DR   EnsemblGenomes-Gn; RPB_R0057.
DR   EnsemblGenomes-Gn; RPB_R0058.
DR   EnsemblGenomes-Gn; RPB_R0059.
DR   EnsemblGenomes-Gn; RPB_R0060.
DR   EnsemblGenomes-Tr; EBT00001631794.
DR   EnsemblGenomes-Tr; EBT00001631795.
DR   EnsemblGenomes-Tr; EBT00001631796.
DR   EnsemblGenomes-Tr; EBT00001631797.
DR   EnsemblGenomes-Tr; EBT00001631798.
DR   EnsemblGenomes-Tr; EBT00001631799.
DR   EnsemblGenomes-Tr; EBT00001631800.
DR   EnsemblGenomes-Tr; EBT00001631801.
DR   EnsemblGenomes-Tr; EBT00001631802.
DR   EnsemblGenomes-Tr; EBT00001631803.
DR   EnsemblGenomes-Tr; EBT00001631804.
DR   EnsemblGenomes-Tr; EBT00001631805.
DR   EnsemblGenomes-Tr; EBT00001631806.
DR   EnsemblGenomes-Tr; EBT00001631807.
DR   EnsemblGenomes-Tr; EBT00001631808.
DR   EnsemblGenomes-Tr; EBT00001631809.
DR   EnsemblGenomes-Tr; EBT00001631810.
DR   EnsemblGenomes-Tr; EBT00001631811.
DR   EnsemblGenomes-Tr; EBT00001631812.
DR   EnsemblGenomes-Tr; EBT00001631813.
DR   EnsemblGenomes-Tr; EBT00001631814.
DR   EnsemblGenomes-Tr; EBT00001631815.
DR   EnsemblGenomes-Tr; EBT00001631816.
DR   EnsemblGenomes-Tr; EBT00001631817.
DR   EnsemblGenomes-Tr; EBT00001631818.
DR   EnsemblGenomes-Tr; EBT00001631819.
DR   EnsemblGenomes-Tr; EBT00001631820.
DR   EnsemblGenomes-Tr; EBT00001631821.
DR   EnsemblGenomes-Tr; EBT00001631822.
DR   EnsemblGenomes-Tr; EBT00001631823.
DR   EnsemblGenomes-Tr; EBT00001631824.
DR   EnsemblGenomes-Tr; EBT00001631825.
DR   EnsemblGenomes-Tr; EBT00001631826.
DR   EnsemblGenomes-Tr; EBT00001631827.
DR   EnsemblGenomes-Tr; EBT00001631828.
DR   EnsemblGenomes-Tr; EBT00001631829.
DR   EnsemblGenomes-Tr; EBT00001631830.
DR   EnsemblGenomes-Tr; EBT00001631831.
DR   EnsemblGenomes-Tr; EBT00001631832.
DR   EnsemblGenomes-Tr; EBT00001631833.
DR   EnsemblGenomes-Tr; EBT00001631834.
DR   EnsemblGenomes-Tr; EBT00001631835.
DR   EnsemblGenomes-Tr; EBT00001631836.
DR   EnsemblGenomes-Tr; EBT00001631837.
DR   EnsemblGenomes-Tr; EBT00001631838.
DR   EnsemblGenomes-Tr; EBT00001631839.
DR   EnsemblGenomes-Tr; EBT00001631840.
DR   EnsemblGenomes-Tr; EBT00001631841.
DR   EnsemblGenomes-Tr; EBT00001631842.
DR   EnsemblGenomes-Tr; EBT00001631843.
DR   EnsemblGenomes-Tr; EBT00001631844.
DR   EnsemblGenomes-Tr; EBT00001631845.
DR   EnsemblGenomes-Tr; EBT00001631846.
DR   EnsemblGenomes-Tr; EBT00001631847.
DR   EnsemblGenomes-Tr; EBT00001631848.
DR   EnsemblGenomes-Tr; EBT00001631849.
DR   EnsemblGenomes-Tr; EBT00001631850.
DR   EnsemblGenomes-Tr; EBT00001631851.
DR   EnsemblGenomes-Tr; EBT00001631852.
DR   EnsemblGenomes-Tr; EBT00001631853.
DR   EnsemblGenomes-Tr; EBT00001631854.
DR   EnsemblGenomes-Tr; EBT00001631855.
DR   EnsemblGenomes-Tr; EBT00001631856.
DR   EnsemblGenomes-Tr; EBT00001631857.
DR   EnsemblGenomes-Tr; EBT00001631858.
DR   EnsemblGenomes-Tr; EBT00001631859.
DR   EnsemblGenomes-Tr; EBT00001631860.
DR   EnsemblGenomes-Tr; EBT00001631861.
DR   EnsemblGenomes-Tr; EBT00001631862.
DR   EnsemblGenomes-Tr; EBT00001631863.
DR   EnsemblGenomes-Tr; RPB_R0001-1.
DR   EnsemblGenomes-Tr; RPB_R0002-1.
DR   EnsemblGenomes-Tr; RPB_R0003-1.
DR   EnsemblGenomes-Tr; RPB_R0004-1.
DR   EnsemblGenomes-Tr; RPB_R0005-1.
DR   EnsemblGenomes-Tr; RPB_R0006-1.
DR   EnsemblGenomes-Tr; RPB_R0007-1.
DR   EnsemblGenomes-Tr; RPB_R0008-1.
DR   EnsemblGenomes-Tr; RPB_R0009-1.
DR   EnsemblGenomes-Tr; RPB_R0010-1.
DR   EnsemblGenomes-Tr; RPB_R0012-1.
DR   EnsemblGenomes-Tr; RPB_R0013-1.
DR   EnsemblGenomes-Tr; RPB_R0014-1.
DR   EnsemblGenomes-Tr; RPB_R0015-1.
DR   EnsemblGenomes-Tr; RPB_R0018-1.
DR   EnsemblGenomes-Tr; RPB_R0019-1.
DR   EnsemblGenomes-Tr; RPB_R0020-1.
DR   EnsemblGenomes-Tr; RPB_R0023-1.
DR   EnsemblGenomes-Tr; RPB_R0024-1.
DR   EnsemblGenomes-Tr; RPB_R0025-1.
DR   EnsemblGenomes-Tr; RPB_R0026-1.
DR   EnsemblGenomes-Tr; RPB_R0027-1.
DR   EnsemblGenomes-Tr; RPB_R0028-1.
DR   EnsemblGenomes-Tr; RPB_R0029-1.
DR   EnsemblGenomes-Tr; RPB_R0030-1.
DR   EnsemblGenomes-Tr; RPB_R0031-1.
DR   EnsemblGenomes-Tr; RPB_R0032-1.
DR   EnsemblGenomes-Tr; RPB_R0033-1.
DR   EnsemblGenomes-Tr; RPB_R0034-1.
DR   EnsemblGenomes-Tr; RPB_R0035-1.
DR   EnsemblGenomes-Tr; RPB_R0036-1.
DR   EnsemblGenomes-Tr; RPB_R0037-1.
DR   EnsemblGenomes-Tr; RPB_R0038-1.
DR   EnsemblGenomes-Tr; RPB_R0039-1.
DR   EnsemblGenomes-Tr; RPB_R0040-1.
DR   EnsemblGenomes-Tr; RPB_R0041-1.
DR   EnsemblGenomes-Tr; RPB_R0042-1.
DR   EnsemblGenomes-Tr; RPB_R0043-1.
DR   EnsemblGenomes-Tr; RPB_R0044-1.
DR   EnsemblGenomes-Tr; RPB_R0046-1.
DR   EnsemblGenomes-Tr; RPB_R0047-1.
DR   EnsemblGenomes-Tr; RPB_R0048-1.
DR   EnsemblGenomes-Tr; RPB_R0049-1.
DR   EnsemblGenomes-Tr; RPB_R0050-1.
DR   EnsemblGenomes-Tr; RPB_R0051-1.
DR   EnsemblGenomes-Tr; RPB_R0052-1.
DR   EnsemblGenomes-Tr; RPB_R0053-1.
DR   EnsemblGenomes-Tr; RPB_R0054-1.
DR   EnsemblGenomes-Tr; RPB_R0055-1.
DR   EnsemblGenomes-Tr; RPB_R0056-1.
DR   EnsemblGenomes-Tr; RPB_R0057-1.
DR   EnsemblGenomes-Tr; RPB_R0058-1.
DR   EnsemblGenomes-Tr; RPB_R0059-1.
DR   EnsemblGenomes-Tr; RPB_R0060-1.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2587559; 19020098.
DR   EuropePMC; PMC3406152; 22660709.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000250.
DR   SILVA-SSU; CP000250.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Caroline Harwood
CC   (csh5@u.washington.edu)
CC   Contact: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5331656
FT                   /organism="Rhodopseudomonas palustris HaA2"
FT                   /strain="HaA2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316058"
FT   gene            676..2094
FT                   /locus_tag="RPB_0001"
FT   CDS_pept        676..2094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04713"
FT                   /db_xref="GOA:Q2J497"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J497"
FT                   /protein_id="ABD04713.1"
FT                   /translation="MSNMEHDRWSRVKGRLRSSVGEDVYSSWFARMDLEAVQPESVHLS
FT                   VPTRFLKSWIQTHYSDKVLTCWQAELPEVCRIDLTVRSPMRAAVAKEAAAPVEHRRAEH
FT                   RPATETRSHATVPASSNHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRRGDP
FT                   VMFNPLYIHSGVGLGKTHLLQAVTWAGNTGIERKVLYLTAEKFMYGFVAALKTQTSLAF
FT                   KEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPSDLESLDERV
FT                   RSRLAGGLVVEMAPLGEDLRLGILKSRVVAARAHHASFDVPAPVLEYLARAITHNGRDL
FT                   EGAINRLLAHSKLNAQPVTLEMAEHEVRDLIRPQEPKRIKIEDIQRIVARQYNVSRSDL
FT                   LSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVSKDTT
FT                   LSDEVDSLKRQLQE"
FT   gene            2356..3474
FT                   /locus_tag="RPB_0002"
FT   CDS_pept        2356..3474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04714"
FT                   /db_xref="GOA:Q2J496"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J496"
FT                   /protein_id="ABD04714.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLSLK
FT                   ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGR
FT                   SRFTLQTLPESDFPDLAAGEMSHSFSLTASDVKRLIDRTQFAISTEETRYYLNGIYLHT
FT                   AGSAKDAKLRAVATDGHRLAQVDLTQPAGAAGMPGVIVPRKTVGEVQRLIEDNDAEIGL
FT                   ELSVGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEGE
FT                   VAVLRLADPGSPTLIQDRDKKNALYVLMPMRV"
FT   gene            3640..4011
FT                   /locus_tag="RPB_0003"
FT   CDS_pept        3640..4011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0003"
FT                   /product="Protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04715"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J495"
FT                   /protein_id="ABD04715.1"
FT                   /translation="MPQRPRHVSTPAKLRAFAKTMRHAPTDAESAMWKLLRDRRFAQLK
FT                   FRRQVPFQNYILDFVCFEQRLVIEIDGSQHAEQTRDQIRDATLLAAGFRVPRYWNNDVL
FT                   QRRTAVLEDILAKLSETDE"
FT   gene            4098..5234
FT                   /locus_tag="RPB_0004"
FT   CDS_pept        4098..5234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04716"
FT                   /db_xref="GOA:Q2J494"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J494"
FT                   /protein_id="ABD04716.1"
FT                   /translation="MTASRITRLTLTHFRNYRAAVLTTSAERVVLVGANGAGKTNCLEA
FT                   ISFLSPGRGLRRATLDDVADNEGDGSWAVAAEVEGALGLATLGTGIDPPRADAATSRRC
FT                   RIDREPVGSATAFGDHLRMVWLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSGRVSAL
FT                   DRSLRSRNRLLEVRYPDAHWLDAIERETAELAVAVAAMRGQTAMRLAAMLDARGAASAF
FT                   PSAKIMLDGWMESALLTEPATAVEDRYRTILREGRPRDAAAGRTLDGPHLTDLEVVYAP
FT                   KAMPARDASTGEQKALLIGLVLAHAQLVSEMTGITPLLLLDEVVAHLDPSRRAALFEEL
FT                   AKLGAQVWMTGADPAAFAEIGSGAEIFTVESGRIRPQQ"
FT   gene            5462..7903
FT                   /locus_tag="RPB_0005"
FT   CDS_pept        5462..7903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04717"
FT                   /db_xref="GOA:Q2J493"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J493"
FT                   /protein_id="ABD04717.1"
FT                   /translation="MTEPARQPIAETPSPVPAEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHATAVEVVLNADGSVTVRDDGRGIPVDIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLVLRVWRNGKEHIIEFAHG
FT                   DAVAPLSVVGDANGRRGTEVTFFASPETFTHIEYDFATLEHRLRELAFLNSGVNIVLSD
FT                   MRHPVEKREEMRYEGGVTEFVKYLDRNKKPMVPAPIVLAADLNGIGVEAALWWNETYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRAALTRQVNGYADSNAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPAEAKVIVGKVIEAAAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPSKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLGSEQIGTLITALGTGIGRDDFDIAKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPALIEGGFLYIAQPPLYKVTRGKSEQYLKDERALEEYLIATGL
FT                   DDCAFKIASGEVRGGRDLLALVEDARVIRQTLHNLHGRYNRSVVEQAAIAGVLSPRITS
FT                   DVATANEAAAYIARRLDALADEVERGWIGRFVEGEGFHFERTVRGVKDVAMIDDALLGS
FT                   ADARKLDEYAAVLQEVYPRPGVLRRKDAETAIHGPVSLFEAVTDAGRKGVALQRYKGLG
FT                   EMNPSQLWETTLDTNARSLLQVKVREVDEADDIFTKLMGDVVEPRREFIQENSLSATVD
FT                   V"
FT   gene            complement(7925..9004)
FT                   /locus_tag="RPB_0006"
FT   CDS_pept        complement(7925..9004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0006"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04718"
FT                   /db_xref="GOA:Q2J492"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J492"
FT                   /protein_id="ABD04718.1"
FT                   /translation="MQTAVIRRDGSADQVASADHDDISALVARLTSEVNEIACGKTKSI
FT                   QKITSQMKILALNALIESARAGKQGAGFAIVAQEVRNVGAQIEEIARDLESQLTKRTGE
FT                   LISSIGSMTERSRGDRLVDLSLNAVELIDRNLYERTCDVRWWATDSAVVDCAAKPDAAS
FT                   ASYAGERLAVILGAYTVYLDLWLCGLDGTILANGRPGRFGVVGSSVAGCDWFKEALRLR
FT                   SGDDYVAGNVERMPQLGNAQVATYCASVRSDGRSTGAPLGILAIHFDWEAQARAIVQGV
FT                   RLDPQDNARVLLLDSRFRVIAASDGSGLLEERFPLKVAGQRSGTYRDASGAMVGFHLTP
FT                   GYETYRGLGWYGVIVSRAE"
FT   gene            complement(9197..9706)
FT                   /locus_tag="RPB_0007"
FT   CDS_pept        complement(9197..9706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0007"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04719"
FT                   /db_xref="GOA:Q2J491"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J491"
FT                   /protein_id="ABD04719.1"
FT                   /translation="MSDADVPVAETVRRLDAIDRKILTVLQQDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLEADGVITRRVALVDQDKIGLGLSVFVSIESGDHSEAWLKTFADAVSAMP
FT                   EVIEFYRMAGDVDYMLRVVVADMRAYDVFYKRLISTVPLKNVTSRFAMEKIKSVTALPV
FT                   PPMSAA"
FT   gene            complement(9854..10132)
FT                   /locus_tag="RPB_0008"
FT   CDS_pept        complement(9854..10132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04720"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J490"
FT                   /protein_id="ABD04720.1"
FT                   /translation="MPRTFASQVAASEAPATQAGSQSASKAFIIEVNSRAAGIVVRDGR
FT                   GFRFHAATDDFTGLEGRGFRSPGDAHKAAQRLLDSLRLGRSMKFGAA"
FT   gene            complement(10273..10476)
FT                   /locus_tag="RPB_0009"
FT   CDS_pept        complement(10273..10476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04721"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J489"
FT                   /protein_id="ABD04721.1"
FT                   /translation="MAMFTYSDSDALIRPKPAPVETRPEPATDEDADTRWLRSLSLPHR
FT                   SFVRFYRALRKLQPMFPPLSCC"
FT   gene            complement(10492..10656)
FT                   /locus_tag="RPB_0010"
FT   CDS_pept        complement(10492..10656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0010"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04722"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J488"
FT                   /protein_id="ABD04722.1"
FT                   /translation="MVFLVPLALMLGLLGLAAFLWSLKSGQYEDLDGAAWRAISDDDQT
FT                   PRPPAKEPA"
FT   sig_peptide     complement(10573..10656)
FT                   /locus_tag="RPB_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.305 at
FT                   residue 28"
FT   gene            complement(10656..12851)
FT                   /locus_tag="RPB_0011"
FT   CDS_pept        complement(10656..12851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0011"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04723"
FT                   /db_xref="GOA:Q2J487"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J487"
FT                   /protein_id="ABD04723.1"
FT                   /translation="MLMTRDFSHYVKDVDPQTAHLDLAVEGVSCAGCMAKIERGLSAIP
FT                   DVTLARVNLTDRRLAVEWKKGAVEPALFIDRLAELGYKAYPYEPVRAEVEETERSKFLL
FT                   RCLGVAAFATMNVMMLSVPVWVGGDLSPEARDFFHWLSALVVLPCAAYAGQPFFQSAWR
FT                   ALKAKSVNMDVPITIGVVLALGMSLVETINHAEHTYFDAAIMLIAFLLAGRFLDQKMRQ
FT                   KTRAVAGNLAALKAETATKFVGPDEISEVPIAAVRAGDLVLLRPGERCAVDGSVVEGRS
FT                   EIDQSLITGETLYVKAERGTQVYAGTLNISGTLRVRVSAASEGTLLAEITRLLDHALQA
FT                   RSRYVRLADRASQLYAPVVHATALLTVIGWVLAGASWHDAIVIGIAVLIITCPCALGLA
FT                   IPAVQTVASGAMFRAGVLLNAGDAIERAAAVDTVVFDKTGTLTLPELDVVNGAGVPDEV
FT                   FQLAGRLALASHHPVAAAVARAAQAKAPLPGVTEEPGRGVRALFEGEELRLGSPAFCGA
FT                   DAEANAILSADPEVSVVAFSRGDRHTVFAVRQLLRPDAARTIDALLNRGIAVELLSGDR
FT                   EPAVRHAADALGVSAWRAGVTPAEKIAHIEALKAQGRVVMMVGDGMNDAPSLAAAHVSM
FT                   SPISATHLSQATADLVFLGKELAPVLAAIDYSRKAMAVMRENLTLAIGYNVLAVPIAIA
FT                   GLATPLIAALAMSGSSILVMLNAMRARRVRLGGASWK"
FT   gene            complement(12887..13387)
FT                   /locus_tag="RPB_0012"
FT   CDS_pept        complement(12887..13387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0012"
FT                   /product="FixH"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04724"
FT                   /db_xref="GOA:Q2J486"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J486"
FT                   /protein_id="ABD04724.1"
FT                   /translation="MTRPTSKPRQLTGKVVFVSLVAFFGVVFGVNGLMMALAIKTLPGT
FT                   EVDSAYAASLAYESEIAAARDQEKRGWKVDARVERRPDGRATLRVEARDRAGLPLSGLT
FT                   FFGRLERPADKAGDHDVVLAETASGVFQGDATGVAPGRWDLVLEGDQNGNRMFLSKNRL
FT                   TLN"
FT   sig_peptide     complement(13298..13387)
FT                   /locus_tag="RPB_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.911) with cleavage site probability 0.844 at
FT                   residue 30"
FT   gene            complement(13407..14954)
FT                   /locus_tag="RPB_0013"
FT   CDS_pept        complement(13407..14954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0013"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04725"
FT                   /db_xref="GOA:Q2J485"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J485"
FT                   /protein_id="ABD04725.1"
FT                   /translation="MLGGTRGSTDAPAAESRRGDETKKNPEMNKPLRDTDLVPDDDGGP
FT                   LYAAGKKIYPQRVSGSFRRIKWILMAVCLGIYYFLPFVRWNRGLGAPDQAVLIDLANNR
FT                   FYFFFIELWPQEIYYFTGLLIVAAITLFLMNALGGRVWCGYLCPQTVWTDLFFAVERLV
FT                   EGDRRERMRKAEEGWSLQRGSELVLKHSIWLMIAWWTGGAWVLYFADAPTLIKDLVTFQ
FT                   APMVAYIWIGILTFTTYTLAGFMREQVCVYMCPWPRIQAALTDEWALNVTYKYDRGEQR
FT                   TSLKKAAQARALGEQVGDCVDCNQCVAVCPTGIDIRNGPQLDCIQCGLCIDACDNVMTK
FT                   IGRPTRLIGYDNDINIHRRMEGKPEIFKPLRARTVVYSALIAGIGAIMLYALLNRSLLD
FT                   LNVLHDRNPVAVRLSDGSIRNGYTIRFLNKRGFDRVIAVDVSGPPNAVIHIVGADSIVP
FT                   DRPMIILARDATTELRVLVDSRPSSEEDLAPSTPVAFHVTDIGLGEVASAKDVFVKP"
FT   gene            complement(14983..15864)
FT                   /locus_tag="RPB_0014"
FT   CDS_pept        complement(14983..15864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0014"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04726"
FT                   /db_xref="GOA:Q2J484"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J484"
FT                   /protein_id="ABD04726.1"
FT                   /translation="MADHAHHAEIDKVTGTSTTGHEWDGIKELNTPLPRWWIWTFYACI
FT                   VWSLGYFLVYPAWPLVNGYTTGFFNYSSRAELAVDLAKLDVVRGDKMAALATAPLADIE
FT                   KDPALLALARAKGKVVFGDNCAACHGSGGAGAKGYPNLNDDDWLWGGTLEQIEKTLLYG
FT                   ARSGHDDAHQGNMPAFGKDGLLEKDQIVQLANYVRSLSGLSVRPGTDLAAAKQLFADNC
FT                   SSCHGDEAKGNVELGAPNLTDRIWLYGSDEATLIETMTNGRGGVMPAWNERLDPATIKA
FT                   MAVYVHSLGGGK"
FT   gene            complement(15872..16036)
FT                   /locus_tag="RPB_0015"
FT   CDS_pept        complement(15872..16036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0015"
FT                   /product="Cbb3-type cytochrome oxidase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04727"
FT                   /db_xref="GOA:Q2J483"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J483"
FT                   /protein_id="ABD04727.1"
FT                   /translation="MKAILSVENFVSSFVTMWWTPLFVVIFLAIVAYALWPQNKAEFDA
FT                   AARMPLRED"
FT   gene            complement(16046..16780)
FT                   /locus_tag="RPB_0016"
FT   CDS_pept        complement(16046..16780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0016"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04728"
FT                   /db_xref="GOA:Q2J482"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J482"
FT                   /protein_id="ABD04728.1"
FT                   /translation="MSFWNRHKIFETNSIILIVGILLVISIGGLVEILPLFYLKSTIEK
FT                   VDGMRPYTPLELAGRNIYIREGCYLCHSQMIRPLRDEIERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGGKYSDDWHVAHLRDPRSIVPQSVMPAYAFLGKTTVDGASLSDHLRTN
FT                   RTLGVPYSEEDVAKAAEDLKTQVDPDSAGAADLLKRYPKAVVRNFDGQDGAPTELDALV
FT                   AYLQMLGTLVDFKLYNEKANLR"
FT   gene            complement(16792..18438)
FT                   /locus_tag="RPB_0017"
FT   CDS_pept        complement(16792..18438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0017"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04729"
FT                   /db_xref="GOA:Q2J481"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J481"
FT                   /protein_id="ABD04729.1"
FT                   /translation="MNQALTSKRITFGEGGLTLVFTLTTALCIYASIFAKDAPFAFHAA
FT                   LGAAVSAWAVFAIITRYSRRTGVPPQEINGVPNYNLGPIKFLSFMAMFWGIAGFSVGLY
FT                   IALELAYPGLNVAQWVNFGRLRPLHTSAVVFAFGGNVLLATSFYVVQRTTRARLAGDLA
FT                   PWFVAIGYNFFIVIAGTGYLLGVTQSKEYAEPEWYADLWLTIVWVTYLLVFVATLMKRK
FT                   EPHIYVANWFYLAFILTIAVLHLGNNPTLPVSLLGSKSYIAWAGVQDAMFQWWYGHNAV
FT                   GFFLTAGFLAIMYYFIPKRAERPVYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDWTQ
FT                   TLGMTFSIMLWMPSWGGMINGLMTLSGAWDKLRTDPVLRMMVVSVAFYGMSTFEGPMMA
FT                   IKAVNSLSHYTDWTVGHVHSGALGWVGFVSFGALYCLVPWIWGRKELYSLRLVNWHFWI
FT                   ATLGIVLYISAMWVSGILQGLMWRAYTSLGFLEYSFIESVEAMHPFYAIRAAGGGLFLI
FT                   GALIMAYNLWMTVRVGESSEAQPRVALQAAE"
FT   sig_peptide     complement(18331..18438)
FT                   /locus_tag="RPB_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.801) with cleavage site probability 0.755 at
FT                   residue 36"
FT   gene            complement(18787..19707)
FT                   /locus_tag="RPB_0018"
FT   CDS_pept        complement(18787..19707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0018"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04730"
FT                   /db_xref="GOA:Q2J480"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J480"
FT                   /protein_id="ABD04730.1"
FT                   /translation="MRILIVGAGAIGGYFGGRLLQIGRDVTFLVRPKRADELARDGLVI
FT                   KSPHGDLTIPHPPVVQADGLAPDYDLVLLSCKAFDLDDAIASFAAGVGPQTVVLPLLNG
FT                   MKHLDVLDAAFGRARVLGGQCVIAATLDAQRHVVQLAPMNAITFGERDGGLSDHVGAIA
FT                   RTLGGSSFEVNPSAEIMQEMWEKWVFLASLAGSTSLMRAAVGDILAAPGGADFMLGVVD
FT                   EISAIAAVAGHPPREAFLERARGALLAKGSALTASMFRDIQAGARIEADHVIGDLIARG
FT                   DAAKRPVARLRVIYTHLKAYERQRG"
FT   gene            complement(19785..20522)
FT                   /locus_tag="RPB_0019"
FT   CDS_pept        complement(19785..20522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0019"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04731"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J479"
FT                   /protein_id="ABD04731.1"
FT                   /translation="MTPRNATVAVIGAGDYIGAEIARKFAAEGFTVFAGRRDGAKLEPL
FT                   VREIEAAGGRIVARTLDARKEDEVAAFLDAADAHAPLDVTIFNVGANVNFPILETTDRV
FT                   FRKVWEMACWAGFLAGRESARLMLPRGRGNIFFTGATASLRGGSGFAAFASAKFGLRAV
FT                   AQSMARELMPQNIHVAHLIIDSGVDTAWVRERREQLWGKQALDNPDLLMPPASVAGAYW
FT                   QLYQQPKSAWTFEMEIRPFGEKW"
FT   gene            complement(20675..21277)
FT                   /locus_tag="RPB_0020"
FT   CDS_pept        complement(20675..21277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0020"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04732"
FT                   /db_xref="GOA:Q2J478"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J478"
FT                   /protein_id="ABD04732.1"
FT                   /translation="MTQPAPQFLFDFGSPNAFLSHRAIPAIERRIGVTFDYVPVLLGGI
FT                   FKATNNKSPAETLAGVRNKREFMALETERFLKRFGVTPYVWNPNFPVNTLNLMRAAVAA
FT                   QRDGVLAQYVDAAFHHMWVEPKKMDDPQIAAQALASSGLDAEKLFAGAQEPEIKAKLIA
FT                   NTEDAVARGVFGSPTFFVGAEMFFGKEQLRDVEEMYG"
FT   gene            21526..22194
FT                   /locus_tag="RPB_0021"
FT   CDS_pept        21526..22194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0021"
FT                   /product="Glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04733"
FT                   /db_xref="GOA:Q2J477"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J477"
FT                   /protein_id="ABD04733.1"
FT                   /translation="MITVHHLNNSRSQRVLWLLEELGLPYEIKRYQRQPDMMAPKELRA
FT                   VHPLGKSPVITDAGNTVAESGAIITYIVETYGDGRLIPPPKTPERLRYTYWLHYAEGSA
FT                   MSPLLLKLLFTMMPQRAPALLRPLVKLVAGGALTGFVDPQLKQHMAFWESELAKSDYFA
FT                   GADFTAADIQMSFPLEAAASRAGLDQTYPNAQAWLARIHARPAYKRALEKGGPYEIGKA
FT                   "
FT   gene            complement(22420..23301)
FT                   /locus_tag="RPB_0022"
FT   CDS_pept        complement(22420..23301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0022"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04734"
FT                   /db_xref="GOA:Q2J476"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J476"
FT                   /protein_id="ABD04734.1"
FT                   /translation="MSSLAGKTLFITGASRGIGLAIALRAARDGANVAIAAKTAEPQPK
FT                   LKGTIYTAADEIRAAGGQALPLICDIRDEAQVIAAIDKTVAEFGGIDICVNNASAISLT
FT                   NSQATDMKRYDLMMGINSRGTFMVSKYCIPHLKKAANPHILMLSPPLDMKAKWFAASTA
FT                   YTMAKFGMSMVVLGLSGELKGAGIAVNALWPRTTIATAAVGNLLGGDAMMRASRTPEIM
FT                   GDAAHAILTKPSRDFTGQFCIDDKVLYEAGVTDFERYRVDPSVPLMSDFFVPDDDVPPP
FT                   GVTVASLPGAKG"
FT   gene            complement(23383..23877)
FT                   /locus_tag="RPB_0023"
FT   CDS_pept        complement(23383..23877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0023"
FT                   /product="Protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04735"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J475"
FT                   /protein_id="ABD04735.1"
FT                   /translation="MIRYTLRCDRGHSFESWFQSSSAYDSQVRRKLVECPSCGSVKVEK
FT                   AIMAPQIVGKKGRGRAPEPVTSEPAVGEASEPMTSEPSATPLMLAQERELRAKLKELRD
FT                   HIVKTADNVGERFPNEARKMHYGDIEHRPIFGEASPAEAKALIEEGIEVAPLPVLPEDR
FT                   N"
FT   gene            complement(23874..24752)
FT                   /locus_tag="RPB_0024"
FT   CDS_pept        complement(23874..24752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0024"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04736"
FT                   /db_xref="GOA:Q2J474"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J474"
FT                   /protein_id="ABD04736.1"
FT                   /translation="MTETAPFNAALVQMRTGLLPGPSLEQGTKLIREAAAAGADYVLTP
FT                   EVSNMMQLNREALFDQLADEDSDVSLKAYRDLARELKIHLHIGSLALRASPDRAVNRSF
FT                   LIDPSGTILASYDKIHMFDIDLGNGESYRESANYQPGETAVISDLPWGRIGLTICYDVR
FT                   FPALYRALAEAGASFISVPAAFTRPTGEAHWHVLLRARAIENGCFVFAAAQGGLHENKR
FT                   ETYGHSLIIDPWGVVLAEGGVDPGFVMARIDPAEVGKARGKIPSLQHGRRFTLVDAKAT
FT                   PDYLHLVREQT"
FT   gene            complement(24749..25024)
FT                   /locus_tag="RPB_0025"
FT   CDS_pept        complement(24749..25024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0025"
FT                   /product="Glutaredoxin, GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04737"
FT                   /db_xref="GOA:Q2J473"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J473"
FT                   /protein_id="ABD04737.1"
FT                   /translation="MSAAIEIFTRPGCGYCSAAKSLLNRKKAAFTEYDVAVDPAHRKTM
FT                   DARTYPGSTYPQIFIGGTHVGGCDDLYALDREGKLDALLAGEKATS"
FT   gene            complement(25063..25827)
FT                   /locus_tag="RPB_0026"
FT   CDS_pept        complement(25063..25827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0026"
FT                   /product="Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04738"
FT                   /db_xref="GOA:Q2J472"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J472"
FT                   /protein_id="ABD04738.1"
FT                   /translation="MQAVGAVRRLWSRAAHLALDVALPTLCVACREPVAGEGLCPQCWS
FT                   QLSFIAPPYCEKLGIPFVYDPGPGILSMQAIADPPAYARARAAVRYDEVAKTLVHALKF
FT                   HDRIDLAPTMGRWMAHAGAPLLADADLLIPVPLHWRRGFARRYNQSGALARAIGRQTQL
FT                   PVAIEALKRVRPTAHQIGLSRAERAANVQGAFKVPAERKAEVQGRRIVLVDDVLTSGAT
FT                   VDACARALLRAKAQSVDVLVFARVVDTLKSPI"
FT   gene            25947..26294
FT                   /locus_tag="RPB_0027"
FT   CDS_pept        25947..26294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J471"
FT                   /protein_id="ABD04739.1"
FT                   /translation="MAHKGDTRRATREIAVSESNDKSADIINYVDIPTASHVYFDIAPA
FT                   HGVMANNVEIELAARTLNPLSDGSVEVKFVTTARLRCSQAGALHLRNALDAVLKMFEAS
FT                   QQSPAAASKLN"
FT   gene            26356..27189
FT                   /locus_tag="RPB_0028"
FT   CDS_pept        26356..27189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04740"
FT                   /db_xref="GOA:Q2J470"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J470"
FT                   /protein_id="ABD04740.1"
FT                   /translation="MTEPTPILFDRRLLAARLARARALGPAPFLLDRITEEMAERLHAV
FT                   LRDFNAIADIWTPGDALPAERFPNVRHVDIDPSGDEALNLAPGSLDLAVSALGLQFAND
FT                   LPGVLAQIRRALKPDGLLLAALTGGDTLTELRQAFAAAEAEIEGGVSPHVAPTADLRDL
FT                   GALLQRAGFALPVTDVDRVVVRYDHAFALMQDLRRMGAGNVLIERRRTPLRRATLARMA
FT                   NIYAERFADPDGRIRATFEIIWLSGWSPHDSQQQPLKPGSAKASLAEAVKRLGTK"
FT   gene            complement(27426..27839)
FT                   /locus_tag="RPB_0029"
FT   CDS_pept        complement(27426..27839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0029"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04741"
FT                   /db_xref="GOA:Q2J469"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J469"
FT                   /protein_id="ABD04741.1"
FT                   /translation="MTKSIKLLLVVAVALIDADNRVLIAQRPKHKQLGGLWEFPGGKVD
FT                   PGERPEAALIRELDEELGITVKEACLAPLTFASHAYEDFHLLMPLYVCRRWDGQVMPRE
FT                   GQELAWVRANKLRDYPMPPADIPLIPPLIELLM"
FT   gene            complement(27958..29199)
FT                   /locus_tag="RPB_0030"
FT   CDS_pept        complement(27958..29199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0030"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04742"
FT                   /db_xref="GOA:Q2J468"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J468"
FT                   /protein_id="ABD04742.1"
FT                   /translation="MSSKVSPLAPTNVPTLPELAGVRLATAAAGIRYKNRTDVLLVALD
FT                   PGTSVAGVFTTSKCPSAPVEWCRDNLKGGTARVLVVNSGNANAFTGKTGRKATTLTASI
FT                   AAKATGCKPAEVFLASTGVIGEPLDATKFEGVLGTLAETAQPGGWLDAAKAIMTTDTFP
FT                   KVATKTVKLGKAKVTINGMAKGAGMIAPDMATMLSFIFTDAPLSASCLQALLKAGVADT
FT                   FNAVTIDGDTSTSDTLLAFATGAAAKNGAPKISRASDPRLTAFVKAFNAVLADLAEQVA
FT                   RDGEGARKLVEIIVDGAVSKASARKIALSIANSPLVKTAIAGEDANWGRVVMAVGKAGE
FT                   PADRDKLSIAFNGIRVAKAGARDPSYDEKEVSAAMKQPEIQIKVGLGLGKGRDRVLTCD
FT                   LTKEYVAINGDYRS"
FT   gene            complement(29453..29962)
FT                   /locus_tag="RPB_0031"
FT   CDS_pept        complement(29453..29962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0031"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04743"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J467"
FT                   /protein_id="ABD04743.1"
FT                   /translation="MDAATLRATQAPLKERFKSDPAAALITLTAKGAVDGPGIACRLET
FT                   GRGPAQAGLHPSAGGSGLDLCSGDMLLEALVACAGVTLKTVATAIELPLTDGRVTAEGD
FT                   LDVRGALGIDKDAPVGFRDIRLRLEVATDAPQDQLDLLLKLTERYCVVYQTIKNGPKVS
FT                   VSLERV"
FT   gene            30131..32929
FT                   /locus_tag="RPB_0032"
FT   CDS_pept        30131..32929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0032"
FT                   /product="UTP-GlnB (protein PII) uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04744"
FT                   /db_xref="GOA:Q2J466"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J466"
FT                   /protein_id="ABD04744.1"
FT                   /translation="MDKVVTPQRPAADERFDTTRITADIAALAGQHAGNEPTFRTALAQ
FT                   LMKAELAKARAAAEAQLLRDRHGRRCAEHLCFVQDEIIRLLFMAATQYLYNSPTPSSSE
FT                   RMSVVATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEVILYCLWDIGLKVGHATRS
FT                   VDESIRQARADMTIRTAILETRFLTGDKALYQELVDRFDKEVVEGTAAEFVTAKLAERE
FT                   ERHRRSGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVRGTSELLEHGVFDQIEFRT
FT                   FRRCEDFLWSVRCNLHFVTRRAEERLSFDLQREIGVRLGYTSHPGMQDVERFMKHYFLI
FT                   AKKVGNLTAILCAKLEDQQAKPAPALSRMMARLRPGATRRRVPESDDFVIDNNRINCAM
FT                   PDVFKHDPVNLIRIFRLAQKNNLAFHPDAMRTVTRSLALINAQLRDDPEANRLFIEILT
FT                   SDNAEQVLRRMNETGVLGRFIRAFGRIVSMMQFNMYHSYTVDEHLLRCVGNLQEIERGG
FT                   NDEFILSSDLIRKIRPDHRAVLYVAVLLHDIAKGQPEDHSTAGAKVARRLCPRFGFNAA
FT                   DTELIAWLIDKHLVMSTVAQSRDLSDRKTIENFAAVVESVEQMKLLTILTTADIRGVGP
FT                   GVWNGWKAQLLRTLYYETEPVLTGGFSEVNRAERIRGAQAEFRANFTEWPAAELDAYVA
FT                   RHYPAYWLKVELARKIRHARFLRASEQAGHKLAVNVGFDEARGVTELTILAVDHPWLLS
FT                   IIAGACASAGANIVDAQIYTTTDGRALDTISISREYDRDEDEGRRATRIGEMIEEVLEG
FT                   KLRLPEAVARRATNGRAKLRAFVVEPEVSINNNWSDRYTVIEVSGLDRPGLLYQLTTAI
FT                   SKLNLNIASAHVATFGERARDVFYVTDLLGAQITAPTRQAAIKRALVHLLANGDAEQQP
FT                   AA"
FT   gene            33043..33582
FT                   /locus_tag="RPB_0033"
FT   CDS_pept        33043..33582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0033"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04745"
FT                   /db_xref="GOA:Q2J465"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J465"
FT                   /protein_id="ABD04745.1"
FT                   /translation="MRFSAPARHIDSMLPFWQYTVMTDEAHAPFDHPANALVLEVFRLN
FT                   GALIRFGDALVKPLGLSSARWQVLGSIAHGRGTFSVARLADNMGLARQSVQRIVDELAE
FT                   AGLVGFEANPAHKRAKLVVMTPRGERAFARATDLWRPVADAMAGGLAARDLRKTIDNLA
FT                   ALRGRLEDQSENGSSA"
FT   gene            33579..34025
FT                   /locus_tag="RPB_0034"
FT   CDS_pept        33579..34025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04746"
FT                   /db_xref="GOA:Q2J464"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J464"
FT                   /protein_id="ABD04746.1"
FT                   /translation="MIRTLHPVAGIIAFVTILCFWLSTVVVELGGDQASIAAVKRAILW
FT                   GLVLLVPAIALAGASGFRLGGKSQHPDIARKRKRMPVIAFNGIVVLVPCAIFLQQRAAA
FT                   GLFDQTFTVVQAIELIAGAINLALLGLNIRDGFRLSHRFAPARA"
FT   gene            complement(34035..36800)
FT                   /locus_tag="RPB_0035"
FT   CDS_pept        complement(34035..36800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0035"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04747"
FT                   /db_xref="GOA:Q2J463"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J463"
FT                   /protein_id="ABD04747.1"
FT                   /translation="MRLSVRLTLAMTALVLCAVAAVGVLAYYNIGRAVVPAELTRLAGQ
FT                   AKARLGAFDSILRVLHNEILAARTLPGHQGIVRAVLNGGVDPQDHFTSAKWLSHLGDVY
FT                   AGQMSVKPSIVRFSLIGVADGGRELLSVDRAGPDGDIRVVPADELERVGDDELFERTLA
FT                   LPPEQDVYASPIRAGPGRHGDTAPVPMISISALLRAPSGAPFGVLVLDFDLRPTFERIR
FT                   AALDDTTKVYFVGADGRYLLDLLDGRVTPSGQTGRWQDDYPDLAKALADKQGTATVLTA
FT                   PDGKRVGAAIVTAPLVGGLRVGVIETQDFRKIIAPATALENTSITVALVAALVAVLLSA
FT                   LLSRSLARPVAQITAAVAGFTRSGRLALPTGLSGEPKILAAAFAQMVEEIDKATAALRA
FT                   KSEVLDKTIASMADAVLVIDAEGRRVFANPPANAIFGDFRDIGSETWRREYQRFRADGV
FT                   TPMAETECPARRASQGEGFDNVEIGIRRDGGPLLQLAASARTMQKADGSFDGAVIVYRN
FT                   VTALKETERQLRQAQKMQAIGQLTGGVAHDLNNILTVLTGGIEILAEGVSDRPALRDVA
FT                   LMVDQAVTRASDLTNGLLSFARKQPLQPRSIDVNALMQETARLLRSTLGGDIEVEFEPA
FT                   PGLRPALADSSQLSSALINLAINARDAMPRGGTLRLAAGNADLDQRYADQHDEVVAGRY
FT                   VVLAVTDTGIGIPAAIRDRVFEPFFTTKAVGEGTGLGLSMVYGFVKQSNGHIEISSNEG
FT                   AGTTVRLYLPCAAAQDDAADADAPRQAQGGRETILVVEDDVLVRSYVMTDLAGLGYTAH
FT                   GAATAAEAMVLVYDELEFDLLFTDVMLSGGIDGRQLADALRKHRPGLKVLFTSGYSGGA
FT                   SRPQADRTDGSLMLAKPYRRAELARMLRLALDGEAASAPANDGDVRLRGT"
FT   sig_peptide     complement(36720..36800)
FT                   /locus_tag="RPB_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.660 at
FT                   residue 27"
FT   gene            complement(36947..37375)
FT                   /locus_tag="RPB_0036"
FT   CDS_pept        complement(36947..37375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04748"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J462"
FT                   /protein_id="ABD04748.1"
FT                   /translation="MSGHIDPTKEVFAQFRDNDREGPIHMLNLVRLKPRAAYPDGRAAS
FT                   GAEAYAAYGRESQPVFSRLGGKVVWQGAFELMLIGPQQEHWDHVFIAEYPSVAAFVEMI
FT                   RDPAYREAVKHRQAAVEDSRLIRLKPLPAGGGFGQIPD"
FT   gene            37459..37827
FT                   /locus_tag="RPB_0037"
FT   CDS_pept        37459..37827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0037"
FT                   /product="Protein of unknown function DUF1304"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04749"
FT                   /db_xref="GOA:Q2J461"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J461"
FT                   /protein_id="ABD04749.1"
FT                   /translation="MNAVANTLIALVAALHVYFLILEMFLWTRPLGLKTFRNTPEKAAS
FT                   SAVLAANQGLYNGFLAAGLIWSLLHPDPVVALQLATFFLGCVIVAGLYGGWSVSKRILY
FT                   VQAAPAALALILVWLARA"
FT   gene            37966..39186
FT                   /locus_tag="RPB_0038"
FT   CDS_pept        37966..39186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0038"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04750"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J460"
FT                   /protein_id="ABD04750.1"
FT                   /translation="MKSLIQAATAAVAAIVLTAAPAAAQKKYDTGATDTEIKIGQTVPF
FT                   SGPASAYAGIGKTQAAYMRMINDAGGINGRKINLIQYDDAYSPPKAVEQVRKLVESDEV
FT                   LLTFQIIGTPSNAAVQKYLNQKKVPQLLAATGATRFTDPKNFPWTMGYNPNYQTEGRIY
FT                   ARYILKNHPDAKIGVLFQNDDLGRDYVTGLRAGLGDKADKMIVAETSYELTDPTVDSQI
FT                   VKLKSAGATLLYDASTPRFAAQAIKKVADLGWNPVHILDINASPVSATLKPAGLDISKG
FT                   IISVNYGKDPADPQWADDPGVKKYFAFMDKYYPEGDKMNTVNSYGYSTAELLITILKQC
FT                   GDNLTRDNIMKQAANLKNVTLDLSLPGMSINTSPTDFRVNKQLRMMKFNGERWELFGPI
FT                   IEDDAAM"
FT   sig_peptide     37966..38040
FT                   /locus_tag="RPB_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 25"
FT   gene            39440..39697
FT                   /locus_tag="RPB_0039"
FT   CDS_pept        39440..39697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04751"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J459"
FT                   /protein_id="ABD04751.1"
FT                   /translation="MLDVDDFGSAAARGEITMRAEPSRYFTVEQLEELAVAKYIEAALT
FT                   PEGDEREELLQEAKRFASRAKMKSWLMGEMGIAPPRRDYH"
FT   gene            complement(39741..39992)
FT                   /locus_tag="RPB_0040"
FT   CDS_pept        complement(39741..39992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04752"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J458"
FT                   /protein_id="ABD04752.1"
FT                   /translation="MSRVLKTAEEIEILLLQDVRQQRHCDKVEAIRICPCPPDDDSNGA
FT                   NWKVASVDPGQASREFAGAAVMIAMDRLQREVSVGSEG"
FT   gene            40187..42394
FT                   /locus_tag="RPB_0041"
FT   CDS_pept        40187..42394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0041"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04753"
FT                   /db_xref="GOA:Q2J457"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J457"
FT                   /protein_id="ABD04753.1"
FT                   /translation="MAVGKKKAGERREPKFGLADSLSGLRLNPQDRISVADDDRPKKPR
FT                   AAKAQPARSSGGGGSRKPRGKSRSKGGLRRLVTRTVYWTAVAGIWAVLAVVGLMVWVGA
FT                   HLPPIQSLEIPKRPPTITIVAADGSQLAVRGEMAGTNVALKELPPYLPKAFIAIEDRRF
FT                   YQHFGVDPIGIGRAAIANVLHRGVSQGGSTLTQQLAKNLFLTQDRTLMRKLQEVELALW
FT                   LERKHSKAEILELYLNRVYFGSGAYGIEAASQKYFGKSAKDVTLVEAAMLAGLVKSPSR
FT                   LAPNRNPEGAEKRAQLVLAAMADADFITDKQARTAIANPVYTVKPTGAGTINYVADWIG
FT                   EVLDDLVGQIDQSIVVETSIDPKLQAEAEAAIIDELAAKSVKFKVSQGALVAMTPDGAV
FT                   RAMIGGRNYAESQFNRAVTAKRQPGSAFKPFVYLTAIEAGLTPETIRQDAPLDVKGWRP
FT                   ENYTHEYFGSVTLTQALSMSLNTVAVRLGLEVGPKNVVRTAHRLGIASKLEANASIALG
FT                   TSEVSVLELVGAYAPFANGGLAASPHVVDRIRTASGNKLLYARPNDPPNRVVDARAVAM
FT                   MNTMMRETLQSGTAKKADVPGWTAAGKTGTSQDFRDAWFIGYTGTLVTGVWLGNDDNSP
FT                   TRKATGGGLPVDVWTRFMREALKGTAPQPLPGGGWSGGPLVAGSPSAGGTIAQAGPRGE
FT                   TQIVNIPAASGAARPQPARANVRPEADSGLDGWLMDRLFGR"
FT   gene            complement(42525..42956)
FT                   /locus_tag="RPB_0042"
FT   CDS_pept        complement(42525..42956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04754"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J456"
FT                   /protein_id="ABD04754.1"
FT                   /translation="MTSSACSHSGPPNRGIARTGLLAAAAVLALALVAVSGDAEAAKRR
FT                   ASVGHFDGTWNVVFATRAGNCSPTYSAPFAVQGRRVASAGGGKVTGGITGGGNVAVRLS
FT                   VGASVANGRGRLSGNSGTGIWSGLIQGDRCRGVWQATRG"
FT   sig_peptide     complement(42846..42956)
FT                   /locus_tag="RPB_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.495 at
FT                   residue 37"
FT   gene            43356..43556
FT                   /locus_tag="RPB_0043"
FT   CDS_pept        43356..43556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0043"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04755"
FT                   /db_xref="GOA:Q2J455"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J455"
FT                   /protein_id="ABD04755.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVMSAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVIFKTDGDNIKKYFLPNA"
FT   gene            43644..44003
FT                   /locus_tag="RPB_0044"
FT   CDS_pept        43644..44003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0044"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04756"
FT                   /db_xref="GOA:Q2J454"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J454"
FT                   /protein_id="ABD04756.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKAAKGFRGRRKNTIRAAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRINAAVRPFGMTYSVFINGLSKSGIVVDRKVLSDLAITEPA
FT                   AFQAIAEKAKAALAA"
FT   gene            44142..45266
FT                   /locus_tag="RPB_0045"
FT   CDS_pept        44142..45266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0045"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04757"
FT                   /db_xref="GOA:Q2J453"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J453"
FT                   /protein_id="ABD04757.1"
FT                   /translation="MTDERPVLHPRRIAMTDLSTLQSQILSDIAAASDEAALEAVRVAA
FT                   LGKKGSVSALLATLGKMDPEQRKTEGAAINLAKDAVTQALAARRDVLKAAALDAKLAAE
FT                   TIDVTLPLREPLAEAGRIHPLSQVWDELTAIFADMGFAIAEGPDIETDDYNFTKLNFPE
FT                   GHPAREMHDTFYFNPKDDGSRLLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRSDSDQT
FT                   HTPMFHQVEGLVIDKGSHLGHLKWILHEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDI
FT                   QCRRGKDEIRFGEGEDWLEILGCGMVHPNVLTACGLDPDVYQGFAWGMGIDRIAMLKYG
FT                   MSDLRQLFEADSRWLNHYGFKPLDIPTLAGGLSS"
FT   gene            45527..46018
FT                   /locus_tag="RPB_0046"
FT   CDS_pept        45527..46018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0046"
FT                   /product="Protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04758"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J452"
FT                   /protein_id="ABD04758.1"
FT                   /translation="MDDSKQPTWKVSPSLRRHARELRKKSTDAERLMWGELRDKRLGGF
FT                   SFKRQVPIGPFIADFACHSVKLVVEIDGGQHFADAAERADAARTAAIEARGFRVIRFSN
FT                   ADVMSNRDGVLQSIATELAARALTPTLSRKRERERAAREAKQRPDQTTSKQRHSTDDAD
FT                   "
FT   gene            46160..48568
FT                   /locus_tag="RPB_0047"
FT   CDS_pept        46160..48568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0047"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04759"
FT                   /db_xref="GOA:Q2J451"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J451"
FT                   /protein_id="ABD04759.1"
FT                   /translation="MKLTLSWLKDHLDTDEQLDALADKLTMIGLEVEGIEDKAKALAPF
FT                   TIALVLTAEKHPNADKLQVCSVDTGAGAPVQVVCGAPNARAGLVTVFAPPGTFIPAKAI
FT                   TLGIGNIRGVESRGMLCSAAELELSEDHDGIIELPADAPIGQGFAEWAGLGDPVLDINL
FT                   TPNRQDCAGISGIARDLAAAGMGKFKNPSIKPIKGDFPCPVKVSVEDDKLCPGFALRLV
FT                   RGVKNGPSPDWLQQRLTAIGLRPINALVDITNFLTFDRSRPLHVFDAAKVSGDLVVRRA
FT                   KDGETLLALDGRSYTLDPNVCVIADAHGVESLAGIMGGEASGCSDDTTDVLIESALWNE
FT                   INIAQSGRRLGINTDARYRFERGVDPAFMVPGLDLATHLVMQFCGGTPSEAVVVGKAFG
FT                   DDRIIDFPLSEVKRLAGIEVPFVEVRRILTHLGFMVAGSGAVVKVAVPSWRSDVHGKAD
FT                   IVEEIVRIVGVDKVPMTPFERGDAPRKPVLTQIQTRTRRAKRALAARGLTEAVTWSFIS
FT                   KPSAEAFGGGQPELALANPIAADLSDMRPSLLPGLIAAAQANADRGIPDLALFEVGQIF
FT                   KGDRPQDQFIAASGVRRGVASAQGLGRHWSGSAQASALDAKADAFAVLAAAGAPMAGLQ
FT                   IATNKLPAWLHPGRSGAIQIGPQNVLGYFGELHPRVLEQLHADGPLVAFEVLLDKIPDA
FT                   KQRPTRAKPALELSAFQPVSRDFAFIVDRKVAAADLVRAAQGIDKKLITSVGVFDVYEG
FT                   KGIDTDKKSIAIAVTLQPRDKTMTDQEIDAVGAKIVAEVTKKTGGVLRG"
FT   gene            complement(48751..50181)
FT                   /locus_tag="RPB_0048"
FT   CDS_pept        complement(48751..50181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0048"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04760"
FT                   /db_xref="GOA:Q2J450"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J450"
FT                   /protein_id="ABD04760.1"
FT                   /translation="MTISRRRFLGATAGLAVAPMFGGRASAALPREVDVVVVGAGAAGI
FT                   AAARRIAASGRKVIVVEAAAQIGGRCQTDTTSFDAPFDRGARFLHNPDSNPLVRLARSE
FT                   GFEIAPAAPGQKVRIGRRNARARETEDLLATMVRASRALGDAARGRADVSCAAALPNDL
FT                   GDWTATVEFVLGPVATGKDLKDLSAIDGFRAQDRNAIIGVRQGLGGLLARLAAALPVTL
FT                   STPVTRIVWSGRDIGVETASGKIAARAIILTASTNVLSSGAIAFSPELPKRQLDAAGKL
FT                   GLGSYDRIALSFKGNPLGLSRDEMMIERSDSARTAVLSANVNGSSLCTVDVAGAFGRDL
FT                   SAQGEAAMQAFAVEWLSKLFGSDIAAAIDRKAATRWNAAPYVQGAMSAAAPGGAASRKV
FT                   LAEPLGNLFIAGEATSDLMWGTVLGAWESGETAADAALKRIGPAKPAAAAEKPQRKPKP
FT                   RRRNQEATGSADRWPGSR"
FT   sig_peptide     complement(50098..50181)
FT                   /locus_tag="RPB_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            50507..51430
FT                   /locus_tag="RPB_0049"
FT   CDS_pept        50507..51430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04761"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J449"
FT                   /protein_id="ABD04761.1"
FT                   /translation="MGIVFDAIGKVIAGYLQKEEPGYEPFTPSDPDHLRTIMQPGDVLL
FT                   VEGNARISGIIKYLTQSTWSHAALYVGPIDGAAEPDGEPHVLIEANIGEGVSSSPLSRH
FT                   LNYHTRICRPVGLSHEDRHTVCRYAINRIGFGYDTKNIIDLMRYLVPMPVPQRWRRRMI
FT                   ALGSGDPTKIICSALIAQAFDAVRYPILPKITKAGSRAARREILHIRDSSLYMPRDFDI
FT                   SPYFEVVKPTIVNGFDYTALHWADKQKPLAEVAGPFSTFQDGLDPAPPLVPAPADAEAA
FT                   ACDAQVMDTALHHQAPAPTPAREPAN"
FT   gene            complement(51434..53662)
FT                   /locus_tag="RPB_0050"
FT   CDS_pept        complement(51434..53662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0050"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04762"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J448"
FT                   /protein_id="ABD04762.1"
FT                   /translation="MPQIRLKTSKTSKRCTVARKPKPSRSATKGPKPLPRPKRPSRAAA
FT                   VADRERAVAVALDEARKSHERLREAIDILPQGIVFLDSEGRYILWNKRYAEIYKASADL
FT                   FKPGARIEDTMRVGVARGDYPEAVGHEEEWIAERMRRLFDPGHSHEQVLADGRCIRIEE
FT                   RTTSDGGVIGLRVDITELKQREASFRLMFEGNPVPMIVCSLKDERIVAVNDAAVLHYGY
FT                   SPAEFAGLTIRRLQAFGTELPWSGEQTNEERAARTWTHVKADGSLIDLAVYARQLTYNG
FT                   EPAVLLALMDITERKRAEMRLAFMAHHDGLTKLPNRSLLRKRLDELLAKTRRTGDKIAV
FT                   LFIGVDHFKAVNDTLGHAIGDKLLRGIARRLRSTLREEDPLARLNSDEFAVIQTGIKRP
FT                   EDVTLLAKRLLNAIAEPYLLEGHSVVAGASIGIAVAPLDGDDSEKLLMNAGMALSRAKT
FT                   DSRGSFSFFEPDMDARAQSRRKIETELRAALRHEVLRPYYQPLIALSGGGVTGCEALVR
FT                   WPHPERGMVSPGEFIPVAEDTGLINAIGAQVLRAACRDAARWPGDISVAVNLSPLQFRV
FT                   GNLMATVMDALKQSGLPPRRLELEITETLLLEKSSQVIATLHALRALGVRISMDDFGTG
FT                   YSSLSYLRSFPFDKIKIDQSFVRGVSDNREAQAIVRAIISLGMGLGVTITAEGVETEAE
FT                   LNWLRAEGCHEAQGFLFSPARPNDELRDLLDRQGTAGGAFPVSASRVA"
FT   gene            54035..54991
FT                   /locus_tag="RPB_0051"
FT   CDS_pept        54035..54991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0051"
FT                   /product="Peptidase U6, penicillin-insensitive murein
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04763"
FT                   /db_xref="GOA:Q2J447"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J447"
FT                   /protein_id="ABD04763.1"
FT                   /translation="MRRRSIPARWLLAAALLGASVPSAWAQDKGTVDPKPLPPLANPND
FT                   PELAARELFGRRYLPAALPPRPIGFYARGCLAGAEALPITGKTWQVMRLSRNRFYAYPA
FT                   MVDLVARLSRKAHSDAGWPGILVGDMSQPRGGPMLTGHASHQVGLDADIWLTPMPNRQL
FT                   SRNEREEMSAVMMVRRDRLDIDPAAWTPTHWKVIRAAAQEPQVERIFANAAIKKALCRE
FT                   AKGDRGWLNKVRPMYGHDYHFHIRIKCPPGLAGCEAQPETPQGEGCAPADLAYWFSDAV
FT                   LHPKPPKVPPKPKRQLTLAELPAECRAVLNAPDKKID"
FT   sig_peptide     54035..54115
FT                   /locus_tag="RPB_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(55011..55415)
FT                   /locus_tag="RPB_0052"
FT   CDS_pept        complement(55011..55415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J446"
FT                   /protein_id="ABD04764.1"
FT                   /translation="MKMSGARLAAVAVVGLGLGIGYANPASAQVINQRQEYYQARWDWK
FT                   GVHKSTQDPNNISFIQFKSPTQAVYCYKKACRNVKLQKVPGGDLTFSVNGKDYFEMNIV
FT                   NSTRINGRFWTDMTPPARSPDATAVFVRKP"
FT   sig_peptide     complement(55329..55415)
FT                   /locus_tag="RPB_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            complement(55477..55956)
FT                   /locus_tag="RPB_0053"
FT   CDS_pept        complement(55477..55956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J445"
FT                   /protein_id="ABD04765.1"
FT                   /translation="MIHRHLLLGLLSAAAVAASPCAASAQDAKAKKYAEVGGWTVESYS
FT                   MDGQYMRCGAIVPGAVKIAFEKSAEGWTVVVPTTLKTIPDEIKGSVELDGKAAKASFYG
FT                   GDAGRVMTFLKDPQIKALRTAKSFVVKAGQETTPVPLAGIDAALRKAAECDGKGG"
FT   sig_peptide     complement(55879..55956)
FT                   /locus_tag="RPB_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.846 at
FT                   residue 26"
FT   gene            complement(56021..56614)
FT                   /locus_tag="RPB_0054"
FT   CDS_pept        complement(56021..56614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04766"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J444"
FT                   /protein_id="ABD04766.1"
FT                   /translation="MMIETPSTTKAMLMSLGLATLAATPASAAPPLQCQDFVNYAMKAQ
FT                   AQYYARGCPRIPSMHANREGHFQWCLKRNEGQVAAEQRAKAATLNSCLAGAASPPRPQS
FT                   AQMQSTATREPVCSSYGQAGEKWRNRATAQGCNVAAIPVPRGWASYAWGANQLFSYCMG
FT                   TSDAGFRGRSAQALGHKVQLEKACSQQLRRPVRL"
FT   sig_peptide     complement(56528..56614)
FT                   /locus_tag="RPB_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(56695..57093)
FT                   /locus_tag="RPB_0055"
FT   CDS_pept        complement(56695..57093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04767"
FT                   /db_xref="GOA:Q2J443"
FT                   /db_xref="InterPro:IPR000922"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J443"
FT                   /protein_id="ABD04767.1"
FT                   /translation="MSDSRSEYPSLAAGRRAALMLSAALAMIATAGLAGRAQAMGNDPD
FT                   QKVVRVVSATYGANCGVAPGNATRQIAASCNGRRSCSYAVSYKILGDPAYGCKKDFRVR
FT                   YFCGRSGPFEGRAPGEAGYGTKVSLICN"
FT   sig_peptide     complement(56974..57093)
FT                   /locus_tag="RPB_0055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.734 at
FT                   residue 40"
FT   gene            complement(57528..59321)
FT                   /locus_tag="RPB_0056"
FT   CDS_pept        complement(57528..59321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0056"
FT                   /product="Sodium/hydrogen antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04768"
FT                   /db_xref="GOA:Q2J442"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J442"
FT                   /protein_id="ABD04768.1"
FT                   /translation="MGSLDTVSIAILLGAVLVMAGILSSLLALRFGAPLLLVFLVLGML
FT                   AGEAGPGGLKFDDLSTTYLVGSVALALILFDGGLRTRFSTIKAVLAPSMGLATVGVLLT
FT                   ALITAPVAYYALDLNWTEALLAGAVIASTDAAAVFLLVHSQGLRLRPRVGATLEVESGT
FT                   NDPFAVFLTLMLVGLITRGESSTWYVVVEFLWEALLGTAIGVIGGRMVVMALNRVALPQ
FT                   GLHAPFVATAALVVFGAAQISHASGFLAVYLAGMIIGNQPTRAHNSVVAFLDAATWLAQ
FT                   IVMFVLLGLLVSPQRLMSSIGPAVVVALALMLVARPVAVFLCLAPFRFNWRERLFIAWV
FT                   GLRGAVAIFLASIPMLVGLPKAYLYFDVAFVVVIISLLLQGWTLGPAARKLHVALQRTD
FT                   RGPRRIELDLPGQLEKQLVGYPVRAKSLYLKRGLIPSWSKPTLVIRDERILTPEEAEPV
FT                   APGDYLYLLAPPEKAEALDRFFVDMPPSTAPDPHLLGDFIVPGETTLGDLAAAYGVNVP
FT                   TGEEALTLADYFDIHLDRAPTVGAEVKLDTIVLVARSLGGGRVNVVGLRLPEDEDDAPP
FT                   PTRVQKARRKLSKVWSQLSGV"
FT   sig_peptide     complement(59259..59321)
FT                   /locus_tag="RPB_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.892) with cleavage site probability 0.582 at
FT                   residue 21"
FT   gene            59695..61008
FT                   /locus_tag="RPB_0057"
FT   CDS_pept        59695..61008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0057"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04769"
FT                   /db_xref="GOA:Q2J441"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J441"
FT                   /protein_id="ABD04769.1"
FT                   /translation="MIDFTQASEALLSAARSVGAEFTAPWFYAQLGIIITALGVGLGGG
FT                   ALIKARVDLTTLTMGWPVPLRTFLRVVVDSAWTALFALTLILARVVMLHATWPSRSYLI
FT                   GIAAKLALAWLLIRLVTSILRNAFLIRVVSVSAWCVAALSIIGQLFPVLEALDSVAIVV
FT                   GDLRLSPLLVIKLCVLLAIALWLANIASNFFEGRINRTADLTPSVQVLLIKLMRIGLMV
FT                   FAIALTMSAVGINLQALAVFSGAVGVGIGFGLQKIFGNFISGVILLADKSVKPGDLVTI
FT                   GDSSGKISAMNTRYISVAAGDGREFLIPNEDLITQKVVNWTYTDRNTLVKVAFATNYDA
FT                   DPRLVCQLAIDVATNVARASKAKPPGCILTEFTDTGMKFALTFWIAEPDGMDAVKSEAM
FT                   LGLWDAFKREGIRVPYPVREIRVRGGALPVETIVEVPR"
FT   gene            61107..61931
FT                   /locus_tag="RPB_0058"
FT   CDS_pept        61107..61931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0058"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04770"
FT                   /db_xref="GOA:Q2J440"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J440"
FT                   /protein_id="ABD04770.1"
FT                   /translation="MSYVDASDTALRKTGQIKLHGAAGFAGMRKAGQVVAQCLDELVDI
FT                   VKPGVPTSAIDDFVRDFAFSHGAFPATLMYRGYRYSTCTSINHVVCHGMPGDRPLKEGD
FT                   IVNVDVTMIVDGWYGDSSRMYPVGPIARKAERLIDVTYESLLRGIAAVKPGATTGDIGH
FT                   AIQSFVEPQQMSVVRDFCGHGLGRLFHDEPNIIHVGSPGQGVVLKPGMFFTIEPMINLG
FT                   KPYVKILSDGWTAVTRDRSLSAQFEHSIGVTKDGCEIFTLSPKQLDKPPFQS"
FT   gene            complement(62130..62684)
FT                   /locus_tag="RPB_0059"
FT   CDS_pept        complement(62130..62684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0059"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04771"
FT                   /db_xref="GOA:Q2J439"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J439"
FT                   /protein_id="ABD04771.1"
FT                   /translation="MNAIPELNDHADRSLLIVEDDKPFLERLSRAMETRGFEVTSCDSV
FT                   SSGLAQIGKAAPAFAVVDLRLGDGNGLDVVSALKKERPDARAIVLTGYGNIATAVTAVK
FT                   MGAVDYLSKPADADDVVAALLASGTEKSELPNNPMSADRVRWEHIQRIYEMCNRNVSET
FT                   ARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(62851..64173)
FT                   /locus_tag="RPB_0060"
FT   CDS_pept        complement(62851..64173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0060"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04772"
FT                   /db_xref="GOA:Q2J438"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J438"
FT                   /protein_id="ABD04772.1"
FT                   /translation="MSDDLISADFRHPRRHVRLDTILRLRWLAALGQLSAIFIVAQGLE
FT                   FDFAVLPCLAIIFASAVVNLGLQIAFNPMQRMEPIYAALLLALNIAELAGLLYFTGGLQ
FT                   NPFAFLFLGPVLIAATALPTRMTIALGVFAAGCAALLGYNHQPLPWAGDEAVQLPEIYL
FT                   VGVWLSILLAIGVTSVYTFQVTEEARKLADALSATELVLEREQHLTQIDGLAAAAAHEL
FT                   GTPLSTIFLISRELEKTAPPEMAGDLKTLREQAQRCREILAKISHLNAAGAPFDMMPLS
FT                   TLIEEAVAPHRDFGVTIKIRVAVSGVAEPVVMRNPAILYGIGNILENAVDFARDTVEVN
FT                   AWWNAETVQIMISDDGPGIKPDLLKRIGEPYLSRRRHADDASNERSGLGLGVFIARTLL
FT                   ERTGAKVSFRNKLFPDHGAVVQLTWPRNRFENSEISAVAEV"
FT   gene            64282..65091
FT                   /locus_tag="RPB_0061"
FT   CDS_pept        64282..65091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0061"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04773"
FT                   /db_xref="GOA:Q2J437"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J437"
FT                   /protein_id="ABD04773.1"
FT                   /translation="MTAETARTPEPPATAAHAAAAIEVAHLVKVYKATRAVDDISFSVA
FT                   RGSITGLLGGNGAGKTTTIAMIMGLVLPTAGRIRVLGHDMPERRADVLGRINFESPYVD
FT                   MPSRLTVRQNLRVFGKLYDVPDLPGRIAELAADLDLGDFLDRPSGKLSAGQKTRVALAK
FT                   ALINRPELLLLDEPTASLDPDTADWIRSHLETYCRQHGASILLASHNMLEVERLCDRVI
FT                   IMKRGRIEDDDAPAAIMARYNRATLEEVFLDVARGRARGEEQGDQPA"
FT   gene            65088..65918
FT                   /locus_tag="RPB_0062"
FT   CDS_pept        65088..65918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0062"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04774"
FT                   /db_xref="GOA:Q2J436"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J436"
FT                   /protein_id="ABD04774.1"
FT                   /translation="MRSLIDSLELGRGIAWHRIAAMVLRYWYLLMSSWPRLLELVYWPA
FT                   LQIITWGFLQSYIADNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNLGN
FT                   LMMSPLKPIEFLAALMIMSLVRLAIGIIPMALLAMIFFDFNLLGFGLPLIAFFCNLIFT
FT                   SWALGIFVSGLVLRNGLGAESIVWTLMFAVMPLACVYYPVSVLPHWLQPIAWALPPTYV
FT                   FEGMRALLMQHQFRADLMLWSLALNAVLFAASFVSFLVMLNSARRHGSLIQSGE"
FT   gene            66038..67363
FT                   /locus_tag="RPB_0063"
FT   CDS_pept        66038..67363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0063"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04775"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J435"
FT                   /protein_id="ABD04775.1"
FT                   /translation="MPVIGEFGRPPELPAEVSPAMTTPMYWFYELAHASLNPARAMSDA
FT                   AKLMFKNPLNPWSHTDLGKSIAAACEVFERTTRRYGKPEWGLDTTEVNGMRVPIEIHNV
FT                   WEKPFCRLLYFERKLEHPLRHPQPRVLIVAPMSGHYATLLRGTVEAFLPTHEVYITDWT
FT                   DARMVPVAAGRFDLDDYVDYVIEMLQTLGGNVHVVAVCQPSVPVLAAVSVMEANDDPFV
FT                   PLSMTLMGGPIDTRRNPTAVNNLAAEKGIDWFRSHVITKVPFPHPGVMRDVYPGFLQLN
FT                   GFISMNLDRHMDAHKNLFNHLVQGDGDLADKHREFYDEYLAVMDLTAEFYLQTVDVVFV
FT                   KHALPKGEMMHRGKLVEPWKIKRVALMTVEGEKDDISGLGQTEATHTLCSSIPDERRVH
FT                   YVQKGVGHYGVFNGSRFRSEIVPRISDFMLSAANGARANAAE"
FT   gene            67630..68466
FT                   /locus_tag="RPB_0064"
FT   CDS_pept        67630..68466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0064"
FT                   /product="Protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04776"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J434"
FT                   /protein_id="ABD04776.1"
FT                   /translation="MICFRAGRFQWRRIWQTPGNLLLSGSAEMAFRALLYRRPTEPSTI
FT                   PVRHGSQFFAVRIRRHRRATRYTLRIHPSDREAILTMPPRGTLADAKDFAQRHGAWIAA
FT                   RLGRLPKAAPFQPGTLVPLRGHDHRIVHRAGRGTVWTETRESGERIICVAGEAEHIDRR
FT                   VHDFLKREARADLQKACDRYAPELGVKVTRLSIRDQSSRWGSCTSAGSLSFSWRLILAP
FT                   PYVLDYLAAHEVAHLVEMNHSARFWRVVGKVCPHMERAKTWLDTHGNDLHRYGISD"
FT   gene            complement(68769..69206)
FT                   /locus_tag="RPB_0065"
FT   CDS_pept        complement(68769..69206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0065"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04777"
FT                   /db_xref="GOA:Q2J433"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J433"
FT                   /protein_id="ABD04777.1"
FT                   /translation="MNQGKVETIVAIKMAMEAGMDLVEISPNVSPPVCKIMDYGKFKYS
FT                   AQKKAAEARKKQKIVEIKEIKLRPMIDDHDYDVKMKAMQRFFEEGDKVKITLRYRGREM
FT                   AHQEIGTKLLEKVKADVAEIAKVEQDARFEGRQVVMVLAPR"
FT   gene            69327..69650
FT                   /locus_tag="RPB_0066"
FT   CDS_pept        69327..69650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04778"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J432"
FT                   /protein_id="ABD04778.1"
FT                   /translation="MNVGGGRSDQRMSKKHRRLCRSDHALHIGQSATGRKTEIAPVENA
FT                   EAMPFLIAAQCDGRTPTRQADFRLSGAKPADSRHFRHAGRWPDVDGATLRIANQLRNEA
FT                   LDP"
FT   gene            69647..70441
FT                   /locus_tag="RPB_0067"
FT   CDS_pept        69647..70441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04779"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J431"
FT                   /protein_id="ABD04779.1"
FT                   /translation="MTNNAATQAATDPDFITVGDGPAQRRIAVRARAGRGPGLFWLGGF
FT                   NSDMTGTKAVALDAWAAARGRACVRFDYSGHGASSGAFAEGTISRWLEDSLAVFDHVCK
FT                   GPQVVIGSSMGGWMALLLARELLRRGPGPATLAGLVLIAPAPDFTEALMWNGFSPQIRE
FT                   QIETEGVWMRPSDYGEPYPITRTLIEDGRNHLLLGGAISTGCPVRILQGKRDPDVPWTH
FT                   AFALTERLPCEDVVLTLIQDGDHRLSRPQDIARMLAAVEEIG"
FT   gene            complement(70581..71018)
FT                   /locus_tag="RPB_0068"
FT   CDS_pept        complement(70581..71018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0068"
FT                   /product="Protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04780"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J430"
FT                   /protein_id="ABD04780.1"
FT                   /translation="MRATLSAAEVIAQLGLAPHPEGGHYRETFRDSRCDSTGRSASTAI
FT                   YFLLARGERSHWHRIDAVEIWHYYAGATLTLEIADDNGHRAVALGPDVAAGETPQAIVP
FT                   PQAWQAAVSTGDWTLVGCTVAPGFQFEHFELAPSGWSPRPG"
FT   gene            complement(71018..71785)
FT                   /locus_tag="RPB_0069"
FT   CDS_pept        complement(71018..71785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0069"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04781"
FT                   /db_xref="GOA:Q2J429"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J429"
FT                   /protein_id="ABD04781.1"
FT                   /translation="MAADIRIVPCLTDNFGYLIHDPSSGATASIDAPEAAPLIAALEKE
FT                   GWKLTDILVTHHHGDHVGGIAELKAKYHCRVVAPHDANAKIADADLRVEEGDVVKVGGL
FT                   EARVLETPGHTLDHISYVFADDRALFAADTLFSIGCGRVFEGTYPMMWESLLKLRALPD
FT                   DYKLYCGHEYTASNVKFALTIEPENAALQARAKQVEQQRGAGRPTIPVTLGEEKQANVF
FT                   LRADVPSVAAAIGFAGESAADVFGELRERKNNS"
FT   gene            71962..72726
FT                   /locus_tag="RPB_0070"
FT   CDS_pept        71962..72726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04782"
FT                   /db_xref="GOA:Q2J428"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J428"
FT                   /protein_id="ABD04782.1"
FT                   /translation="MTMDVVNLREFYSNRLGVVARRLINRGIQTRWPDARGQRVLGLGY
FT                   PTPYLGLFRHNCERCIAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHS
FT                   LEMSDDPDALLREVWRVLAPSGRLLAVVPNRRGVWARIDNTPFGHGRPYSRSQISDLLR
FT                   RTWFTPIGWSEALFVPPLEQAWLLRWAPAWERIGAAISLPLAGVHVVEATKQVVRPIQA
FT                   KRERTRLIPSLEPSLVPSPMQADDTDAPLLPR"
FT   gene            complement(72806..73540)
FT                   /locus_tag="RPB_0071"
FT   CDS_pept        complement(72806..73540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04783"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J427"
FT                   /protein_id="ABD04783.1"
FT                   /translation="MRNGQNNKRLRNRNSGSNTNNNNNNRRGQNPMTRVFESNGPDIKI
FT                   RGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQAPRI
FT                   DNDMSENDDDGESDYSNFGAEPGLVPVQQQPQSFQPREPREQPQFQPREPREQPQPREH
FT                   RPQPQFTPRVEQPQPSVDAGVDRLPSFITGPQPQISPAAFEGATGGGGERFPPRRRRRP
FT                   HAPRGDAAAAPVPAEDASPGNE"
FT   gene            complement(74067..74936)
FT                   /locus_tag="RPB_0072"
FT   CDS_pept        complement(74067..74936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0072"
FT                   /product="modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04784"
FT                   /db_xref="GOA:Q2J426"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J426"
FT                   /protein_id="ABD04784.1"
FT                   /translation="MDQQNSVAEARRALGRRLKDAGIESAELDARLLIGEATGLDLTGL
FT                   IVQAERVLTLDEAERLDAFAVRRLAGEPVARILGVREFWGLALRLSDDTLVPRPDTETV
FT                   VEAALDHLRAEARARPLILDLGTGSGAILLALLSECPDAFGVATDISLGALRAARANAA
FT                   ALGLADRAGFVACDYAAALGGSFDLIVSNPPYIPASAIAALDVEVREHDPRRALDGGED
FT                   GLDAYRRIIPEAARLLGRGGALVVEIGQGQGDDVAALMRASGLAVPEPPRRDLGGVFRA
FT                   VTGRNLTG"
FT   gene            complement(74942..75721)
FT                   /locus_tag="RPB_0073"
FT   CDS_pept        complement(74942..75721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J425"
FT                   /protein_id="ABD04785.1"
FT                   /translation="MVDNATGRIDELNQIVRENEIFCILTRDSSLQEEACSALSGALEK
FT                   CSSLKADSIDSQNEVLANLALGFECVLRMLISELKMWILLKQEEPDKAWDYLIEAQMAA
FT                   SDAARAHKGFTHVRERGKQLEDLERTIFPPQVFFSAGLIVRKQICTVCGSEYGTCGHIV
FT                   GRPYWGEFCCIRVEDFEANHFSMVEDPADKRCRVITFEDGLGERNRMTWKVVPPSEKSF
FT                   EKSSQLNYQVNGSNNLSAPLRSSARLMHIDTLARRRS"
FT   gene            complement(75693..76202)
FT                   /locus_tag="RPB_0074"
FT   CDS_pept        complement(75693..76202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04786"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J424"
FT                   /protein_id="ABD04786.1"
FT                   /translation="MATEISDFICVRYHVKKFGIAAPEGFAVLPSNFTIAQSRSDFLIP
FT                   SEGATVRALFRNEGLPLSEEFFEGARYIQNNSYEWLAPTIFVSAGLLSENPSAVSLALG
FT                   VLTNFISDLFKGISGKKSVKLSIVIEDSADYACKKIDYEGDLEGLEALAPLIKKVADGR
FT                   QRNGPN"
FT   gene            complement(76273..77394)
FT                   /locus_tag="RPB_0075"
FT   CDS_pept        complement(76273..77394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0075"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04787"
FT                   /db_xref="GOA:Q2J423"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J423"
FT                   /protein_id="ABD04787.1"
FT                   /translation="MPFSHFVVRDRSMSNLPEAKLDVLLAHHASLEAQLLGEVAANDYV
FT                   RITRELSELNPLVEAVKAYREVRDELGDIDDLLEDPATDPEMRAMAEAERDALDAHRED
FT                   LIQQIRVALLPKDAMDERNVMLEIRAGTGGDEASLFAGDLFRMYEKFAALQGWSVEVIS
FT                   ASEGTVGGFKEIIAEVKGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEV
FT                   EEVDVDIKPDDLKIDTMRAQGAGGQHVNKTESAIRITHLPTGIVVMMQDSRSQHKNRAS
FT                   AMNILRSRIYDAEQQRIDSARSAERKQKVGSGDRSERIRTYNFPQGRVTDHRINLTLYK
FT                   LPQVIAGEALGELIDALTTEHQVAQLAAQGHAA"
FT   gene            complement(77432..79699)
FT                   /locus_tag="RPB_0076"
FT   CDS_pept        complement(77432..79699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0076"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04788"
FT                   /db_xref="GOA:Q2J422"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J422"
FT                   /protein_id="ABD04788.1"
FT                   /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNREAVHQTVLTAHEGLVGLVASEATPLNLSDAQSHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVLQNRAKRTYVEEEVEALQTTAMVLAEMIASG
FT                   ELSALAQPGAEPAARHSIHKTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEIRRLD
FT                   TALANLRADLDRLLERGDVADGGEHRDVLEAYRMFANDHGWSHKLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQNHAPSREQLPDNAILIARS
FT                   MGPAALLDYDRKRLRGLVLEEGTANSHVSIVARALGIAAIGEVPNAPGIADPGDAIIVD
FT                   ATSGSIYVRPSAEVEAAYAERVRFRARRQAQYSALRDLACVTTDGQPIDLMINAGLAID
FT                   LPHIDDTGSSGVGLFRTELQFMIGQSLPRSSDQLALYRAVLDAAGSKPVTFRTLDIGGD
FT                   KALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRNLRIMFPMISEVAE
FT                   FDAAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELFKKVDFISVGSNDLF
FT                   QFLYAVDRGNAKVSDRFDTLSAPILRALRDIVRKAKAAKRSVSLCGEMASQPLGALALI
FT                   AIGYRALSVSAVSHGPVKAMILELDAAKAEAAISPLLDAPAGSVSIRHKLAEFAEAHGL
FT                   SL"
FT   gene            complement(80003..81256)
FT                   /locus_tag="RPB_0077"
FT   CDS_pept        complement(80003..81256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0077"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04789"
FT                   /db_xref="GOA:Q2J421"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J421"
FT                   /protein_id="ABD04789.1"
FT                   /translation="MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMAG
FT                   KTNELVAWCTEASPMHDAREYDAVVASGEQVTSGLLAIALQALGIQARSWQGWQLPIRT
FT                   SDAHASARIVEIDGSEIVKRFGDRKEVAVIAGFQGINPETGRITTLGRGGSDTSAVAIA
FT                   AALKADRCDIYTDVDGVYTTDPRVVPKAKRLDKVAFEEMLELASQGAKVLQVRSVELGM
FT                   VHNMPIFVRSSFDKPEDIDPHGTPPGTLICSEEKIMENHVVTGIAFSKDEAQISVRRIE
FT                   DKPGVAASIFGPLADANINVDMIVQNVSEDGKTTDLTFTVPASDFARAKQTITSAQDKI
FT                   GYARFDSETDVAKVSVIGSGMRSHAGVAAQAFAALAARNINIRAITTSEIKFSVLIDAA
FT                   YTELAVRTLHTLYGLDQV"
FT   gene            81424..81900
FT                   /locus_tag="RPB_0078"
FT   CDS_pept        81424..81900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04790"
FT                   /db_xref="GOA:Q2J420"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J420"
FT                   /protein_id="ABD04790.1"
FT                   /translation="MGYIDQILQPGEKVLYSAKPHWIFYLPALGLWIIVAAVAGLTRIP
FT                   AVVAMDPRIEIGMLGLAAVIGVFALYLTLKAWFHRWTTETDVTSLRLVHKTGFIQRRTF
FT                   EMSLDKIESVDLDQSILGRVLDYGDVTVLGVGEGRETIRTVAAPLAFRSSITAR"
FT   gene            81916..82677
FT                   /locus_tag="RPB_0079"
FT   CDS_pept        81916..82677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0079"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04791"
FT                   /db_xref="GOA:Q2J419"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J419"
FT                   /protein_id="ABD04791.1"
FT                   /translation="MALQSESPGPVSPSVDPAEIAKFSKLSAQWWDPTGKMAPLHRINP
FT                   LRISFIRDAACRKFERNAKSLSCLSGLRMLDIGCGAGLLCEPFTRLGAQVIGIDPSATN
FT                   IAAAKIHADKSHLPIDYRCTTVEEIDPRERFDIVLAMEVIEHVTDVGAFLGRCAALMKP
FT                   NGIMVVATLNRNWKSFALAIVGAEYVMRWLPRGTHQWDKFVTPAELEQHLHGFGMIVTE
FT                   QSGLVFNPLADRWKLSADMDVNYMVVAETAP"
FT   gene            complement(82852..83667)
FT                   /locus_tag="RPB_0080"
FT   CDS_pept        complement(82852..83667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04792"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J418"
FT                   /protein_id="ABD04792.1"
FT                   /translation="MLRCLAAFVALFAVLSSPALAEDGFRGSECLAMAQAPPRAVPVSL
FT                   RRTAAAEQVLITYRGHSTYTIETPGGVMIATDYNGAYATGRVPDVVTMNRAHSTHYTLA
FT                   PDPKIAHVLHGWGDDGQPAHVRLRVGDVMIRNVTTDIRRYMFDDGNAGMIKDGNSIFIF
FT                   EVAGLCIGHLGHLHTTLDDSHFAAIGRIDILMVPIDGSYTMSLDGISAITKRLRAAVVL
FT                   PMHRFMTPLDEFMRRIGQSFAIDQRGDSALRISRETLPGAPTVIILRGV"
FT   sig_peptide     complement(83602..83667)
FT                   /locus_tag="RPB_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            83751..84722
FT                   /locus_tag="RPB_0081"
FT   CDS_pept        83751..84722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0081"
FT                   /product="permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04793"
FT                   /db_xref="GOA:Q2J417"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J417"
FT                   /protein_id="ABD04793.1"
FT                   /translation="MSRFRLTAASRPATVPRHSSPDPFMLTAASLWIPFALVAAVGQVA
FT                   RNAMQRSLTGPLGTWGATNIRFLFGFPFSILFLGVVIAATGDALPWPGLDFWPWLLLGA
FT                   LSQIAATGLMLAAMNERSFVVTTAYLKTEAIQTAIFGFVFLGDHLTVLKVGAILIATFG
FT                   VVITALRPGSARNLASLRPTALGLAAAAGFALSAVGFRGAIIVVPGVGFVTAATFTLVF
FT                   ALGVQTLVLTIYLLARAPQVLRDILHLWKPSMLAGFVGAAASQFWFLAFALTAAANVRT
FT                   LALVEVLFAQAVATYSFKQPMSARELGGIALIVLGVALLVAV"
FT   sig_peptide     83751..83870
FT                   /locus_tag="RPB_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.795 at
FT                   residue 40"
FT   gene            complement(84920..86704)
FT                   /locus_tag="RPB_0082"
FT   CDS_pept        complement(84920..86704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0082"
FT                   /product="gamma-glutamyltransferase 1. Threonine peptidase.
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04794"
FT                   /db_xref="GOA:Q2J416"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J416"
FT                   /protein_id="ABD04794.1"
FT                   /translation="MQDSTTLAPSETPPRTMTMLHRKAVTALVAMVALVVVPATAPAQD
FT                   MRGGAARAPGAASAVVARHGMVVAQERLSAEVGARFLARGGNAIDAAVATGFAMAVTYP
FT                   RAGNLGGGGFMLIHAAARNEDVAIDYRETAPQAATREMFLTDGKPDPDKSRRSALGIGV
FT                   PGTVAGLALALDKYGSGKFSLAEVIAPAIALARDGISVADDTADTLPDWHPWLSRWPST
FT                   RKIFARPDGSPLREGDRLVQPDLAATLQAIADHGPDGFYRGGVADKLARGIRDAGGIIT
FT                   TDDLANYQAIVRAPVRGNYRGYDIVAMPQPSSGGVVLIETLNILEGFPMPSLEQGSAPS
FT                   LHLLIEAMKRAYADRARYLGDPAYVDAPLSTLLSKDYAATLRAGIDADRATPAVVAPPQ
FT                   PKEGENTTHYSVADDQGNAVSNTYTLNFSYGVGLVADGTGVLLNNELDDFTAAPGAANA
FT                   YGLVGFGANLPAPGKRPLSSMSPTIVLKDGKPVLVTGSPGGSRIISATLQVIVNVLDYR
FT                   MNIAAAVGAPRLHHQWLPDELRVEQGFPDATLDALRAMGHRIATPLGQTSANSIVIDAD
FT                   GFHGAPDPRTRGATAAGN"
FT   gene            86769..88157
FT                   /locus_tag="RPB_0083"
FT   CDS_pept        86769..88157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0083"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04795"
FT                   /db_xref="GOA:Q2J415"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J415"
FT                   /protein_id="ABD04795.1"
FT                   /translation="MTSSTAADHSRESVPRTYPSRAAVGGWILFDWAAQPYFTLITTFI
FT                   FAPYFATYVAPDPATGQSLWGFATAASGLLIALASPILGAVADASGRRKPWIAVFGAML
FT                   VIGSSLMWFGRPGDAGVILPLLIAYAIATIGVEFATVFNNAMMPNLVPPEKIGRLSGTG
FT                   WATGYVGGILSLILVLGFLAANPQTGKTLIGVTPLFGLDAASHEGDRITGPLTGLWFMV
FT                   FVLPMFLLTPDFPAKLSVKAAVGEGLRELRETLRDLPQRRSLASFLLANMIYTDGLVSL
FT                   FAFGGIYATGTFGWGTIQIGSFGVILAIAATFGAFIGGRLDDALGSKRVIAGSIVLLLI
FT                   AISGILLIDPSHILFVEVTPPQPGGALFAAPAERAYLLLGCLIGIAGGPLQAASRTLLI
FT                   RIAPRDRIAQYFGLFALTGKVTSFVGPLLIATVTAITASQKAGMAVLVLFFVGGLALLT
FT                   RVRN"
FT   gene            complement(88475..90067)
FT                   /locus_tag="RPB_0084"
FT   CDS_pept        complement(88475..90067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0084"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04796"
FT                   /db_xref="GOA:Q2J414"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J414"
FT                   /protein_id="ABD04796.1"
FT                   /translation="MTDLPRRVTRALLSVSDKTGLVDFARALAGHGVELVSTGGTAKAI
FT                   AAAGLPVKDVSEITGFPEMMDGRVKTLHPKVHGGLLAVRDNDEHKQAMAAHGIAQIDLL
FT                   VVNLYPFEATVDKGGSYEDCIENIDIGGPAMIRAAAKNHDDVAVIVESSDYQAVLDELA
FT                   ANAGATSHGLRKRLAAKAYARTAAYDAAISNWFAQQLKTDAPDFRAIGGRLIQSLRYGE
FT                   NPHQTAAFYATPEKRPGVATARQVQGKELSYNNINDTDAAYECVGEFDAKRTAACVIVK
FT                   HANPCGVAEGSSLLDAYRKALACDSTSAFGGIVALNRTLDAEAARAIVEIFTEMIIAPE
FT                   ASEEAIAIVAAKKNLRLLLAGSLPNPRAAGLTYKSVSGGLLVQSRDNAVVDDMALKVVT
FT                   KRQPSEAELRDLKFAFRVAKHVKSNTIIYAKDLATVGIGAGQMSRVDSARIAARKAQDA
FT                   AAELKLAAPMTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADDAG
FT                   IAMVFTGTRHFRH"
FT   gene            complement(90170..91924)
FT                   /locus_tag="RPB_0085"
FT   CDS_pept        complement(90170..91924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0085"
FT                   /product="Heparinase II/III-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04797"
FT                   /db_xref="GOA:Q2J413"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J413"
FT                   /protein_id="ABD04797.1"
FT                   /translation="MSSAHRRRISSLIVGRFARNMVARASGGSAALTRLWPGRTDRLII
FT                   APHDLRTADATRAAEIYAGRFVFAGKIVTCHGRSIFDLEPPSDDWEAALFGFGWLRHLR
FT                   AADTAITRANARSLVDDWLGNMARNRTVGRRPDVMARRVISLLSQAPLVLSDTDGKFYR
FT                   RYLRGLTREIRALRLALLDVPDGVARLQVTIALCYAALCLANQARNIRGATKRLSDELQ
FT                   RQILPDGGHFSRNPGALIDLLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHG
FT                   DGNIALFNGMSGTPSDLLATLLAYDDSHGIPMPSMPHSGYQRIDAGSTLVIIDAGLPPP
FT                   PNVSQDGHAGCLSFEMSSGQCRIVTNCGMPSTNRESWRGFARSTAAHSTVTCHDTSSCQ
FT                   FVERSAMKRLLQGAPIVSGPTLVDNRREAVAGGVLLTASHDGYRDKFGVIHQRVVMVKH
FT                   DGSRVDGEDTLSPAQGGRHRAGQADYAVRFHLHPSIKASRLGDAHGVMLVLPNREVWTF
FT                   EALDDKVDLEDSVFLAGNDGPRRTTQIVIRQNSIEAPSIRWSFIRSNTSPQQTSARRAA
FT                   RREPELPL"
FT   gene            complement(92238..93590)
FT                   /locus_tag="RPB_0086"
FT   CDS_pept        complement(92238..93590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0086"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04798"
FT                   /db_xref="GOA:Q2J412"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J412"
FT                   /protein_id="ABD04798.1"
FT                   /translation="MPAPRFAQPSEVPGLAARRIAADILDGVLQKRRMLDDQLEGPAAH
FT                   PGLKTLPDRDRALMRRLVATILRRLGTLEHLLARMLDRGVPTDAPRAKSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQSDRRAAKYAGLVNAVLRRCAREGHPLIDAVAGQALDVPEWL
FT                   MARWRAHYGDDAAKAIALAISHEPSLDITVKSDPDHWAGRLYGELLPTGTVRTLLQGSV
FT                   KMLPGFDDGQWWVQDAAAALPARLFGDLAGKSVADLCAAPGGKTAQLAQAGARVSAIDR
FT                   SPARVARLRENLARLGLEAETAVADATEWRSDAPGSFDGVLVDAPCASTGTIRRHPDVA
FT                   WLKQESDIGALSAVQSRLLHKAVALLKPGGTLVYCTCSLEPEEGEQVVGALLDAEPGMR
FT                   RLPVEPAEVAGLAEIVTAEGDVRTLPSHLPHADPRLAGFDGFYAARLTKSL"
FT   gene            93756..93977
FT                   /locus_tag="RPB_0087"
FT   CDS_pept        93756..93977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0087"
FT                   /product="Protein of unknown function DUF1674"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04799"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J411"
FT                   /protein_id="ABD04799.1"
FT                   /translation="MTKSDPQPVPAAPTEPPRRELPDAAKRALAEADARRVEAAQHAAA
FT                   RAKEYQGPKGPEPTRYGDWEVKGIASDF"
FT   gene            94073..94651
FT                   /locus_tag="RPB_0088"
FT   CDS_pept        94073..94651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0088"
FT                   /product="SNase-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04800"
FT                   /db_xref="GOA:Q2J410"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J410"
FT                   /protein_id="ABD04800.1"
FT                   /translation="MSPLFRTNPVRIARLPWRGRLRSIWPWVFVLGVAAGMMLPARHWV
FT                   QWPWAEPDSQALRNDSETVWRRAGNPAVRHPVDVLYIIDGDTFEARVHLWPGTDLATRV
FT                   RLRGIDAPELKAQCAQELKLAEAATGALRDLLRQGEVAIYNIGPDKYQGRVVADVATKR
FT                   TPSVSAALLEAGYARAYGSGRREGWCGGR"
FT   gene            complement(94763..96517)
FT                   /locus_tag="RPB_0089"
FT   CDS_pept        complement(94763..96517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0089"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04801"
FT                   /db_xref="GOA:Q2J409"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J409"
FT                   /protein_id="ABD04801.1"
FT                   /translation="MMRFATTFFALLVSTSFAAAQTIYPIDRAEILAGARFDLKVEFAG
FT                   EVSADKATLTVNGTDAAAVFGKAPELIAREDGRPQSALLLRDVALDKPGAYTVEAGDGA
FT                   DRRSVGWTVYDTGPRKAKNVILFIGDGLSPAHRVAARLLSKGIKEGRAGGKLAIDDMPQ
FT                   MALVSTAGSDSIITDSANAASAYATGHKAAVNAMGVYADRTASPLDDPRVETLASLAKR
FT                   RLGLAIGIVTNTEVEDATPAAVIAHTRRRAAYDDIVAQFFAASPDVLMGGGAAYFLPKS
FT                   AQGKRKDDVDYLAKFRDAGYAVATSATELAAAGKPDTRKLLGLFAPGNMDGVLDRRFLK
FT                   GGGVAKNPDQPDLTEQVAVALDVLSKNEAGFFLMVESGMIDKYAHALDMERAVYDTIML
FT                   DNAVRQTRDWAKARGDDTLILVVADHNHPNALVGTVRDDLAEGEDVPLRERIGVYQRAG
FT                   FPNYPAPDKDGYPDRVDVSRRLAIFSASLPDHYETLRPKLDGPNQPTEAGDKPGTFKAN
FT                   EKYKAVPGAVLRLGNLPAMMNASVHSGEDVILTAAGPGSDRVHGAMENTDVFRVMAEAL
FT                   GLAAASAK"
FT   sig_peptide     complement(96455..96517)
FT                   /locus_tag="RPB_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.714 at
FT                   residue 21"
FT   gene            complement(96815..98203)
FT                   /locus_tag="RPB_0090"
FT   CDS_pept        complement(96815..98203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0090"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04802"
FT                   /db_xref="GOA:Q2J408"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J408"
FT                   /protein_id="ABD04802.1"
FT                   /translation="MIFALPTRKPPQPIGSPMSTILKSLPKGENVGIAFSGGLDTSAAL
FT                   LWMKQKGARVFAYTANLGQPDEADYDEIPRKAMEFGAEKARLVDCRSQLVHEGIAAIQS
FT                   GAFHVSTGGIAYFNTTPLGRAVTGTMLVSAMKEDGVNIWGDGSTYKGNDIERFYRYGLL
FT                   TNPDLRIYKPWLDQQFIDELGGRAEMSAFMTAAGFAYKMSSEKAYSTDSNLLGATHEAK
FT                   DLEHLDSGIRIVVPIMGVPFWREDCAVKAETVSVRFEEGQPVALNGKTFADPVALFLEA
FT                   NAIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRIS
FT                   GMKLGRLLYQGRWFDSQALMLRETAQRWVARAITGEVTLELRRGNDYSILNTQSPNLTY
FT                   APERLSMEKVEDAPFTPGDRIGQLTMRNLDIADTRAKLDIFAKAGLLSAGEGSHIPKLE
FT                   NDKG"
FT   gene            complement(98256..99044)
FT                   /locus_tag="RPB_0091"
FT   CDS_pept        complement(98256..99044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0091"
FT                   /product="Phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04803"
FT                   /db_xref="GOA:Q2J407"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J407"
FT                   /protein_id="ABD04803.1"
FT                   /translation="MNRKGLHIALALFAAIGLLFGLFPGLDLWLAGLFYDPATKTFPMR
FT                   ADQDLEFLRDLAMWIAWAIAAPSIFALVFKMVRPDRPLVMPGRTVAFLLISITLSAGVL
FT                   TNMTFKTHWGRPRPAAVAEFNGPWQFKAWWDPRGACPKNCSFFSGEGATAYWTFAPAAL
FT                   TPPAVRPYAYAAAFVFGTVTSGLRVAFGGHFFTDVAIAGLVTFLVIWLLYALIYRWAWS
FT                   RTSDAAIDAALTRAFWPGYRWRSKWRGRDVGPAPSPAPAA"
FT   gene            complement(99087..99578)
FT                   /locus_tag="RPB_0092"
FT   CDS_pept        complement(99087..99578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04804"
FT                   /db_xref="GOA:Q2J406"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J406"
FT                   /protein_id="ABD04804.1"
FT                   /translation="MSLIGRLFAIAFGFLFASLAAGLVVVGTMLFPELSDLAGGPLDPD
FT                   ALNIVLGFGFIFVSGFALLPALIIVLVTEAFSIRSALVYAIGGGLVGVGCYLGLVPFDP
FT                   GTLQFDGIVRRHLEIMTGAGIIGGLVYWLIAGRNAGLWRDPPRQPTAVAPPSPQPPPAA
FT                   "
FT   sig_peptide     complement(99516..99578)
FT                   /locus_tag="RPB_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.636 at
FT                   residue 21"
FT   gene            complement(99721..100920)
FT                   /locus_tag="RPB_0093"
FT   CDS_pept        complement(99721..100920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04805"
FT                   /db_xref="GOA:Q2J405"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J405"
FT                   /protein_id="ABD04805.1"
FT                   /translation="MTLAVAVAPLEKTPLETYVPPAKPSLIGLSRAELAERLGAIGVAP
FT                   AQRKMRAQQLWHWMYVRGARDFAEMTNVSKEMRATLAEHCTVDRPEVVAEQISADGTRK
FT                   WLLRLPSGDDVQKAHEVECVYIPETDRGTLCVSSQVGCTLNCSFCHTGTQRLVRNLTAG
FT                   EIVGQVMVARDRLGDWIDRETPNGNRLVTNVVMMGMGEPLYNFEAVRDALLIVTDNEGI
FT                   GISRRRVTLSTSGVVPNIARTGDEIGVMLAISLHAVRDELRDELVPLNRKYPLKELLQA
FT                   CRDYPGASNARRITFEYVMLKGVNDSLDDARRLVQLLKGIPAKINLIPFNPWPGSKYEC
FT                   SDWDQIEKFSEYVFNAGYSSPVRTPRGRDILAACGQLKSETEKLSVRERDALRAMAMTD
FT                   "
FT   gene            complement(101152..101751)
FT                   /locus_tag="RPB_0094"
FT   CDS_pept        complement(101152..101751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04806"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J404"
FT                   /protein_id="ABD04806.1"
FT                   /translation="MTDVCMSARRILIAAMAGAMLWSAGSAAQARPASKGATAKPEPAA
FT                   AASNSAEPTLIGQFGSWGAYMATPNGKRVCFVLAKPSSSKTTPPNRPRDPAYAFISTRP
FT                   AEKVINEVSVMIGYPLKPGSESTMEIGGASFAMYTQGDGLWIKNAAEEDRLVEALRKGP
FT                   EVTVKGVSAKGTATTDTFSLKGLAQALDKVAQSCGG"
FT   sig_peptide     complement(101659..101751)
FT                   /locus_tag="RPB_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.587 at
FT                   residue 31"
FT   gene            102027..103001
FT                   /locus_tag="RPB_0095"
FT   CDS_pept        102027..103001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0095"
FT                   /product="Alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04807"
FT                   /db_xref="GOA:Q2J403"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J403"
FT                   /protein_id="ABD04807.1"
FT                   /translation="MKAILCQQYCGPDDLVLTEVPDPVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPGAEVAGVIESIGEGVTDLKVGDRVVASCGHNGAREKIALPASA
FT                   IIKIPDNLDYDRAAGIIIIYGTALHALDDRASPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSDEKLEFAKQHGAELTLNYAKEDLKEGLKKLTGGKGVDIIFDPVGGTYAE
FT                   AALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRINPAKHRANLEK
FT                   LVQWAAEGKISSHVDRTFPLAQTADALNVLGGRQAMGKVILHP"
FT   gene            complement(103097..105265)
FT                   /locus_tag="RPB_0096"
FT   CDS_pept        complement(103097..105265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0096"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04808"
FT                   /db_xref="GOA:Q2J402"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J402"
FT                   /protein_id="ABD04808.1"
FT                   /translation="MKTFLTVKLVLVPFALFWALLAMGHVDWAIGAGLVLALIGNAWRA
FT                   WRRELFVLEVGGLVLFLGLGGLLLVVPDLAAPTALWLSFAGLSAISIASLVVRRPWTSD
FT                   YARAAYPDNAATPQFFVINAAITALWAVLFAAIAACRYAGAPGGVIAALVIGGALISIF
FT                   GPRLAIRFVLQRLAASGETYRWPAPSFARDNAADCDVAVIGAGIGGLTAAALLADAGLK
FT                   VKVFDQHVVAGGYCHTYLRKAHHLNKPVLYRFDAGPHDFSGVQPGGPFATLLLRLGVAD
FT                   RITWERVTQSFHTARGAIDVPPDWRDYVRVLGERFPDSAAGIKSLFEEIKAIFDDMFST
FT                   AASRGGVPGPPSTIDELLAFPRAHPHAYKWMNRPFAELVAAHVRDPAVVAVIDGLAGYI
FT                   GDGSEPPSCARMVPIFGYYFHGGYYPRGGSGVVADALVEAIEARDGEVRLKTAVKQIIV
FT                   ENGSAAGVVLADGERVRARAVVSNADFKRTLLELVPAAALPRGVRDDLAAAAPANSCFS
FT                   VHLGVDFVPDLGPSTHLHAPMPLGIAMMSKCDPTAAPPGHAILSLIALVPHDEAKSWFP
FT                   QESGGNDWKEWRRSEDYLRRKEEFGDRMIAAAETAIPGLSQHIVYRTDASPVTYARYDW
FT                   ASFGAIYGMSTAGQLKGSKTALRHLVIAGGGNIGAGVEAVVISGANAAEALVPGLLARA
FT                   GSEATASISLLTPKSHAPDKADREAVRC"
FT   sig_peptide     complement(105191..105265)
FT                   /locus_tag="RPB_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.933 at
FT                   residue 25"
FT   gene            105431..106054
FT                   /locus_tag="RPB_0097"
FT   CDS_pept        105431..106054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0097"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04809"
FT                   /db_xref="GOA:Q2J401"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J401"
FT                   /protein_id="ABD04809.1"
FT                   /translation="MNEQAKTSDDPRRAAILQAAFDVFVEKGFEAATTAEIVRRAKTSK
FT                   RTLYEFFASKQDILSALVRYGSQKMQPSLDLPAPQDRAQFLVVLEQFGQRFLGELLHPE
FT                   RTAMYRLAIAEAGRGGGMVARELDANGRQPVMRAATRFFDQAAARGIIRGDDIATLLSV
FT                   YFSVLIGFAQLQTLLGAEPPFDAEAIAQRAALATRATERMMRPA"
FT   gene            complement(106070..106444)
FT                   /locus_tag="RPB_0098"
FT   CDS_pept        complement(106070..106444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0098"
FT                   /product="Protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04810"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J400"
FT                   /protein_id="ABD04810.1"
FT                   /translation="MTTEHSVGFEPADKLAQDPESVRRRFWHKIKRVAAHLPFAEDILA
FT                   AYYCAFDRQTPRHVQVALLGAIAYFVLPFDFMPDILPILGFTDDAAILATALRMVASNI
FT                   TPAHREAARAAMQRGLEDET"
FT   gene            complement(106532..106837)
FT                   /locus_tag="RPB_0099"
FT   CDS_pept        complement(106532..106837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0099"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04811"
FT                   /db_xref="GOA:Q2J3Z9"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3Z9"
FT                   /protein_id="ABD04811.1"
FT                   /translation="MVERLTGRERQQALQSIAGWREVEGRDAIARSFVFTDFNEAFGFM
FT                   TRVALVAEKADHHPEWRNVYKTVEVVLTTHDAGGVTRRDIDLAAAMNAIAGQFGVA"
FT   gene            107004..108446
FT                   /locus_tag="RPB_0100"
FT   CDS_pept        107004..108446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0100"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04812"
FT                   /db_xref="GOA:Q2J3Z8"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z8"
FT                   /protein_id="ABD04812.1"
FT                   /translation="MDFKRLFARSMDEPEPVDPLLHMSARPVRRKTTLISLAAILALVG
FT                   AISAAYYFAMRPTTLKIAVGPQASDDLRLIQALAQAFSRERNIVRMRPIVTDGPAASAA
FT                   ALKSDTTDLAVIRGDLPVPRNARSVAVLHKNVAVLWAPGRPASGKRRKAAVAGVTTITQ
FT                   LVGKRVGVIGRTEANAGLLAVILRQYGIDPAKVESVQLTAADVAEAVRTGKADAFLAAG
FT                   PLNSKVIGEALAATASSGREPVFLGIDSSEALAANHPSYESASIPAGAFGGAPARPGDD
FT                   VKTISFSHYIVARDGVSDATIASFTQQLFTARQTVMTENPLAAKIETPDTDKDAVIPVQ
FT                   AGAAAYVDGEQRSFLDRYSDLIWFSLMGLSATGSLGAWFASYLRKDERNTNASQRDRLL
FT                   DMLAAARRCDAQDELDAMQTEADAILRDALNCYENGAIDSAALTAFSIALEQFHNAVVD
FT                   RKMLLAAIPPAPPIRPARPQVV"
FT   gene            complement(108459..109907)
FT                   /locus_tag="RPB_0101"
FT   CDS_pept        complement(108459..109907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0101"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04813"
FT                   /db_xref="GOA:Q2J3Z7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z7"
FT                   /protein_id="ABD04813.1"
FT                   /translation="MRRITRRLKRWLYLGHRWLGIACCLLFAIWFISGVVMMYVAFPQF
FT                   DAKERRAALPDLAFSEIRLAPDQAMAAAGLTTYPRELRLAMQDGEPVYRLAGTNRRRQA
FT                   ISAVDGRALGDISPEQALAVARHHPAAVAPALLDIVDRDQWSVTARFDPLRPLFLIGLG
FT                   DDAGTELYVSQKTGEIVLDTNRHERVWNWLGAIPHWIYLTLLRQDAPLWRQVVMWTSGI
FT                   CLLVAISGIWIGLLRAGLRRRYASGRITPYRGWMAWHHLTGLVAGVLVLTWMASGWLSV
FT                   NPFELFARRGDSREALQRYAGHDAPTIASTLPARDRPGVVEARFIWVGGAPLMLLAHRD
FT                   GSQSVADPASGASRTLSPERIFDAAARLLPDATMTLRQRLEEPDAYWYSHHHQRVLPVL
FT                   RAGFDDAAATWYHLDPSTGEILGRSDRSRRVYRWLFNALHSFDFPVLIAHRPAWDIVVI
FT                   VLSLAGLVISVSGILLGWRRLRRA"
FT   sig_peptide     complement(109782..109907)
FT                   /locus_tag="RPB_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.745 at
FT                   residue 42"
FT   gene            complement(109910..112177)
FT                   /locus_tag="RPB_0102"
FT   CDS_pept        complement(109910..112177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0102"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04814"
FT                   /db_xref="GOA:Q2J3Z6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z6"
FT                   /protein_id="ABD04814.1"
FT                   /translation="MSPSPTASGRNRRLLSSVALTALLWPAAGHAQSAPRGLDPIVVEG
FT                   QTARPSKPRAASSAAGSSRTRRASAPASRPPAAPAAAPSAAVAAVPTFNLGTMASTASR
FT                   LGLTPLQTPASVDIITAQTIAERGQRDVLDAVTQNATGITATPEPGNGGVVFSTRGFSG
FT                   TGSVMTLYDGTRLYVGAGTVTFPFDTWSAERIEVLRGPASVMYGEGAIGGAINVITKQP
FT                   LDVQRNQAEVSLDTNLTRRIAVDSGGPINKDVSYRITATGNMSDGWVDRDKTSNIAVSA
FT                   AVKVKQTDHLTWTLSTAYGDRHPSLYYGTPLVNGRLDESLRFKNYNVGDSSIRYQDSWT
FT                   QLKSEWQVTDSITVRNALYYLNSRRHWKSAEEYAFNPTTRQVDRSTYLEIFHDQQQIGD
FT                   RMDATVRGHLFGLENTFVAGFDVNRINFKHTNNSPYGGTSSVDPYNFDPGLFASPDLTR
FT                   PGYSSVTNQYAVFAENRLQLTEQLALIGGIRQDQPTVERTDLRNPANNYTRSYSSTTWR
FT                   AGAVYTPIQDLAFYGQYSTAVDPVGGLVTASNANAKFELATGKQVEIGVKQSFWGGRGE
FT                   WTLAGYHIVKNNLLARSSEDPDQVVQVGQQSSRGIEASVGLALDHGWRVDANTTFLQAK
FT                   YDDFVQSVNDVGVNFAGNVPINVPLNVSNAWLTWAFAAGWSANAGVQVVGKRFADAANT
FT                   LEMPGYTLVNAGLQWKPDAASTLSLRLYNIFDKVYATSSYVDNQWLLGRPRTAELSYNV
FT                   KF"
FT   sig_peptide     complement(112082..112177)
FT                   /locus_tag="RPB_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 32"
FT   gene            113015..114838
FT                   /locus_tag="RPB_0103"
FT   CDS_pept        113015..114838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0103"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04815"
FT                   /db_xref="GOA:Q2J3Z5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z5"
FT                   /protein_id="ABD04815.1"
FT                   /translation="MTLRNIAIIAHVDHGKTTLVDKLLQQSGTYRDNQRQVERAMDSND
FT                   LERERGITILAKCTSVVWDDTHINIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVGKALKLGLKPIVAINKVDRSDARVTEVVNEVFDLFAALDATDDQLDFPILYG
FT                   SGKNGWMSDKPDGSHEDGMRPLFELVLKHVPPPAVEEGPFRLLGTILEANPYLGRIITG
FT                   RIASGSVKPNQSVKVLSRDGKLVETGRITKILAFRGLERVPLDIAEAGDIVAIAGLTKG
FT                   TVADTFCDPSVDTPIQAQPIDPPTVSMSFIVNNSPLAGTEGDKVTSRLIRDRLLREAEG
FT                   NVALRVVEAADKDAMEVSGRGELQLAILIENMRREGFELSVSRPRVVLTRDEDGQLLEP
FT                   IEEVVVDVDEEFSGVVVQKMSERKAEMIEMRPSGGNRLRLVFYAPTRGLIGYQGELMTD
FT                   TKGTAIMNRLFHNYLPYRGEIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWKV
FT                   YKGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIRMTLEKALAYIEEDEL
FT                   VEITPKSIRLRKRHLDANERKRAEKSKQAVA"
FT   gene            114968..116236
FT                   /locus_tag="RPB_0104"
FT   CDS_pept        114968..116236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0104"
FT                   /product="Amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04816"
FT                   /db_xref="GOA:Q2J3Z4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z4"
FT                   /protein_id="ABD04816.1"
FT                   /translation="MSQQRFPSSVDIAIIGAGAAGLGAARTLENSGLSVIVLEARDRVG
FT                   GRAFTRMVTPEIAFDVGCGWLHSADENCFVGIAGQLGIAIDTTHPPWSERSFGDVFPPR
FT                   QRAAFGKALDAFYERVWRAAKRKTDAAAATLLEPGNRWNPMIDAVSTYVNGAELDRISI
FT                   HDVEAYRDTGVNWRIRAGYGALIAAYGAPCPVALNCPVSVVDHSGLQLKIETSQGPLTA
FT                   DKVIITVPTNLIADGAIRFVPELPDKVEAARGLPLGADDKVMLKLSDPNGFPADGNLRG
FT                   ATMRAAMGSYHLRPFGLDCIEGFFGGRFARELEDAGDGAFAAQSIDEIADLLGNDIRRK
FT                   LTPLAESRWSRDPFTRGSYSHALPGHAGARAILAAPVDDRLFFAGEATSPHFFSTAHGA
FT                   RDSGERAAREVMARRVVAVAKLV"
FT   gene            116378..116920
FT                   /locus_tag="RPB_0105"
FT   CDS_pept        116378..116920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0105"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04817"
FT                   /db_xref="GOA:Q2J3Z3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z3"
FT                   /protein_id="ABD04817.1"
FT                   /translation="MPRPRLALISRMSTTLIEVRPARAADASAVAGTHDEAWRSAYQGI
FT                   IPGAELEKLINRRGPNWWDSAIRKGSRVSVLCFGDKVAGYANYGRNRARSLHFDGEIYE
FT                   LYLRPEFQGLGFGRRLFAAARRDLAQSGLKSMVIWALSDNEAATEFYRALGGRMVARSS
FT                   ERFGPKSLDKVAFAWSN"
FT   sig_peptide     116378..116452
FT                   /locus_tag="RPB_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.855) with cleavage site probability 0.855 at
FT                   residue 25"
FT   gene            116996..117532
FT                   /locus_tag="RPB_0106"
FT   CDS_pept        116996..117532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0106"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04818"
FT                   /db_xref="GOA:Q2J3Z2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z2"
FT                   /protein_id="ABD04818.1"
FT                   /translation="MRIDAIPVGINPPHDVNVIIEVPVGGEPIKYEMDKDAGTLVVDRF
FT                   LYTAMRYPGNYGFIPHTLSDDGDPCDVLVANTRGIVPGAMMSVRPVGVLFMSDEAGHDE
FT                   KIIAVPSSKLTQRYDRIKTYSDLPEITLQQIQHFFEHYKDLEPGKWVKILRWGGAEDAH
FT                   KLIVEGIERAKAAKK"
FT   gene            117568..119049
FT                   /locus_tag="RPB_0107"
FT   CDS_pept        117568..119049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0107"
FT                   /product="Gly-X carboxypeptidase YSCS precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04819"
FT                   /db_xref="GOA:Q2J3Z1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Z1"
FT                   /protein_id="ABD04819.1"
FT                   /translation="MRRLLRWIRNIVVVAVIAIAGLAVALTYNTFRQPSRQIDVAAVAP
FT                   VAVDEDGAARRLAEAIRFPTISNFLNPEQDAEALRGLQAHIVASFPAFHAAATREVVNG
FT                   KSLLYTWQGTDPQARPIALLAHQDVVPIAPKTEQDWQHKPFDGVIADGFVWGRGSWDDK
FT                   GNLYAMLEAVEAMAKQGFRPKRTIYFAFGHDEEVSGLRGARQIADLLAARKVRLDFVLD
FT                   EGLLITDGIMKGLDRPAALIGVSEKGYATLVLTARGTPGHSSMPPRDTAIGMLAAALTH
FT                   LEDNRLPMRVRGSVADMFDTLAPEMRGFNRVVLSNLWLFKPLLLREFAKSGTTEAMVRT
FT                   TTALTVFNAGDKDNVLPGIAEASVNFRLLPGDTQAGITDHVRKTVANDRIAIAGSEGNF
FT                   DPPPVTGTASASYEALNRTIREIFPDVVVAPGLMIAATDSRHYAGVADNIFRFSPVRAT
FT                   SEDLKRFHGTNERISIANYADMIRFYVRLIQNTAG"
FT   sig_peptide     117568..117645
FT                   /locus_tag="RPB_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.976 at
FT                   residue 26"
FT   gene            complement(119224..120111)
FT                   /locus_tag="RPB_0108"
FT   CDS_pept        complement(119224..120111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0108"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04820"
FT                   /db_xref="GOA:Q2J3Z0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3Z0"
FT                   /protein_id="ABD04820.1"
FT                   /translation="MTATIIDGKIISAELRARVAAEVTRIKADHGITPGLAVVLVGSDP
FT                   ASEVYVRSKHKQTQEAGMASFEHRLPADVPQAELLALIGQLNADPAVHGILVQLPLPKG
FT                   LDSNAVIDAIDPAKDVDGLNPVNAGRLASGLFALTPCTPLGCIIMAKQVHASLEGMNAI
FT                   VIGRSNLVGKPLVQLLLNENATVTIAHSRSRDLPALCRQADLVFAAVGRPEMVKGDWIK
FT                   PGATVIDVGINRTPSPDGGKDKLVGDVAFAEAKDIAGAITPVPGGVGLMTVACLLVNTV
FT                   RAASAIHGLPKPAV"
FT   gene            complement(120210..120536)
FT                   /locus_tag="RPB_0109"
FT   CDS_pept        complement(120210..120536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0109"
FT                   /product="Protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04821"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3Y9"
FT                   /protein_id="ABD04821.1"
FT                   /translation="MAEAWRYSAQGVAVAVRVTPRGDRDEIDGLETLSDGRPVVKLRVR
FT                   AIADGGEANRAVIELLAKALGVPKRNVRLLSGATSRQKQIAIDGDPKSLGETLRQLTAA
FT                   KPAG"
FT   gene            complement(120565..120924)
FT                   /locus_tag="RPB_0110"
FT   CDS_pept        complement(120565..120924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0110"
FT                   /product="Protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04822"
FT                   /db_xref="GOA:Q2J3Y8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y8"
FT                   /protein_id="ABD04822.1"
FT                   /translation="MHGPEPIFTGQPFRVRTREISTAMRAILDIVLIILDLYIWLLIAS
FT                   AILSWLIAFNVVNTRNQFVSAVSEFLYRITEPLLGPIRRMLPSLGGLDISPIILILLIM
FT                   FLQRVITYYIYPSVF"
FT   gene            121051..121126
FT                   /locus_tag="RPB_R0001"
FT                   /note="tRNA-Ala1"
FT   tRNA            121051..121126
FT                   /locus_tag="RPB_R0001"
FT                   /product="tRNA-Ala"
FT   gene            complement(121412..122239)
FT                   /locus_tag="RPB_0111"
FT   CDS_pept        complement(121412..122239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0111"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04823"
FT                   /db_xref="GOA:Q2J3Y7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y7"
FT                   /protein_id="ABD04823.1"
FT                   /translation="MSTRDILYQDILYEVADRIATITLNRPDRMNAWTPVMEREVREAM
FT                   ETAAEDAEVRVIVLTGAGRGFCAGADMQVLQTIDPSDVRRASSLPPFDMNRRADWQTRY
FT                   AFYPAIPKPIIGMLNGATAGIGLVHALYCDVRFAADSAVFTTAFARRGLIAEHGISWML
FT                   PRIVGHANALDLLLSARRVSAEEALRIGLVNRLVPSEQLREQTYAYARDLADNVSPASM
FT                   RVIKRQLYEVPFQTLAEATIEANREMVVSLGSDDFKEGVASFVEKRPPQFRSV"
FT   gene            complement(122378..123181)
FT                   /locus_tag="RPB_0112"
FT   CDS_pept        complement(122378..123181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0112"
FT                   /product="Glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04824"
FT                   /db_xref="GOA:Q2J3Y6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y6"
FT                   /protein_id="ABD04824.1"
FT                   /translation="MLLRPIDDFSRVASPALQPAGQAADTRPVLMILHQETSTPGRVGN
FT                   ALRALGHPLDIRRPRFGAALPETLDGHAGVVVFGGPMSANDPDDYIRREIDWIAVPLRE
FT                   RRPFLGICLGAQMLAAQLGARVSPHPEGRAEIGYYDIRPTAAGLAMCAQWPRQVYHWHC
FT                   EGFALPTGAELLAEGGDFPVQAIRAGSAYGLQFHPDVTCAMLHRWTTRGHERLELPGAR
FT                   PRRDHFADRALHDAAERAWLADFLDHWLTRMPAALPALPLREAAE"
FT   gene            complement(123314..124093)
FT                   /locus_tag="RPB_0113"
FT   CDS_pept        complement(123314..124093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0113"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04825"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y5"
FT                   /protein_id="ABD04825.1"
FT                   /translation="MTERVTLITGASAGIGTELARIFAANAHRVALVARRADRLEALAA
FT                   EITAKGGKEPIIIVCDLAKPEAVDEIVARLTAAGVEVEYLVNNAGYGLFGRAAEIDRED
FT                   QLGIIDVNIRALTDLSLRFADSVAKLRGGILNVASIASFLPGPGMAVYYASKAYVLSLS
FT                   EALHQELGKKGVRVTAICPGPVSTEFQSRAGFEPGFDSAVLNVSPAEVARQGYQGLMNN
FT                   RRLVLPGLGVKIVPFLLRFFPRGFILAAVGGYQQRQR"
FT   gene            complement(124356..124835)
FT                   /locus_tag="RPB_0114"
FT   CDS_pept        complement(124356..124835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0114"
FT                   /product="Protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04826"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y4"
FT                   /protein_id="ABD04826.1"
FT                   /translation="MLDKLRQFISDVVAPTAPDELTLDDGGYRLAATALLIHVISLDGD
FT                   PSEVERRKLQDLLETRFELDAATASRLIASATLVEGEAVDLYNFTSVIMRSVNEQGRLR
FT                   IIEMMWELVFADGQVTEFEENVVWRAADLLAVSSRDRINLKRQVAAQQSETDPAN"
FT   gene            complement(124958..126376)
FT                   /locus_tag="RPB_0115"
FT   CDS_pept        complement(124958..126376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0115"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04827"
FT                   /db_xref="GOA:Q2J3Y3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y3"
FT                   /protein_id="ABD04827.1"
FT                   /translation="MKAMTDVRPLYTVLRQTTEAPVVDAIAHLIADGADSELNRINVLE
FT                   FATRTGLDEEKVISGFLHAAQLGLFDMSWNVLCPGCSGVLDSHPSLKALRHDEYTCALC
FT                   AKAYEASVDDQVEAAFTVSPGIRRIGAHDPDSLPLWDYTRQMFWSSGIELDEDVLARLS
FT                   DQDTLGAAALQPGETAELSIALPSEFIIVFEPVTHSAQFIDVAGEPTDEVQSLALSFER
FT                   QHPLTPTLSLRPGPLKLSLTNHADKRVIPAVWVAADALHTLLGKRKPILTAKRMLTNQT
FT                   FRDVFKADNLSPDQRLKITSLTFLFTDLKGSTALYQRVGDLKAFDLVRAHFRALLEIIA
FT                   AEKGAVVKTIGDAVMATFNRPEDALAAALRMREAMDALNEERGTRDLVVKIGIHEGPCL
FT                   AVMLNERQDYFGQTVNIAARVLGLATTQAIHLTGAVIDTPAVTAMLDREAIAPIEKHAA
FT                   LRGIADKVLVYEIP"
FT   gene            complement(126415..127803)
FT                   /locus_tag="RPB_0116"
FT   CDS_pept        complement(126415..127803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0116"
FT                   /product="Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04828"
FT                   /db_xref="GOA:Q2J3Y2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y2"
FT                   /protein_id="ABD04828.1"
FT                   /translation="MSIAEVYAVADRPAPLVPPTPPRAPENISALGRLAAIRRNAIASW
FT                   GARAYQDDIVKGRFFTHASYILNTPDAIRHVLVDNDENYTRTATGIRVLQPMLGEGLLL
FT                   AQGRVWKHQRRTLAPAFTPRAVGTLVPHMISATEETVAELRDSAGAPVDLREKMQHLAL
FT                   EIAGRTMFSFEMGSHGKALRDFVIEYGTRLASPRFLDLLLPLGWPTPQDISRAFFRRRW
FT                   TKFVGELIAARRAAGKGEGAPPRDLFDLMVAARDPETGEAFSDDQLGDQVATMILAGHE
FT                   TTATALFWALYLLALDPRTQDDLADEVRAAGSGETPALDRLPFTRAVLDETLRLYPPAF
FT                   LIAREAAGPDTVAGHAIHRHDVLLIAPWLLHRHEKLWDNPSAFMPSRFLPGAPPPDRFA
FT                   YLPFGVGPRICIGAHFALVEATLALARVVGAFRIELIDAAPVMPIGIVTTQPDRSPMFR
FT                   LTRR"
FT   gene            complement(127873..129246)
FT                   /locus_tag="RPB_0117"
FT   CDS_pept        complement(127873..129246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0117"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04829"
FT                   /db_xref="GOA:Q2J3Y1"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR040664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y1"
FT                   /protein_id="ABD04829.1"
FT                   /translation="MHSSRRSILKGLGALPLVFGGPSLRAFAQGPVAASPETPVPPILF
FT                   VHGNGDHAALWITQIWRMESNGIARLRLAALNFTDPLARTDDGVAQPDRSSTEDQRREL
FT                   GVAIAELKRRTGAAKVALVASSRGGNAVRNYIKVGGAADVSHAVLCGTPNHGVYAWDAG
FT                   LGNEFNGKGPFLRGLNEGESEVTPGVAFLTLRSDGLDKYAQADGRFLGKPGTPTGVTAE
FT                   GPELRGATNLALSALDHREVAFHPRAFREIYKFIAGREPDLIAIAPERTVQLSGLVTAT
FT                   PGGVPTNRPVAGAGVEVFRVAPDSGERIGAALYSGKTGPDGRWGPVDTQPPWPLEFVLS
FT                   QPGEMITHIYRSPFPRSSDVVHLRAARPAAKPEAETGAVVMLSRPRGYFGLPRDIVLLD
FT                   GQQPADVKPGVPTDALTTAKLPASEVGRAVAGHFNEERIVARAWPLAENRVIVAELTS"
FT   sig_peptide     complement(129160..129246)
FT                   /locus_tag="RPB_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            129405..131093
FT                   /locus_tag="RPB_0118"
FT   CDS_pept        129405..131093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04830"
FT                   /db_xref="GOA:Q2J3Y0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Y0"
FT                   /protein_id="ABD04830.1"
FT                   /translation="MTGRPKRGAFSAGGVAAPLRYALFRRIWLASLLSNLGLMINGVGA
FT                   AWAMTQMTSSADKVALVQTALMLPIMLVAMPAGAIADMYDRRLVGLASLTLGLGGATAL
FT                   AVLAHLGLVTPEILLAFCFVIGTGMALFGPAWQASVSEQVPGEALPAAVALNGISYNIA
FT                   RSFGPAVGGIVVASAGAVAAFAANAVLYLPLLAVLLLWRRVSEPPRLPPERLNRAIVTG
FT                   VRYIANSPSIRIVLARTLITGIAGSSVLALMPLVARDLLKSGAETYGILLGAFGVGAVI
FT                   GALYVGMVRERMSSEAAIRSCALIMGVAMAAVAMSRWSILTAAALVIAGAVWMLAIALF
FT                   NIGVQLSAPRWVAGRSLAAFQASIAGGIAIGSWGWGHVADLSGVAPSMLISAGAMVVSP
FT                   LLGLWLRMPAVGTQIEDADLLADPEVRLALTPRSGPLVVEIEYRVDPDDARAFHGVMQQ
FT                   VQLSRQRNGAYGWSIARDIADPELWTERYHCPTWLDYLRQRNRSTQDDRNLHQRAMAFH
FT                   RGADPIRVRRMLERPFGSVRWKDDSPDRATGTEVLPVAGVSGGST"
FT   gene            complement(131145..131402)
FT                   /locus_tag="RPB_0119"
FT   CDS_pept        complement(131145..131402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04831"
FT                   /db_xref="GOA:Q2J3X9"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X9"
FT                   /protein_id="ABD04831.1"
FT                   /translation="MLRASRSRIWMAAMLKSVVTVASLLLLVSAAQAQSGRPDPGCGRD
FT                   VSRFCRAVMDQGDGVILACLQKNRARLSKTCAKVLTDNGQ"
FT   sig_peptide     complement(131301..131402)
FT                   /locus_tag="RPB_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.950 at
FT                   residue 34"
FT   gene            complement(131495..131836)
FT                   /locus_tag="RPB_0120"
FT   CDS_pept        complement(131495..131836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04832"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X8"
FT                   /protein_id="ABD04832.1"
FT                   /translation="MADKNSSDVILNMMSKNLDQARGAMNNYLQFIEKSMSVSPVGASS
FT                   QANTLKDYVEKNIQATFDFSQQLLHAKDFQDVVRIQTEFLQTQFRVLTDQAKDVVEMTK
FT                   PTVIVPRDG"
FT   gene            complement(132154..132558)
FT                   /locus_tag="RPB_0121"
FT   CDS_pept        complement(132154..132558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04833"
FT                   /db_xref="GOA:Q2J3X7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X7"
FT                   /protein_id="ABD04833.1"
FT                   /translation="MQNWFVALAVAVLIVVGFAAGPMSVVVAFLSFWVTLYLVWAYELG
FT                   FKDTWARYGLNRVKPPFWAEENKVWFYPIFGDRVKVVKAAAVALLIVAFSLMLPVSVVR
FT                   IATLVVLAWYVTEIYRAQKSTDQLDRARFN"
FT   sig_peptide     complement(132499..132558)
FT                   /locus_tag="RPB_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.531 at
FT                   residue 20"
FT   gene            complement(132639..132968)
FT                   /locus_tag="RPB_0122"
FT   CDS_pept        complement(132639..132968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04834"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X6"
FT                   /protein_id="ABD04834.1"
FT                   /translation="MILLGSFALVAALAVSDRIGGPSGVLIEPAVAATPVAPPPPPAFR
FT                   TVTSSSCSSNGCPTTCEADEALISAICVGSTGAKFSDNLLIENGQITASCGPSSTAIVV
FT                   SCARK"
FT   gene            133626..134597
FT                   /locus_tag="RPB_0123"
FT   CDS_pept        133626..134597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0123"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04835"
FT                   /db_xref="GOA:Q2J3X5"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X5"
FT                   /protein_id="ABD04835.1"
FT                   /translation="MSEPPSLAPSLKIGHPMNNALLLKLHRWTTFVFALPLIAIIFTGL
FT                   ILSVEPIIQSRGLPAGMVDAERITGLLQRYDPAGKARGLAINAGGQQMRLMGVNAPTID
FT                   LATGEAAAASDPVGDVLLWARRTHERLLGYEWLVISSTIALVVIMGIGILMGLPRLRNS
FT                   LAGWHKGAAWFTLPLLLLSPITGLFLAFGLTLQSAPPPAAARAPLPLADAVRAVAQSHD
FT                   VAHLAMIANRGGRMMARIYEGGELRAYSFTADGVTPLPRNWPRLLHEGNWSALISGALN
FT                   VTVSVVLFGLLITGVLLWSRRRLRRRPQGTRTASGTAATGAA"
FT   gene            134722..135132
FT                   /locus_tag="RPB_0124"
FT   CDS_pept        134722..135132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0124"
FT                   /product="putative flagellar basal-body rod protein flgC"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04836"
FT                   /db_xref="GOA:Q2J3X4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X4"
FT                   /protein_id="ABD04836.1"
FT                   /translation="MSSISAIAVSGLKAATRRLEVSASNVANQQSTGALPTANGAVPAG
FT                   APQAYTPLQVTQTAVPGSGTQTSVTPTTPGTIAIADPQAPFADESGMVAAPNVDLAQEL
FT                   IGQMVAKYSYTANLATLKADRDMTKALLDTTA"
FT   gene            complement(135195..135911)
FT                   /locus_tag="RPB_0125"
FT   CDS_pept        complement(135195..135911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0125"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04837"
FT                   /db_xref="GOA:Q2J3X3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X3"
FT                   /protein_id="ABD04837.1"
FT                   /translation="MASETDVAARELAAPRRKAAAKRNTSAKPRRRTRTPDQTREALLR
FT                   AAIAEFAREGYGGARVDRISKAAKSNDRMLYYYFVSKEKLFHHVIEHCYAQLVASEEAL
FT                   DLDLTRPREALAALVAFNWQYYWENPELLSILASENLFKGRHVKNKIRDVFANAQFGLL
FT                   ERILNAGIDRRDFRPDCDRTFIYLSILSLTYFYRSNLYTLSNYMQIDLADQERRKAWLA
FT                   HVQAMIEDLVRRRDDR"
FT   gene            136074..137282
FT                   /locus_tag="RPB_0126"
FT   CDS_pept        136074..137282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0126"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04838"
FT                   /db_xref="GOA:Q2J3X2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X2"
FT                   /protein_id="ABD04838.1"
FT                   /translation="MAGRFAVKLVSVAVALMASGWRADAADQPPIRIGDVSSYSALPIG
FT                   ARGYRQGWELARDEINGKGGVLGRQLQIISRDDAGKPDAAITQAAQLVDAENVDLLTGT
FT                   ILSNVGLAVSDFAKRRKIFFLASQPLTDALIWDKRSRYTYRLRPSTYTQTTILAQEAAK
FT                   LPARRWATIAPNYEFGQAAVSNFKQELRRLRPDVEFISEQWPPLGKIDAGSVVQAMAAD
FT                   NPEAIFNVTFGSDLARLVREGTTRKTFANRTVVSLLTGEPEYLAPLKDEAPEGWIVTGY
FT                   PWNEIATPEHRAFVEAYRARFKDAPNIGALIGYINTLVLAKAIETAGSTETEALLAAME
FT                   HLKIDTPCGPISFRAVDHQSTLGIYIGKLAVRDGQGVMTDWRYVDGATHQPSDADVLAK
FT                   IKE"
FT   sig_peptide     136074..136151
FT                   /locus_tag="RPB_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.960 at
FT                   residue 26"
FT   gene            137318..138385
FT                   /locus_tag="RPB_0127"
FT   CDS_pept        137318..138385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0127"
FT                   /product="Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04839"
FT                   /db_xref="GOA:Q2J3X1"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X1"
FT                   /protein_id="ABD04839.1"
FT                   /translation="MKDSGMKLIAPRNNWYPLTWSRDVTRALGCHRILGIDLVVYRSEA
FT                   GEPIALDDVCPHRLAPLSIGKLKGDAIECGYHGMTFARDGRCIRIPGQPIIPPNARVPS
FT                   YPLHEKMGLVWIWPGDPALADPALIYDLPQYGQPDWHAAHGDALRIGTNYLNLADNLCD
FT                   PAHVSFVHLSTLGNAASEEIPVEHTVNARGVLVWRWINDAPPIPLFAKYGSFTGHVDRW
FT                   HYYDYRAPSIAVIDFGSAEAGAIADPEQRDAGLRIFACHFITPVDDHSCIDHWLHVRNF
FT                   ALNDPDVDQRLHADFRIAFNEDKEILERIEQVDRARPGFKRIRLGIDVAPQRMRRIVER
FT                   MVAEEAEPRAAIPAE"
FT   gene            complement(138422..139462)
FT                   /locus_tag="RPB_0128"
FT   CDS_pept        complement(138422..139462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0128"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04840"
FT                   /db_xref="GOA:Q2J3X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3X0"
FT                   /protein_id="ABD04840.1"
FT                   /translation="MMIHEDLRPDDASPYLLDVNDLVVHFRTGRKRPWGKPSFVHAVDG
FT                   VSFRVRRGTTFGIVGESGSGKSTTAQAIMRLVPSTSGQIVFRGEDIMPLSGEPLRQVRR
FT                   HVQIVFQDPFSALDPRRRAGDQIREPLDLLQIGTSRERDERVRQLLAEVGLPPEAADLF
FT                   PHQFSGGQRQRLCIARALAPEPELIVCDEAVSALDVAIQAQILNLLKKLQRERGLTYIF
FT                   ISHDLGVIQQFCDEIAVMYLGKIAEQAPASALFTGPRHPYTWSLVSAAVPPGPLRDELK
FT                   AKYLVKGEPPSPVDPPPGCRFAQRCPFTIERCREELPFLDATGPEHYVACHRKDELGVP
FT                   DFAPKS"
FT   gene            complement(139459..140463)
FT                   /locus_tag="RPB_0129"
FT   CDS_pept        complement(139459..140463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0129"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04841"
FT                   /db_xref="GOA:Q2J3W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W9"
FT                   /protein_id="ABD04841.1"
FT                   /translation="MTMAPVLEVDKLSVSMTDRHGDLVPVLENLSFTIDKGKTIALVGE
FT                   SGCGKSMTALAIMRLLPEGFVITGGRVLLEGEDVLAVHNRRMRALRGDAVSMVFQEPMT
FT                   ALNPLYTVGDQIAEVLYYHRRMSRKDAAEQAVQFLKAVQIPAAEQRAKAYPHQLSGGMR
FT                   QRVMIAMALACKPKLLIADEPTTALDVTVQAQIFDLLAKLQDETETAIVLITHDLGAVA
FT                   ELADDIAVLYAGRCIETGPSHEIAAAPRHPYTRGLLACVPHLAVGVAKPPQWIDLGEIP
FT                   GMVPSLGQRGPDCAFLPRCANARDVCRSRPQPPLDAVSTGHAVSCWRAEEIAA"
FT   gene            complement(140460..141380)
FT                   /locus_tag="RPB_0130"
FT   CDS_pept        complement(140460..141380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0130"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04842"
FT                   /db_xref="GOA:Q2J3W8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W8"
FT                   /protein_id="ABD04842.1"
FT                   /translation="MSTLDQTLIVAQTAPPPAAPGALPAAKAVSPASAAFRQFLKSPSG
FT                   VAGAVLLIVLVSGTLFGPWIYSLDPLEIVGLPFTPPSADAWLGTDYLGRDVLAGLVHGG
FT                   RATLTVGAVAALLTIAIGVTVGSLAGFFGGWIDSLLVKIAEFFQVLPPLLFAMVLVTLF
FT                   GPKLMTITLAIGAVSWTSAARLTRAEFMRLRDLDFIKASRAAGAGNLHLILRVVLPNAL
FT                   PPIIVSATLAIGVAILFEGGLSFLGLGDPNTMSWGLMIGQNRNYVLDAWWAVTFPGAAI
FT                   FLSVLAISLVGDGINDAVNPRLRRR"
FT   gene            complement(141377..142357)
FT                   /locus_tag="RPB_0131"
FT   CDS_pept        complement(141377..142357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0131"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04843"
FT                   /db_xref="GOA:Q2J3W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W7"
FT                   /protein_id="ABD04843.1"
FT                   /translation="MTLLTHLFGKLANAAALLLAVLVLNFCLIHLAPGDPVQVIAGEMG
FT                   GASAEVIAELRAKYGLDQSLLQQLFTYLGNVVQGDFGYSYYFNQPVLNLIAQRLPASLY
FT                   LALSSLFTAVVIGTLLGVVSARRPNGALSHVVTVLSLTGYAAPIFWTGLMLLLLFGSVW
FT                   PVLPVSGMADVVNPKAGFAYALDVATHLVLPSLTLALVFIAQYSRLARVNMIDVLSADY
FT                   VRTARAKGLPERVVIFKHALRNALIPIVTVVGHQFGNLFAGAVLVETVFSWPGMGRLVF
FT                   DSILRRDYPTLMAVLFFSAVMVIAANIITDLVYRLVDPRIRAGAR"
FT   gene            complement(142384..143982)
FT                   /locus_tag="RPB_0132"
FT   CDS_pept        complement(142384..143982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0132"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04844"
FT                   /db_xref="GOA:Q2J3W6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W6"
FT                   /protein_id="ABD04844.1"
FT                   /translation="MKLTKRSFVIGSLGGLAMLGLPADLRAQQAGGGTLVIGSTQVPRH
FT                   FNGAVQSGIATALPSTQIFASPLRFDENWNPQPYLAKSWEVAPDGLSITLKLVDDAVFH
FT                   DGKPVTSEDVAFSIMTIKANHPFKTMLAAVDKVETPDPKTAVIKLAHPHPALLLAMSPA
FT                   LMPILPKHVYGDGQDVKAHPANLKPIGSGPYKLAEYKQGEYYTLEKFDKFFIPGRPKLD
FT                   KIVVRLISDPNALMVSAERGEVHAVPFVTGVRDIDRLEKSKNLKVVDKGFAGLGALNWL
FT                   AFNTKKKPLDDVRVRQAIAYAANRDFIVNKLMGGKAMPSTGPIAPGSPFEEKNVQLYKF
FT                   DVAKAKKLLDEAGLKPDGNGVRATLTIDYLPGSDEQQRNVAEYMRSALKRVGLNLEVRA
FT                   APDFPTWAQRVSNFDFDLTMDSVYNWADPVIGVDRTYLTSNIRKGIIWSNTQQYSNPKV
FT                   DEILGKAAVETSAEKRKALYSEFQKIVVDEVPVFFINAVPFHNAFANGLGGLPTTIWGV
FT                   VSPLDEVHWVTPPKT"
FT   sig_peptide     complement(143899..143982)
FT                   /locus_tag="RPB_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.892 at
FT                   residue 28"
FT   gene            complement(144067..145023)
FT                   /locus_tag="RPB_0133"
FT   CDS_pept        complement(144067..145023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0133"
FT                   /product="Cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04845"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W5"
FT                   /protein_id="ABD04845.1"
FT                   /translation="MTGSSATIPVTVIGGFLGAGKTTFVNHLLATGSPRTAVLVNDFGE
FT                   INVDATLIASHDGSTMTLTNGCICCSIGTGFIDTMCKVLDAEVPFERIVIEASGVGDPW
FT                   KIAEIALIEPSLRLERVVVLADASRIVQLIDDARVGDTVCGQFAQCDVVLLNKSDLVDV
FT                   AGLAAARAALLALRPGLRIIETSRAALPTLASLDVGAAMSAFRADSPDAVPRDHGAAFR
FT                   SWAYRRDGAFDRARIAGALAALPPELLRLKGSCRLAGEAGAHVFQLVDRAWSLTPPAPD
FT                   QPVSPGIVLVGVGTCDLPPPAVLDAILDRALAAGASS"
FT   gene            complement(145020..146663)
FT                   /locus_tag="RPB_0134"
FT   CDS_pept        complement(145020..146663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0134"
FT                   /product="Amidohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04846"
FT                   /db_xref="GOA:Q2J3W4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W4"
FT                   /protein_id="ABD04846.1"
FT                   /translation="MNHDTVVYSARNIITMNPSRPAATHVAVRDGRIVATGTAGELCVG
FT                   GARLDNRFADKVLMPGFVEGHSHIMEGLMWKLPYIGAFDRRSPEGRIVAGVPDIDAIVA
FT                   RLQQAEALLQEPNTPLFAWGFDPLHIGGKMLTRQDLDRVSTTRPVVVVHASFHINNVNT
FT                   TTLERAELLHATNISGVVAGADGLASGELQGIPARMRLFRSLGNNPQTGNITAADVARY
FT                   AASCCVQGVTTVTDLHNDMSDQTVEVYRAATEAADFGVRLVPALAAVSHTPEQGVAKIE
FT                   ALRQGGNDRLHYGIVKLVVDGSIQGFTARLRWPGYHNGVANGLWYIAPEELPRLVGAYH
FT                   RAGIQLHIHTNGDEATELALDAIEAAQIDTPRPDHRHTLQHCQMADAAQFRRMKALGVC
FT                   ANLFANHVYYWGDSHYELTMGPERAARLDATGTAQRIGVPFAIHSDAPVTPLAPLFTAW
FT                   CAVNRVTSGGRVLGRDTEALTVPQALAAITIGAAYTLKMDHLVGSIETGKFADFVVLED
FT                   DPLTVAPERLKDIAIWGTVVGGVVREAPRA"
FT   gene            146884..148467
FT                   /locus_tag="RPB_0135"
FT   CDS_pept        146884..148467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0135"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04847"
FT                   /db_xref="GOA:Q2J3W3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W3"
FT                   /protein_id="ABD04847.1"
FT                   /translation="MGKLAQLAYQEAGRNGSLDRSANASANAASLGNSDALFWGALFRG
FT                   MDRGGSFLQLQIRQIIVTAIEDGRLPLGMRMPSSRDLAAVLKVSRNTVVIAYEQLVDQN
FT                   FLVSRQRSGYFVAGLSKKVASGAGKPAEAASRDDAHWAARYAVQPSAHRNIVKPADWQA
FT                   QPYPFIFGQFDPSLFPTNDWRESARAALSVPEINNWARDLIDGDDPALIEQLQLQVLPR
FT                   RGIHARSDEIMMTIGAQHALYLIATLFINDRTRVGIEEPGYPDARNIFRMLTPDVVPLA
FT                   SDAQGLLPDERLQSCALAYVTASHQCPTATVMPLQRRLELLKAAETGDVVLVEDDYEGE
FT                   LMPEAATLPPLKSLDHASNVLYVGSLSKALAPGLRLGYVVAPAPVIRELRALRRLMLRH
FT                   PPLNNQRVAALFIGLGHYRSHLAQVGRVLLERAKMLDRLLPKHLPDCSFSRGPGSTNYW
FT                   IACPPGTDTTALAREALAQGVVIEPGAVFSMDETASRHCFRLGFSSIRTDRIETGIQRL
FT                   GEVIAEYLKK"
FT   gene            complement(148488..149276)
FT                   /locus_tag="RPB_0136"
FT   CDS_pept        complement(148488..149276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0136"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04848"
FT                   /db_xref="GOA:Q2J3W2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W2"
FT                   /protein_id="ABD04848.1"
FT                   /translation="MQNLIAAAQASFLGALPTPGAIAATLAAVMAAALLRGFTGFGFAL
FT                   AAVPLMGLVMAPAKAVPIAVLLQLLGGLADLRRNRRDCHWPSLRWLIVGAVIGSPLGVL
FT                   ALSVAPAPVARIVISVIIALAVLMLGRGFALAAVPSRFATVLVGATSGLFNGLAAMPSP
FT                   PAIVYYMSGPFRAATARASLLVFFLATSIAAFTSIVAVGLASSAVVWLAVLALPVMLLG
FT                   TWIGELGFRRGTERLHRHVSIVSLGVIALISAAKGFSELM"
FT   sig_peptide     complement(149205..149276)
FT                   /locus_tag="RPB_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.876 at
FT                   residue 24"
FT   gene            complement(149285..150796)
FT                   /locus_tag="RPB_0137"
FT   CDS_pept        complement(149285..150796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0137"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04849"
FT                   /db_xref="GOA:Q2J3W1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W1"
FT                   /protein_id="ABD04849.1"
FT                   /translation="MINIATRIDPAIASAVSETITQLHGRHLIGNALVPAVAGATLEVL
FT                   DPATGAVLGEAPAATTDDVARAVDAASAAFPGWAATPSRQRGKLLAEAARAIAAKSGAL
FT                   AAVLALETGKAIRTECRGEIATAIDIVTMYAGLASELKGETLPFDPQILTYTSREPLGV
FT                   VAAILPWNVPLVLMMLKIAPALVAGNTVVVKASEEAPFATIEMARLMAELLPAGVLNVI
FT                   CGTGRDCGSALVEHPAVAKVTFTGSQAVGELIYQTAARKIIPVSLELGGKSPMIVYPDA
FT                   DMARVVAGAIAGMRFTRQGQSCTAASRIYVHNTLIDAFVAALRDAVAKLVIGDPLDEAT
FT                   DIGTVISQRQKAKIESYLALGERTAGAQVARCGELPRAGHLKDGLFLQPTIVTGLPEDS
FT                   PLMREEIFGPVVCVQPWDDEDDVIARANDSDFGLAATVWTHDLRTALRAVQRLDAGYVQ
FT                   VNQNLTIQPNLSYGGFRKSGLGKEASLEAMLEHFTKKKTVVIDMR"
FT   gene            151023..151457
FT                   /locus_tag="RPB_0138"
FT   CDS_pept        151023..151457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04850"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3W0"
FT                   /protein_id="ABD04850.1"
FT                   /translation="MSDPAVSDPAVSDLDALRLRKLELVFEAFNRHDGAGVMSAMTDDV
FT                   VFDAAAGPEACGRRIVGTAAVRAAFEGTFATFPDVSWECTRHAVFGDRGISEWVFRATA
FT                   KDGSRIEAEGVDLFGFRGELICSKSAFRKDRPALPAQGAA"
FT   gene            151457..152851
FT                   /locus_tag="RPB_0139"
FT   CDS_pept        151457..152851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0139"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04851"
FT                   /db_xref="GOA:Q2J3V9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V9"
FT                   /protein_id="ABD04851.1"
FT                   /translation="MNRPLKTPPVAAYDPHYDPLVSDGPGHNRDYAPTYWHATAGPLPA
FT                   DDGPVTSDIDADVAIVGSGYTGLACAIYLAREHGIKPIVLEANRVAWGCSTRNGGQGQN
FT                   AAGRLTRSQWIARWGIDVAKQLHAEIRDGFDTFEELIRQSPIDCEPQRGGHLYIAHRQR
FT                   NLDKIAAEAKVLRDVFGEKTSVVSAEQLRSDYLNEAEAVGAVLEPLGTGVHPAKLAFGY
FT                   QQMARDLGVRIHPASPVAEIQSRDGALYLRTPGGTVRARAVGIATGAYTAPGLTPALRG
FT                   RCMPILSNSIVTRPLTAAELDATGFRTKLVLTDTRTLRYYYRLLPDNRIQIGSRSSITG
FT                   ADADHPKHLQLLIDGLHRKFPALQGIEIDYSWWGWVDVSHDMMPRIFQPDQQTKMFYAL
FT                   GYGGNGVSYSAQAGRRMAQMIAGQHFKGQDLPIFTSPLPTHTFEPFRRLGQRMLYRWYH
FT                   MRDEAA"
FT   gene            complement(153001..153903)
FT                   /locus_tag="RPB_0140"
FT   CDS_pept        complement(153001..153903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0140"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04852"
FT                   /db_xref="GOA:Q2J3V8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V8"
FT                   /protein_id="ABD04852.1"
FT                   /translation="MIESAAIRYFREVTESGSIKQAAATLRIAPSAISRQIQAIEEEMS
FT                   VKLFERNARGMALTDAGRLLYRYAVENRSQLDGIRAKVQEFETMRRGQIRFATVEGMLA
FT                   NFLSNFLVELSVDYPGIFVSTTVVGSRAVAELVGRNEVDLGLVFGRAPRRDLIELARMR
FT                   QSLCLIVAPDHPMADREACAVKDLAGLRVIVPDPSFGIRQEVDRACANAKVRLEICSET
FT                   NSLAFAQMLASRTDLATFLPRDTAMPAIAAGRLVAVPLRDKRLEATQVTLVQLATRNIS
FT                   PSCRMVADLLIARMKRARE"
FT   gene            154064..155284
FT                   /locus_tag="RPB_0141"
FT   CDS_pept        154064..155284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0141"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04853"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V7"
FT                   /protein_id="ABD04853.1"
FT                   /translation="MLHAWVARCVRLSIPLGIAALASGIQISAASADDVIKIGAPLPIT
FT                   GPLAPEAIKQQQGYNLWAEQANKAGGISVGGKKYKVEIVYTDYQSNTPRAVQATEQLIT
FT                   QNNVNFVFSPFGSGAAKAASTVSEKHKVPTLAATASSSQVYDQGYKYLFGTFTPNDTLT
FT                   TPLTEMIKAKVPEVKKVAILARNDLFPLAIAQEMEKSAKANGLEVVYFEKYAIGTLDHS
FT                   ATLSSIKAQSPQWIFVTGYTNDLLLVRKQMIDQQMKAPVVSMIAGPAYQEFIDALGKGA
FT                   ENVSSAAWWHPAARYDGKDIFGSTANFVKLFKDKYNAEPDYAHASAALCGALFQIAIEK
FT                   AGSIDRDKVRDELAKMDVVTFFGPVKFGANGQINSLDPPVFQIQGGKPVVLFPQAIKQG
FT                   DLKIGLE"
FT   sig_peptide     154064..154162
FT                   /locus_tag="RPB_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.936 at
FT                   residue 33"
FT   gene            155520..156386
FT                   /locus_tag="RPB_0142"
FT   CDS_pept        155520..156386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0142"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04854"
FT                   /db_xref="GOA:Q2J3V6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V6"
FT                   /protein_id="ABD04854.1"
FT                   /translation="MQAVQILINALVLGSLYACIAIGFSLVWGVLNVINLIHGSFIVLG
FT                   AYLAFGLYQSLHLSPWYAIVVAAPVFFVFGYIVQRLILNRVITAPVLVTLTLTFGLDLI
FT                   LNNAMIYVFTADYRRLTLIPPLGSVSFEGVVVPVDRLIATATALALTGLLYLLLRRSRV
FT                   GRAIVAVRLDRDAAVLMGVHVPSIYAVAFGLGAALAGCAGVLMALIFPISPLTSSAYLG
FT                   KAFVVCVLGGLGSVSGALAGGMLLALVESVGSAFFGPAHATTLSFLLLIIFLILRPQGL
FT                   VGRKGFE"
FT   gene            156383..157318
FT                   /locus_tag="RPB_0143"
FT   CDS_pept        156383..157318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0143"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04855"
FT                   /db_xref="GOA:Q2J3V5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V5"
FT                   /protein_id="ABD04855.1"
FT                   /translation="MSRSNIALLVLIACVAALPLFGGAYALRLGTIACMYAVLALSWNV
FT                   VGGFAGYPSFATAAFFGFGAYCGGVLMGKGFPLWAAAAVAGLLALVSAVALGAVLLRLR
FT                   GHYFAIASLSLAEVLREVVNNATDLTGGGMGLNIPLASGAGVMAEATFFFYAMWGVMLI
FT                   TALMVIVVANSKLGFALNCIRQNETASSMVGLNTTLAKSIAFGLSACFVSVAGGIYAAW
FT                   VHYIDPSDVFDILYSVKPIVMALMGGLGSPLGVACGAFMYLGLEEVVWRNYTHIHTGVL
FT                   GVLIVMLLLFLPHGLSSLRFDRLRRRTKHV"
FT   sig_peptide     156383..156451
FT                   /locus_tag="RPB_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.588 at
FT                   residue 23"
FT   gene            157311..158060
FT                   /locus_tag="RPB_0144"
FT   CDS_pept        157311..158060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0144"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04856"
FT                   /db_xref="GOA:Q2J3V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V4"
FT                   /protein_id="ABD04856.1"
FT                   /translation="MSELLQLTGVSRHFSGLQALRDVSLSVSGGEVLGLIGPNGAGKTT
FT                   LVNTICGVTPANSGTVSFDGRDITKIKTYQAARLGLARTFQIVQPFAEFSALDNVAAAA
FT                   LFSQPGASLRSAREAAREHLAFVGLEPQADQSAATLTLAMRKRLELAKALAMKPKLLFL
FT                   DEVNAGLNSAEVERATSLIHQLAANGITIVMIEHLMKVVLNVCTRIVVLHNGQLIADGA
FT                   PREVISNPAVVEAYLGQQYAKRTARNG"
FT   gene            158053..158784
FT                   /locus_tag="RPB_0145"
FT   CDS_pept        158053..158784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0145"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04857"
FT                   /db_xref="GOA:Q2J3V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V3"
FT                   /protein_id="ABD04857.1"
FT                   /translation="MASELILEAKGLDAGYGEIQVLWGIDLAVRRGEITALIGSNGAGK
FT                   TTLMRALSGLIPVRAGRYLSEAEDITGSTAAQILTHGIVHVPEGRRLFGAMSVEENLMM
FT                   GAYLRKASRAEIKRDLDRVYATFPKLRERGNQQAATLSGGEQQMCAIGRGLMSAPKLLM
FT                   IDELSLGLSPLLVEQLVDALRVLNAGGTSILLVEQDVTIALDLCHRAFVMDMGRIVREG
FT                   SGEDLLADPIVRDAYLGVLQD"
FT   gene            158821..159570
FT                   /locus_tag="RPB_0146"
FT   CDS_pept        158821..159570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V2"
FT                   /protein_id="ABD04858.1"
FT                   /translation="MIETVEAPNSGYRYMPGVFQYSCGIAALPGFAIERVRFAEPVPLK
FT                   QGFAKIAEILKAAGRPLTAFGACELRSPAPFTEDGFKAFNEIYIQTLVDWGIMKDGINP
FT                   IARSNVCPQIDPPAEPSFYAFSYTVPADNAPKSFVIAGSGEAPEGKGNYRDHTVALGDT
FT                   SPAGLQKKAQFVLGEMERRMSAFGGSWRDITGAQLYTVHDIHPFLESELGNRGVFRHGL
FT                   TWHFNRPPVEGLDYEMDCRCVHRERVV"
FT   gene            159570..160388
FT                   /locus_tag="RPB_0147"
FT   CDS_pept        159570..160388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0147"
FT                   /product="L-aspartate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04859"
FT                   /db_xref="GOA:Q2J3V1"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V1"
FT                   /protein_id="ABD04859.1"
FT                   /translation="MRSGRAPQRVAIAGLGAIGKAIARELDRGLDGLTLGAVASGDPEK
FT                   HRAFLDGLRTTPPVVPLDQLHAHADLVIEAAPSRLLRAIVEPFVSRGRTAIVLSAAALL
FT                   QNEDLIDLANLNGGQIIVPTGALIGLDAVTAAAVGTIHSVRMITRKPVDGLRGAPFIVD
FT                   NGIDLDGLREPLKLFEGTAREAGKGFPANLNVAVALSLAGIGPDRTMVEIWADPGVTRN
FT                   THRIEVDADSARFAMTIENVPSDNPRTGLITPLSVIALLRKQSAALRVGT"
FT   gene            160667..163552
FT                   /locus_tag="RPB_0148"
FT   CDS_pept        160667..163552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0148"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04860"
FT                   /db_xref="GOA:Q2J3V0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3V0"
FT                   /protein_id="ABD04860.1"
FT                   /translation="MGSMPLALIALIPLFGAVLPLVAIRSGRNACTIVTASISLVALVV
FT                   LLAHAPAVFDGETIRSGTEWVPALGLSFRFFLDGLGLFFAAMILVIGLLVIVYSRFYLG
FT                   RNDPMGRFFAFLLLFQGAMLGIVTSDNMLLLVVFWELTSLSSFLLIGYWSHLPEGRQGA
FT                   RMALVVTGGGGLLLMAGMLLLGQAAGSYELTEILQRGDAIKASPLYVPILLLVLGAAFT
FT                   KSAQFPFHFWLPHAMAAPTPVSAYLHSATMVKAGIFLLARLWPVLSGTEWWFWIVATTG
FT                   LVTMLIGAWIALFKDDLKGILAHSTVSHLGLMTMLLGFGTRFAVIACIFHVLNHATFKA
FT                   ALFMSAGIVDHETGTRSLRRLGGLARRMPISAVLALIAAASMAGVPLFNGFLSKEMMLE
FT                   AAADTQVFGSVWLVPAAATLGALLSVAYSVRFAVSTYLGRPRAVLDVTPHDPPFGMWAP
FT                   VAALVIPVVAIGLAPQLLAGAVVERTAQAVVGAAELDFHPLAIWHGLTWPLAMSAIALA
FT                   GGLLLLIVHAPIETLRGWLPRPDAKTMFDAVVAAAVRSARWTIRRLHTGSLPRYLMVIT
FT                   LTILAVGAVGFFGGRHDAGLRATLPASLPAAAAWILLVAASLGVMMFHIHRLLTLILSS
FT                   VVGLVVSLTFMQFSAPDLALTQISVEVVTVILLLLALNLLPKLTPPDPQFGRKLRNSLI
FT                   AGCGGLAAGALAYAVMTRDVSSISAYHLAESKPGGGGTNVVNVILVDFRGYDTFGEIIV
FT                   LCIAALVIYALLSNALEGAAARRLDSMRQHVDSADAHPLLLVVAARALLPLAITVGAYI
FT                   FLRGHNQPGGGFIAGLVVATAVIMQFMASGYTWSAEQRRIDGHRLLGAGVLAAAATGIG
FT                   ALLFGRPFLTSAFVYVPVPLIGDVELATAILFDIGVFLTVVGTVVLSLSQIARVERRAK
FT                   RSPVPPGPSDIPILPRARMRPRSAAPSAEEG"
FT   sig_peptide     160667..160759
FT                   /locus_tag="RPB_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.768) with cleavage site probability 0.354 at
FT                   residue 31"
FT   gene            163553..163915
FT                   /locus_tag="RPB_0149"
FT   CDS_pept        163553..163915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0149"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04861"
FT                   /db_xref="GOA:Q2J3U9"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U9"
FT                   /protein_id="ABD04861.1"
FT                   /translation="MEILVASGIGVLTMVGLYLVLSRHAFPVIIGTTFLSYAVNLFLFV
FT                   MGRLEIDKAPIITKGVTDYADPLPQALVLTAIVISFGMTALVVVLALRGFLETGTERVE
FT                   KGEPQRDARKRKAAQP"
FT   gene            163912..165447
FT                   /locus_tag="RPB_0150"
FT   CDS_pept        163912..165447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0150"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04862"
FT                   /db_xref="GOA:Q2J3U8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U8"
FT                   /protein_id="ABD04862.1"
FT                   /translation="MSHLIVAPIILPAVVAAFLVLVLRHDLTSQRIVSMASTLVLLAIT
FT                   IWLYVSAAEGAPTPYLLGEWRAPFGIVLVLDRLAATMLLLTALLAVAVLIYAIAGWDHR
FT                   GQHFHPLFQFQLMGLNGAFLTGDVFNLFVFFEVMLIASYGLMLHGGGARRLRTGFHYIA
FT                   INLVGSTLFLFAVGLIYAVTGTLNMADLAARVAQIAPGDEAILRVGALLLLLVFALKAA
FT                   LVPLQWWLPSAYAAAPGPVAALFMMMTKVGAYSIVRVYTVVFGADAGALADIAAPWVVP
FT                   AALATLALGAVGVLASPTLLGMVCFSIVWSMGSLLLALGLFDPVGLSAGLYYLLHSTLS
FT                   GAALFLLADLVAAQRGRLADRLVPAPRLPHADLLAGLFFVAAIAMTGMPPLSGFLGKLL
FT                   ILDATWRSPLAVTSWVILLGSSLLVIVGFARAGSTLFWKIADRPAEPAEPARSIALPVT
FT                   VIAGLLGATALLSVFAGPISRELAATAQQTLDIKAYVRAVNPADLALSRGAPQ"
FT   gene            165444..165932
FT                   /locus_tag="RPB_0151"
FT   CDS_pept        165444..165932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0151"
FT                   /product="cation antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04863"
FT                   /db_xref="GOA:Q2J3U7"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U7"
FT                   /protein_id="ABD04863.1"
FT                   /translation="MTRMFPHPILSLVIAGVFVGLINTLSLGSVVLGLLLGIAIPWFTS
FT                   PYWPNRPTVRSPLKLAAYLAIVGWDIVVSNVQVAYWVLFRRSASLQSQFVVVPLELTSP
FT                   EAIALLAGTITMTPGTVSADLAADGSAILVHCLHTTDPVDTVEQIKTRYERRLKEIFG"
FT   gene            165929..166198
FT                   /locus_tag="RPB_0152"
FT   CDS_pept        165929..166198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0152"
FT                   /product="Multiple resistance and pH regulation protein F"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04864"
FT                   /db_xref="GOA:Q2J3U6"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U6"
FT                   /protein_id="ABD04864.1"
FT                   /translation="MIATACLIAVGVISVSALMNLFRLATGPDVLDRILSLDTLTINAI
FT                   GLVVVIGIWFGTSLYFEIALLFASVGFLSTVAFCKYLLRGNVIE"
FT   sig_peptide     165929..166006
FT                   /locus_tag="RPB_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.857 at
FT                   residue 26"
FT   gene            166200..166619
FT                   /locus_tag="RPB_0153"
FT   CDS_pept        166200..166619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0153"
FT                   /product="Na+/H+ antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04865"
FT                   /db_xref="GOA:Q2J3U5"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U5"
FT                   /protein_id="ABD04865.1"
FT                   /translation="MTMAGLSELLVSALILIGAFFLFVGSFGLVKLPDVMRRLHAPTKS
FT                   TTLGIGSLLIASMLYLALLRDDPSLHELIISVFLFLTAPITAHMISKAHILRNRALQQE
FT                   LPQPPGDEGWATLDPHGANETRLDPEPTRSTNAKD"
FT   gene            complement(166744..167097)
FT                   /locus_tag="RPB_0154"
FT   CDS_pept        complement(166744..167097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04866"
FT                   /db_xref="GOA:Q2J3U4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U4"
FT                   /protein_id="ABD04866.1"
FT                   /translation="MTRSPARSASLLLIASGFVVWASAFSLLYGGLSFGCAFGWQQTMI
FT                   AGISLQRFVLLLILGVHLVALMGLLIYCLRLPRRTDDGTAAFTRRVAIGSNAAALVATV
FT                   WTGLVIPAVSACL"
FT   sig_peptide     complement(167029..167097)
FT                   /locus_tag="RPB_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.926 at
FT                   residue 23"
FT   gene            complement(167102..169627)
FT                   /locus_tag="RPB_0155"
FT   CDS_pept        complement(167102..169627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0155"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04867"
FT                   /db_xref="GOA:Q2J3U3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U3"
FT                   /protein_id="ABD04867.1"
FT                   /translation="MTNQRPDASAAAASPIRLHKQLEAVWGTPGGWGRLAAVNHTIVGR
FT                   RFIATAFVFFGIGGILAMLIRAQLATPRSAFLQPEIYNQVFTMHGTVMMFLFAIPMFEG
FT                   FAIYLLPKILGARDMAFPRLGAYGYWCYLFGGSMLLIAMAVGLAPNGGWFMYTPLSSRV
FT                   YTPGINSDIWLIGITFVEISALSAAVEIIATILKMRAPGMSLDKMPLLAWYLLVTAFMM
FT                   LFGFPPLILGSILLEVERAFDLPFFDPTRGGDALLWQHLFWLFGHPEVYIIFLPAAGMV
FT                   STILPVLARREILGYSAIVISIVALAFLSFGLWVHHMFTVGIPHLALAFFSSASTAVAV
FT                   PTAVQIFAWIGTLAAGRPQLKLPMLYLLGFFSVFVVGGLTGVMLAIVPFNWQVHDTHFV
FT                   VAHLHYVLVGGFVFPMLAAAYYWLPHITGRVPRHSLGVPAFWLIIIGFNVTFLVMHLTG
FT                   LLGMPRRIHGYGAETGWEWPNLISSAGSFVMAIGFALFTVDVLMHWLHGQRSTRNPWGA
FT                   GTLEWSIAVPPTNYAFASLPDVATRTPLQQRPDLGNHLARGGGYLGFVRHGWLETLGVD
FT                   VMSGRVEQIVRLPNRTLLPLFTALVTGVFFVAVLFKLYVVALLALPAIVAMLLAWTPVS
FT                   GERRDRGALPIGHGAAAVLHSEASSPPSLWALGLTLAADATAFASLAFGILFLWVVAPN
FT                   WPPPAMIAFAPWGISLSTAGLLLGFIAGRLATARRVIGSGRRREAALAVAVLGQIVALF
FT                   GIADVILAVPPPTQHAYAAATTIILIYAGLHAALAAVFAGFGIWRSRTGYVSQTRTVDL
FT                   RIGALWSDATAAIGIATLLIVYGLPRVMG"
FT   gene            complement(169624..170322)
FT                   /locus_tag="RPB_0156"
FT   CDS_pept        complement(169624..170322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0156"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04868"
FT                   /db_xref="GOA:Q2J3U2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U2"
FT                   /protein_id="ABD04868.1"
FT                   /translation="MRRCRAWFTAGIVAASGLPLAGCGGPLSTLDPAGPAASAIAELWW
FT                   VMLIGATALFMLVMGLLWWAFVRRGDGTTSPKLWLVGGGLLLPALVLTPLLGYGLLTGE
FT                   RLLAHPAADALRVDVEAKQWQWTFRYPGQGGGRFSVNELHIPAGRPVDLRVSSADVIHS
FT                   FWIPRLGGKIDAIPGHVNLIRLSAAQPGMYRGVCAEFCGTGHTIMDFSVEALEADAFAD
FT                   RLRALPQDKR"
FT   sig_peptide     complement(170254..170322)
FT                   /locus_tag="RPB_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.890) with cleavage site probability 0.261 at
FT                   residue 23"
FT   gene            170344..170826
FT                   /locus_tag="RPB_0157"
FT   CDS_pept        170344..170826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04869"
FT                   /db_xref="GOA:Q2J3U1"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U1"
FT                   /protein_id="ABD04869.1"
FT                   /translation="MPKTILEEVRAYDTNSIVALAGHPIHAMMVSFPIALVIATLGCDI
FT                   FYWWGGDPFWARAGLWASGFAFWLGVAASLAGTAELLLVEGIRKRAASWMHAIAGVMLV
FT                   SIAGANWGLRLVDHENVLPVGLMVSALGSVFVGIAGWHGGKLVFDHGIGLMVSTKD"
FT   gene            complement(170790..171284)
FT                   /locus_tag="RPB_0158"
FT   CDS_pept        complement(170790..171284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0158"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04870"
FT                   /db_xref="GOA:Q2J3U0"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3U0"
FT                   /protein_id="ABD04870.1"
FT                   /translation="MIAWLKAIHILALIVWCAGLLVLPGLFAQRSRLGRGPAVELNRFT
FT                   RTLFIAVTSPAAFVAVVAGTTLLFMREVFTTWMMLKLLAVGLLVIIHMRAGYLILSVFE
FT                   PEGYYAPWRRWVMTVVTVAVIGVILVLILDKPAIETAAFPPWMRQPGGLQSFVETIRPM
FT                   P"
FT   sig_peptide     complement(171198..171284)
FT                   /locus_tag="RPB_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.842) with cleavage site probability 0.835 at
FT                   residue 29"
FT   gene            complement(171281..172048)
FT                   /locus_tag="RPB_0159"
FT   CDS_pept        complement(171281..172048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04871"
FT                   /db_xref="GOA:Q2J3T9"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T9"
FT                   /protein_id="ABD04871.1"
FT                   /translation="MINPYCGAAPLPAELLSRWNVDPVLLVALGGGCVLHLGLLWRERE
FT                   GDRRSRMASAATAWALLFALFVSPLCALTSALFSARVAHHAVMVAIAAPLLAWSLPRRL
FT                   VPQRLGAASGSAAFVVHLVLLWLWHAPAPYVAALADPAMFWVMELSLLGSAMWLWSAVL
FT                   SPATRLGTTLALLLGSVVQMGLLGAVITFARTPLYEAHLGVTAPWGLTALQDQQLAGLI
FT                   MWVPASIPYLAAALALLASRLDQPVATIDEAVR"
FT   gene            complement(172510..173037)
FT                   /locus_tag="RPB_0160"
FT   CDS_pept        complement(172510..173037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0160"
FT                   /product="heme utilization protein HuvX"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04872"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T8"
FT                   /protein_id="ABD04872.1"
FT                   /translation="MVASVVTSEPADLRAYMADNPAAVIEDVARQWKVSPRDVIEALPP
FT                   GMARLGPGDGFVPAMADIAGWGEVTLIVHTEDAIFEFTGEVPAGEIGRGYFNLMQPKGL
FT                   HGHLKHDNCGGVAFVERPFMGKSSAFVAFLNQGGGIMFKVFVGRDSSRELRADQLVRFR
FT                   ALADRCGAGQGG"
FT   gene            complement(173056..173391)
FT                   /locus_tag="RPB_0161"
FT   CDS_pept        complement(173056..173391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0161"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04873"
FT                   /db_xref="GOA:Q2J3T7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T7"
FT                   /protein_id="ABD04873.1"
FT                   /translation="MFIAMNRFQVKRGAEQAFEAVWSARESYLGEMQGFIEFHLLKGPV
FT                   SDDHTLYSTHTTWADKAAFEAWTTSEQFRRSHARAGNETGESLYLGHPRFEGFEVLRTE
FT                   RKSAAAA"
FT   gene            complement(173463..175799)
FT                   /locus_tag="RPB_0162"
FT   CDS_pept        complement(173463..175799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0162"
FT                   /product="TonB-dependent iron siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04874"
FT                   /db_xref="GOA:Q2J3T6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T6"
FT                   /protein_id="ABD04874.1"
FT                   /translation="MVGLNSRIRALLLSGSVVALAVAPAAAQTATTSSPPNQQKQAKRQ
FT                   QAAKPAAQQQVQTPARDPRDALAQAGQGVQALDTITVSATKTEERAIDALAPASAITQG
FT                   QIERLQPNRLQDIFVATPGVAFQDRGDDPSTAINIRGLQDFGRVAVVVDGARQNYQRSG
FT                   HNAQGSFFLDPELIGGVDVVRGPSANVYGSGAIGGVVSFRTKDIDDVLRAGERWGVDMT
FT                   GSYGSNNARGLGSIFGGVRVDPTVDVFGGALYRTQGNYKDGAGTEIGNTGNDIAGGLLK
FT                   LTVRPADGHEIKFGGIFQDYNYDIGQFNRGPVLTAAQRALYQGSSVYESNVKNYTGTMS
FT                   WKYSRPDDMLFDWNISLYGNRTDNDQTKTYHNSTSGAAYCGTGNVGNNISGCVGDQRGY
FT                   RLDTIGIDANNTTRFDYGDWRTAVTYGFDVFNDKVTTWDSRGNSNITTPSGERTVSGGF
FT                   IQLKNNYASWLEVIGAARYDHYELSSETSSASGSRLSPKITVGVTPLAGLTPYVSYAEG
FT                   YRAPSITETLISGAHATGGGPALFTCADGTSGLFCLIPNTGLRPEVGKNKEVGINLKYN
FT                   DVFVSGDSFRGKINAFRNDVDDYIELVASTPQATIYGMYSKYYQYQNIPHARIEGVELE
FT                   TSYDAGLWFVGLSASTLRGVNTDTGLGLASVPSRKVVTSGGVRLLDRKLTIAAQWASYA
FT                   ANTNLPAGYLPATSYDLVNLNVAYRPTADVTLHFSVDNILNNYYRPYAIPGSSTDGTSQ
FT                   NDVLFSSPGAGIVYKGGIKVHFGGA"
FT   sig_peptide     complement(175716..175799)
FT                   /locus_tag="RPB_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 28"
FT   gene            complement(175990..176661)
FT                   /locus_tag="RPB_0163"
FT   CDS_pept        complement(175990..176661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0163"
FT                   /product="NmrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04875"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T5"
FT                   /protein_id="ABD04875.1"
FT                   /translation="MKVLIFGATGRTGRQLVSQAAAIGWSVHAAGRNADRLQDLGDAAA
FT                   ISVVDLAEAEEVAEVVKRVAPDAIIATVGGALPDGRLVDEFGNNAISDAAVSGGVRRLV
FT                   QISSLACGDSRPFASDRIIAAIGPVLEAKTRAEDHLRRLDLDWTIIRPGGLTDGAPTGS
FT                   GALYDDPRVHGMIARADLAAVVLPIVAVAATHGLTLSTVDRTTLAAEPAGLREFVVPAP
FT                   V"
FT   gene            complement(176722..178146)
FT                   /locus_tag="RPB_0164"
FT   CDS_pept        complement(176722..178146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0164"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04876"
FT                   /db_xref="GOA:Q2J3T4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR026332"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T4"
FT                   /protein_id="ABD04876.1"
FT                   /translation="MTMARATTSGGAPHGGHGHHPAAAAALQISDYFVRIGCDALTEAF
FT                   AKRSFSPPWRGSRPVDGDDVEAVLARIFATLRNETAVAYVHVPFCQTHCLFCGFFQNVW
FT                   RAEAGPAYVDDVLAELAARSSTPLIASAPIDAVYLGGGTPSALAADDLARLVEGLRRYL
FT                   PLTSDCEITLEGRGFGFDLAKAEKVADAGVTRLSIGVQTFSTQVRRRLGRKLAGPEVQS
FT                   FLADLVALGRTAVVCDLIYGLPGQTDDIWANDIEIVDRLGLDGVTLYALNMFPGGPMAR
FT                   AIENGKLAPPAAPGVQARVYAEAVERLAGRGWLQVSQSHLVRSAREFNRYNAAIKRGVA
FT                   CLPFGAGAGGQAHGYRWRNVIDIAQRRDMIAQQRAPVEGLAQVPADHAAHAMIAAGLEA
FT                   GRLDLAAIEALRPGFRAAVAPLLANWAAGGLGELSHDGFRPNRAGSFWISNLTSGLSAG
FT                   LQSATQAATSGCCASA"
FT   gene            178492..178689
FT                   /locus_tag="RPB_0165"
FT   CDS_pept        178492..178689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04877"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T3"
FT                   /protein_id="ABD04877.1"
FT                   /translation="MTAQTDNKNPTASAADPAAERAVSIVGNQLESRELFSLGREIVIA
FT                   HGGDRYRLRLTSQNKLILTK"
FT   gene            178686..179657
FT                   /locus_tag="RPB_0166"
FT   CDS_pept        178686..179657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0166"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04878"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T2"
FT                   /protein_id="ABD04878.1"
FT                   /translation="MIAAILSKPARYAIVSLLASTVVTASPGLAGDIAVRDALGREVVI
FT                   ADTSRTLSIGGAITEVLVALGLEQRITGIDSTSTYPPTAVKDKPNVGYLRQLSAEGVIG
FT                   LNPTLILAMDSAGPKQTMQAIESAKIPLVLIPEKLTEQGLLDKIRLIGHAMNADASANC
FT                   LATAVAEDFDQLRQLRAKIDRPLRVMFVMSLVNGQAMAAGRNTAANEIIELSGGVNAID
FT                   GYDGYKSINDEAIVAAKPDAVLTIRRSRDTFEADAFYAHPGFALTPAAKNRVFVAMDGL
FT                   YLLGFGPRTPAAARDVAATLYPQLASQAGDFKPKAASAVCRP"
FT   sig_peptide     178686..178778
FT                   /locus_tag="RPB_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.956 at
FT                   residue 31"
FT   gene            179654..180739
FT                   /locus_tag="RPB_0167"
FT   CDS_pept        179654..180739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0167"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04879"
FT                   /db_xref="GOA:Q2J3T1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3T1"
FT                   /protein_id="ABD04879.1"
FT                   /translation="MTVMEIGRRRVARSFRPRSGVTLAVLLVLLLICLALALTVGAAGI
FT                   PLSRLPAALGLLPAADAGPMAARDQMVLWSIRLPRILTAAIVGSLLAASGALMQGLFRN
FT                   PLADPALVGVSSGGAFAAASSIVLLDHALGDNLRFLQDHLLPVAAFAGSLVTTIALYRI
FT                   ASRAGRTSIALFLLAGLAIAAIANAGIGVLVYLADDRQLRDITFWMMGSLSGANWAKAS
FT                   STALVLLIALAVFVKVARHLDLLVLGESEAFHTGVDVERLKRLSIVLVSLMTGVAVSVC
FT                   GVIGFVGIVVPHLLRLLIGPSHRLLLPASACLGAVMLVAADTVARTIVAPAEMPIGILT
FT                   AAIGAPFFLVILLRQRKLVGL"
FT   sig_peptide     179654..179782
FT                   /locus_tag="RPB_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.925 at
FT                   residue 43"
FT   gene            180736..181524
FT                   /locus_tag="RPB_0168"
FT   CDS_pept        180736..181524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0168"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04880"
FT                   /db_xref="GOA:Q2J3T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3T0"
FT                   /protein_id="ABD04880.1"
FT                   /translation="MSTALEARKAGFATGGATLVHNVDLAVAQGELIAIVGPNGAGKST
FT                   LLRMLSGDLRPTSGSVRLGDRELSSYSPRELADRRAVLAQHINVSFPFTVEEIVRMGTG
FT                   DVGHRKAGALIDAALHEVGLGEFRSRDITTLSGGEQQRAHFARVLVQLWSSEAVRGPGI
FT                   LLLDEPTSSLDIRHQLDLAHTARRCARNGATVIAILHDLNLATRFAERIVVMHRGAVAA
FT                   DGPPSTVMRPELIGAVFDVELTVQMDASGSPFVLPELTRA"
FT   gene            complement(181561..182676)
FT                   /locus_tag="RPB_0169"
FT   CDS_pept        complement(181561..182676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0169"
FT                   /product="ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04881"
FT                   /db_xref="GOA:Q2J3S9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S9"
FT                   /protein_id="ABD04881.1"
FT                   /translation="MRIANIVELGVKELRGLLRDPMMLALIVYSFTFSIYSGSTALPET
FT                   LNHAAISIVDEDQSPVSQRIVTAFNPPYFSIPKLIDQREMDARMDAGLDTFALDIPPEF
FT                   QRDLLAGKSPTIQLNVDATRMTQAFSGGGYVQSIVTGEVDEFLAKHRAATTVPVEQALR
FT                   VRFNAELNKGWFGAINQLVSSITMLSIILTGAALIREREHGTIEHLLVMPVTPFEIMVS
FT                   KIWSMGAVVLLASSFALFVVVQGILAVPVYGSVALFLVGTALQLFATTCMGIFLATAAG
FT                   TMPQFGLLLMLILLPLQALSGGMTPRESMPQIIQDIMLIAPNTHFVSLAQAVLFRGAGL
FT                   DVVWPQLAALFAIGAVLFALALRQFRRFLAA"
FT   gene            complement(182676..185453)
FT                   /locus_tag="RPB_0170"
FT   CDS_pept        complement(182676..185453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0170"
FT                   /product="ABC-2 type transport system"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04882"
FT                   /db_xref="GOA:Q2J3S8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S8"
FT                   /protein_id="ABD04882.1"
FT                   /translation="MSDPAVGTDARAPVVRLAAVSLRYGKTLALDDVTLDLPSGCMIGL
FT                   IGPDGVGKSSLLSLVSGARAVQQGRVEVFGGDIADAAHRRDTCPRIAYMPQGLGKNLYP
FT                   TLSVFENVDFFGRLFGQGRRERAARIAELLESTGLSPFAERPAGKLSGGMKQKLGLCCA
FT                   LIHDPDLLILDEPTTGVDPLSRGQFWELINDIRAQRPGMSVIVATAYMEEAERFDHLVA
FT                   MNAGQVLATGTPADLLRQTGGKSLDAAFIALLPEDERRGHAEVVIPPRTTGTTGIAIEA
FT                   EHLTMRFGDFTAVDDVSFRIEQGEIFGFLGSNGCGKTTTMKMLTGLLAASEGTAKLFGN
FT                   EVDPNDMAVRRRVGYMSQAFSLYTELTVRQNLELHARLFQMEPAKIAPRIAEMERRFDL
FT                   AEVIDKLPDELPLGIRQRLSLAVAMIHSPDILILDEPTSGVDPIARDGFWQMLSDLSRN
FT                   DNVTIFVSTHFMNEAERCDRISLMHAGRVLISDTPGAIVASRSAASLEDAFIAYLEEAI
FT                   GTAATPSAPQTTAAQVTSAADEDAPHPPRASSSWFDLRRMLAYTRREALELQRDPIRAT
FT                   LALIGSVVLMFVLGYGINLDVEKLTFAALDRDDTAISRDYILDIAGSRYFAEQRPITDY
FT                   ADLDRRMRSGELTMAIEIPPGFGRDVSRGRSVEVGAWIDGAMPSRAETARGYAQAMHLG
FT                   WLKRKASELYGDAATAGSFQIAMRYRYNPDIRSVVAMAPAVIPLLLLMIPAMLAALSVV
FT                   REKELGSIINFYATPTTRLEFLIGKQLPYVVLAMLNFVMLTAFAIVVFRVPFTGSFLAF
FT                   GTGALLYVVFATALGLLLSTFMNSQIAAIFGTTLLTLIPAIQFSGLIDPVSSLQGAGAF
FT                   IGKIYPTTYFVDITRGAFSKGLGFEQMWGSFVPLLIAVPLLFGLGAALLQKQAK"
FT   gene            complement(185450..186520)
FT                   /locus_tag="RPB_0171"
FT   CDS_pept        complement(185450..186520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0171"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04883"
FT                   /db_xref="GOA:Q2J3S7"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S7"
FT                   /protein_id="ABD04883.1"
FT                   /translation="MASSWMRWVVIVAVVAVAGGGYFAWRTFGAKGLPPGIASGNGRIE
FT                   ATEIDVSTKSAGRIRDILVREGDFVTAGQVLARMDTDQLEAQRRQAEAQLRRASIGIET
FT                   ATSLVTQREAEREAAVAVIAQRDAQLDALERKLARAEALIKTSAVSQQVLDDDRANEQG
FT                   AKAAVAAAKAQLAASEAAISSAKAQVIDAGAAVDAAKAAIDSITVEINDSTLKSPRDGR
FT                   VQYRVAQPGEVIAAGGRVLNLVDLSDVYMTFFLPTAQAGQIAIGADVRLVLDALPQVVI
FT                   PAKATFVADTAQFTPKTVETEEERQKLMFRVKAHIPQELLRKYIQRVKTGLPGVAYIRL
FT                   DPKAEWPANLSGTLAQ"
FT   gene            complement(186920..187744)
FT                   /locus_tag="RPB_0172"
FT   CDS_pept        complement(186920..187744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0172"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04884"
FT                   /db_xref="GOA:Q2J3S6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S6"
FT                   /protein_id="ABD04884.1"
FT                   /translation="MKFVVLTDTHFVARGRRIYGLDPAERLRAAIGCINRDHPEIAFVI
FT                   VTGDLAHWGEDAAYEALAEVLGELRALTILLMGNHDKRDGFARYFPGVPRDADGFVQTM
FT                   QVFDAATVVTLDTLNEAAPNHEGLLCDARLAFLEHALTSAPTDRPLLLFQHHPPFDTGL
FT                   RYMDTIRLANPEAEWEVIARTRRPDYLFMGHLHRPIAGVWRGIPFHIQRALAHQVAFDL
FT                   VTEGHIPGSHEAPDYAHVSVEGDRIVIHQRSFLYDGPLFSLHDKAALERAEF"
FT   gene            complement(187741..188562)
FT                   /locus_tag="RPB_0173"
FT   CDS_pept        complement(187741..188562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0173"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04885"
FT                   /db_xref="GOA:Q2J3S5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S5"
FT                   /protein_id="ABD04885.1"
FT                   /translation="MKLIQLSDIHLTAPGATIGGRDPRRNFERALAHVLRDHHDAELMV
FT                   ITGDLSDWGDRDDYLWLRTTLDAFPIPTRLCIGNHDRRDVFLGVFPEYDDGGFVQGMHD
FT                   VSAGRCLFLDTVEPNTHAGRYCDARQVWLQRQLTGHPGPFLLFMHHHPMPTHLGPMDRI
FT                   GLSDGAAFRSIVGAHRNRIRHVFFGHCHLPLAGSIGGVPTSSLRGTNHASFPLFSETAM
FT                   LSASDLPQSYGVCFVGADYVTVHMVEFGYDGPIRVEGSPEYTAWDRETMVR"
FT   gene            complement(188622..189902)
FT                   /locus_tag="RPB_0174"
FT   CDS_pept        complement(188622..189902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0174"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04886"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S4"
FT                   /protein_id="ABD04886.1"
FT                   /translation="MLRTWMAAAAFTLAAGCAHAQTQTEVVLQYPYPELFTETHKQIAA
FT                   EFAKVHPEIKVTFRAPYESYEEGTQKVLREAVTNQVPDVTFQGLNRVRVLVDKNIPAEL
FT                   DGYIAAEKDFDKQGFHQAMYDIGTASGKVYALPFAISLPIVYVNVDLVKQVGGDPNNLP
FT                   TSWDGLIDLAKKVKALGPDYNGITYAWDITGNWLWQAPVFARGGTMLNADETKVAFDGP
FT                   EGQFAMKQIARLVTEGGMPNLDQPSMRAAFAAGKTGIHITSTSDLNKTTQMIGGKFTLK
FT                   THIFPDVVKPNGRLPAGGNVVLITAKDKAKRDAAWEVVKFWTGPKGAAIMAETTGYMPP
FT                   NKVANDVYLKDFYEKNPNNYTAVSQLALLTKWYAFPGDNGLKITDVIKDHLNSIVTGTR
FT                   AKEPDAVLADMTKDVQKLLPKSVGAAR"
FT   sig_peptide     complement(189840..189902)
FT                   /locus_tag="RPB_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(189933..190769)
FT                   /locus_tag="RPB_0175"
FT   CDS_pept        complement(189933..190769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0175"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04887"
FT                   /db_xref="GOA:Q2J3S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S3"
FT                   /protein_id="ABD04887.1"
FT                   /translation="MIDALKPNPWAVLRHVVLLCGALVVLTPFIWMISTASKPPAEIYT
FT                   SDVHLIPHHFALWDNLQEAFAKSNLGRFLLNGLIVTVSIFALQVLVALPAAYALAKLRF
FT                   VGRKTLFALVLFGILIPPQATAIPVFLLLHQIGALDSYAALVLPFTISVFGIFLMRQFF
FT                   MTVPDDLIDAARMDGISEFGIVWRVMLPTAIPAVTAFGIFSVVAHWNDYFWPLIVLNSE
FT                   QLRTPPLAVAHFRNAEAGTNYGPLMAAALVIITPLVVAFLLAQRRFIEGITMTGLK"
FT   gene            complement(190766..191710)
FT                   /locus_tag="RPB_0176"
FT   CDS_pept        complement(190766..191710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0176"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04888"
FT                   /db_xref="GOA:Q2J3S2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S2"
FT                   /protein_id="ABD04888.1"
FT                   /translation="MSDAASTLGTLPLARPASAVAARRSPRLGHAAAYGLVGPAFVLML
FT                   LMLLGPLLGVIALSFTDYQLGAPSLGWIGLANYQEMFADKVFWISLANTLTYVVIVVPG
FT                   AVALGLGVALLIQSGAGLRGFYRMVYFLPVMATLIAMAIVWEFMLHPQFGLVNGLLRSV
FT                   GLPAHGWLQDRNTALFSLCVIGIWQALGFNMVLFLAGLVSIPKSLYDAAEIDGAGSAWS
FT                   RFRLVTWPLLGPVTVFVVVITGIRSFQVFDTVHVLTKGGPSKSTEVLIHTMYMEGFEFF
FT                   RSGYAAALTVVFLVFVLALTLVKARLAARQVHT"
FT   sig_peptide     complement(191651..191710)
FT                   /locus_tag="RPB_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.827 at
FT                   residue 20"
FT   gene            complement(191703..192860)
FT                   /locus_tag="RPB_0177"
FT   CDS_pept        complement(191703..192860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0177"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04889"
FT                   /db_xref="GOA:Q2J3S1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S1"
FT                   /protein_id="ABD04889.1"
FT                   /translation="MARIELSAIRKSFDATDVLKGVDLTIEDGEFVSLVGPSGCGKSTL
FT                   LRIIAGLEPQTSGAVTIGGQPVDGVRPSQRNLAMVFQSYALYPHLSVYDNIAVPLRMKR
FT                   LSTLERLPALGRLLPNRHRIEREIRGEVERVAAQLELSAYLKRKPGQLSGGQRQRVAVG
FT                   RAIVRQPVAFLFDEPLSNLDAKLRVHMRAEIAQLHRRLGTTFVYVTHDQAEAMTMSGRI
FT                   AVMIGGELVQVGRPAEVYDNPRDIRVAEFVGSPKINVFPGHIRTDGAVEMLGHSLGVAV
FT                   PGMARPCRIGIRPERIELGATGAFAGAVVHVENMGAEAFVHLGVDGMPTPVLARIGDVR
FT                   ALPPLGSSTRFGVPPDAIRLFDAAGKRIETKPPAATHRAREVASV"
FT   gene            193028..193900
FT                   /locus_tag="RPB_0178"
FT   CDS_pept        193028..193900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0178"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04890"
FT                   /db_xref="GOA:Q2J3S0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3S0"
FT                   /protein_id="ABD04890.1"
FT                   /translation="MALTSARMRAINAVFETGSFAAAARHIGVSQSAVAQSVRELEAEF
FT                   DVALFERHGSSLIPTSLCRQLYGATSKMQAVEADALSILQQRGELAGGELRVGLGNSMP
FT                   GMALIAAFKRLYPKVQVAIEIGSWSAIVAAVVEQRVDIGVLPEVPADKRFRREICLAQR
FT                   VVALCHPDHPLQGREQVGIAELTQYPLVFRSRDSSTQRTVDRAFRDKGLRPAPSLIVNT
FT                   REGILEAVANQLGIGFMWEQGSSRTDGIARISVPELDAEVPECIFALAGKKGRLVELFF
FT                   LARGTHGVA"
FT   gene            complement(193912..195951)
FT                   /locus_tag="RPB_0179"
FT   CDS_pept        complement(193912..195951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0179"
FT                   /product="DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04891"
FT                   /db_xref="GOA:Q2J3R9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R9"
FT                   /protein_id="ABD04891.1"
FT                   /translation="MPFSTTLPPLARALAERHYSEATPVQSAVLAPDAAGRDLLVSAQT
FT                   GSGKTVAYGLAIAPDLLGEAERFEPAAAPLALIVAPTRELALQVHRELGWLYGATGARV
FT                   VSCVGGMDPRREQRELAEGAHIVVGTPGRLCDHLRRNRLDVSQLKAVVLDEADEMLDLG
FT                   FREDMEFILKTTPDSRRTLLFSATLPRGIIALAKTYQHNAFRVEVAGREGGHADIEYRA
FT                   IRIAPNDVEHAVVNTLRYVESPTAIVFCATRSGVTHLQTALLERGFSVVALSGELTQNE
FT                   RTNALNALRDGRARVCVATDVAARGIDLPNLGLVIHADLPNDPEVMQHRSGRTGRAGKK
FT                   GISVLLVPPARRRRAESLLGLAGIEAIWGTAPQADEIRVLDQQRMMQDALFTEETTPDD
FT                   QALAQALLAERSAEEIAVALARLYRARLPAPEDILDPGERPARGRDDRAPAKGARAPRE
FT                   ERDYGPRDPGSRARPGKAGQKHAITDGVWFRAAIGKRKNAEARWLLPMICRRGGIDRQA
FT                   IGAIRILDTTTEFEIAAAAAVDFAAQIKRPDKDDNIRIEPLIGAKPIEAGAERALSKPH
FT                   GGQLSERETRRSKRPDSWSPQIEPLADPRPPRAGKDAGFKDAGFKKKQVFKKDGFKPEG
FT                   FKQDGLKTKKSRDDKPAYVSKARRADPSAPNPGFKKKPKKKFRD"
FT   gene            complement(196286..196957)
FT                   /locus_tag="RPB_0180"
FT   CDS_pept        complement(196286..196957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0180"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04892"
FT                   /db_xref="GOA:Q2J3R8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R8"
FT                   /protein_id="ABD04892.1"
FT                   /translation="MQRLTTSGDRPSTARAFVYLTQILQKAAETVERDPALARCCIERA
FT                   VALLRDVQARHELIDEVPPETLDHPGLARWQLNRVVAHVEQNIDRSLRIRDLAQLIDLS
FT                   ASHFARVFRRSVGVAPRNFVLERRVARAKLLMQTSELPLSEVALACGLSDQAHLSRIFR
FT                   RFTGMPPNAWRRQRRDRESQDDGELASKPISRAVADSQPSRTTRFNRSTGAERAATSKL
FT                   A"
FT   gene            197228..197860
FT                   /locus_tag="RPB_0181"
FT   CDS_pept        197228..197860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0181"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04893"
FT                   /db_xref="GOA:Q2J3R7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R7"
FT                   /protein_id="ABD04893.1"
FT                   /translation="MTASSSPLIVVVDDDAGIRDALDGLFRSIGNHVISFESAQHLLTA
FT                   GVPNDANCMILDVRLPGTSGLDLQAMLTKLDIRIPVIFMTGYGDVPMTVRGMKAGAVDF
FT                   LTKPFRDQEMLDAVSAAIALDQRRRESDGRREDVLKRYAALTPREKQVFDMVSAGSLNK
FT                   NVAADLGLSEITVKIHRGRVMKKMGARSFADLVRMAELIAAPSRDPT"
FT   gene            197949..198338
FT                   /locus_tag="RPB_0182"
FT   CDS_pept        197949..198338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0182"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04894"
FT                   /db_xref="GOA:Q2J3R6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R6"
FT                   /protein_id="ABD04894.1"
FT                   /translation="MTIGKIVAVIDDDENVRIAIEGLVRSLGHRARGFASAQQFLESDV
FT                   DASAGCLITDVQMPGLNGLDLYAKLVADCRAPPVVFITAFPDERIEARARALGALGFLS
FT                   KPFDAQTLVHCIQQALSAGAGPSHR"
FT   gene            198370..203463
FT                   /locus_tag="RPB_0183"
FT   CDS_pept        198370..203463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0183"
FT                   /product="serine/threonine protein kinase and signal
FT                   transduction histidine kinase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04895"
FT                   /db_xref="GOA:Q2J3R5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R5"
FT                   /protein_id="ABD04895.1"
FT                   /translation="MKTITAPLDFVTRNADFGVYRIRNGAAQPRLLLIAEASEPCALQR
FT                   LEREFELTRSLDPGLVVRPHEMVSAQGRPALVVDDHGARPLAESFGHPASVPSLLRRAI
FT                   GVTQALGHIHDHGLVHRNLRPDTIWIDAADRVWLTGLGGASRSRRERRELAPHDAPPGS
FT                   PIYISPEQTGRVNRSVDSRSDLYVLGIILYQMLASGSLPFHASNPGQWIHHHIARRPNP
FT                   LPAAGAATAAIERLIFLLLEKSADDRYQTAAGVERDLRACLAAWESRGHTAGVRLTTHD
FT                   ASGVVRMPEKLYGRDAEINAILAAYHRAASTGVTEWVLISGYSGAGKSSTVKELRKSLT
FT                   PSNGCFISGKFDQYKRDIPFATLAQAFHSLVRQILGQDSEALARWRTSLQAALGDHGEL
FT                   MVNLVPDLSLVIGDQPALREMPQQERRSLFQAVLGRFVAAIARPEHPLLLFLDDLQWMD
FT                   KATSEFLIRLANDPQANHLLVVGAYRDNEIDPEHTLSKVLESIRSSQSHIEEIHLAPLD
FT                   QVHIRALVADALRCEPDEVAPLAALIHRKTGGNPFFAIQFFSSLLNEQLVGFDASRQRW
FT                   TWNVDLIEGKGFTDNVLDLMSRKLDRLPARTRAIVRIFSCLGMSADAALLARLSDMASD
FT                   EVHDGLQELVAHELVLRADDDYRFVHDRVREAAYRLIDPADLPAAHLEIARHFATSIPA
FT                   WPDALFRIVNHYNLGAALIETESERLAVARLNREAGRAAMKAIAYSSAHVYFTTALAML
FT                   GEQRWTRHADLVFEVEYQRAECEFLTGAMVEAEARLHDLVGRAPDAHTKAFVVALQITL
FT                   YTATDRSDRAIETCLANLRDSGIVWPRHPDRAEAGAEYQLLVQRLGSRPIDSLIDLPTI
FT                   TDQSRAAPLAVMSAALAPAFFTDLNLVCLLLCRMANISVQHGNCDASALAYAYLGMVVG
FT                   PCFGDYDAAFRFGDLGLRLVETRGLGHYKARVHLTYGAHVLPWARPLHEAQPYLRLAFE
FT                   EAIETGDLTYAGFSSCTLITNRLSAGDPLDEVEVEAGARLALMHRAKFGLIVHIITTQL
FT                   QFVKSLRNETVAIGSLNSEGFDEEAFERQLAANRSLDIALCWFWIRKMQACYFAGDYSV
FT                   AFVALLKAEPLLWTTVGHHEYSIFHFYVGVISAALAESPSPPEPRAELEQRLAEAHRRM
FT                   AAWEVHNPGNYKSATALLAAEIARLQNRPYEAMQLYQQAVASSRRVRVSQVEAIAHELA
FT                   ARFCHQQGFDTAAQAHLVRARDCYRQWGASAKVEQLDRAHPDLAATLPATAQMPLSIAE
FT                   SFDLAAVVKTSEAVSSEPGVHRLMETLMTLVLEHAGAQRGLLILPQGDALAIRAEARTG
FT                   DQGIQVLLRDDIASADELPTSMVNLAARTGEPITIDDAQYSPFSDDAYVVKAASRSVLC
FT                   LPLMKRNKLIAVIFLENDLAPGVFTPAKLSVLKLLSSQAAISLKNAFLEEKDALVEALQ
FT                   KSQSDLMRMSRLTAIGELVISIAHEINQPLTAIITNADVCLRWLGNEQPSIAEAQSAAR
FT                   RVIENGRRAAEVVQTIRGLAVKSTPPMSPVDINAVAREILTILQSELRQNNIHLETRLT
FT                   ESDAVVVGSKVQLQQVLLNLSMNAIESMTAIEGRRTLTVASAIGDADEVVVSVTDNGLG
FT                   FDENWIDQMFEALVTTKPQGMGMGLSISKSIVEAHGGRLWASSIKPHGARFQFSLPRSH
FT                   "
FT   gene            203612..203809
FT                   /pseudo
FT                   /locus_tag="RPB_0184"
FT   gene            203926..204768
FT                   /locus_tag="RPB_0185"
FT   CDS_pept        203926..204768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0185"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04896"
FT                   /db_xref="GOA:Q2J3R4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R4"
FT                   /protein_id="ABD04896.1"
FT                   /translation="MSSGYVKTKDGVDIYYKDWGPKQAQPIVFHHGWPLSSDDWDAQML
FT                   FFVAQGYRVVAHDRRGHGRSSQVELGHDMDHYAADAFAVAEHLDLKNAVHIGHSTGGGE
FT                   VARYVAKFGEPHGRVAKAVLVSAVPPLMLKTETNPGGLPIEVFDGFRKALADNRAQFFL
FT                   DVPAGPFYGFNRPDAKTLTGVVNNWWRQGMMGSALAHYDGIKAFSETDQTDDLKAITVP
FT                   TLVLHGEDDQIVPIDDSAKLSVKLLKNGKLKTYPGFPHGMLTTHADVLNADLLAFVKE"
FT   gene            complement(204850..206727)
FT                   /locus_tag="RPB_0186"
FT   CDS_pept        complement(204850..206727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0186"
FT                   /product="Amidohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04897"
FT                   /db_xref="GOA:Q2J3R3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R3"
FT                   /protein_id="ABD04897.1"
FT                   /translation="MTDAPDLILHRGLFTTLDRANPTASAVAIKGGRFAAVGHDRDILP
FT                   TAGPSTRVIDLKGRRVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLADAMNMLERQVAI
FT                   TPPPQWVRVVGGFTEHQFVEKRLPTIEELNAVAPDTPVFLLHLYDRALLNGAALRAVGY
FT                   TRDTPEPPGGEITRDANGNPTGLLLAKPNANILYATLAKGPKLPFDYQVNSTRHFMREL
FT                   NRLGVTGAIDAGGGFQNYPDDYAVIQKLDDEGLLTIRLAYNLFTQKPKGEKDDFLNWTR
FT                   TSKYKQGNDYFRHNGAGEMLVFSAADFEDFRVPRPDMPAEMEGELEEVVRVLVQNKWPW
FT                   RLHATYDETISRALDVFEKVNQDTPLEGLHWFFDHAETISDRSIDRIAALGGGIAVQHR
FT                   MAYQGEYFVERYGIGAAEATPPVKKILDKGVKVSAGTDATRVASYNPWVSLSWLVTGRT
FT                   VGGMRLTPQRNCLDRETALRMWTENVTWFSNEEGNKGRIAVGQLADVVVPDRDYFACSE
FT                   AEIADTTSLLTMVGGKVVYGAGDFAKLDDTAPPPAMPDWSPVRRFGGYAAWADDESGAK
FT                   VAATAMRMCGCANSCNVHGHDHATAWSSKLPIADLKSFWGALGCACWAV"
FT   gene            complement(206727..207014)
FT                   /locus_tag="RPB_0187"
FT   CDS_pept        complement(206727..207014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0187"
FT                   /product="Protein of unknown function DUF1427"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04898"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R2"
FT                   /protein_id="ABD04898.1"
FT                   /translation="MKLYLLSLGAGLLVGVIYSLLDVRSPAPPLVALVGLLGILAGEQI
FT                   VPVARQIIAGHGLAAAWHQAKCAPHMFGSLPGRSDQAPMQTARRNPPEKT"
FT   gene            complement(207040..207690)
FT                   /locus_tag="RPB_0188"
FT   CDS_pept        complement(207040..207690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0188"
FT                   /product="Isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04899"
FT                   /db_xref="GOA:Q2J3R1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R1"
FT                   /protein_id="ABD04899.1"
FT                   /translation="MSKLDMLTPDNSAIALIDYQPAMYQGVQSHDRLVVFNNIQILAKA
FT                   AKLFKIPTVLTTVAKDSFSGPFMPEVTDLFPSHDIIDRTSMNSWLDPNFRKAVAATGRK
FT                   KFVIAGLWTEACVMFPTLDMLKEGFEIYIPADACGDLSVEAHNRSMERAIQAGAVPITS
FT                   CQYAFELQQDWARSETYEGMMDILRAHSPYGIQIRFSKWALGEHASEGGTKAA"
FT   gene            208007..209626
FT                   /locus_tag="RPB_0189"
FT   CDS_pept        208007..209626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04900"
FT                   /db_xref="GOA:Q2J3R0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3R0"
FT                   /protein_id="ABD04900.1"
FT                   /translation="MTNVERDPPMTAETRASPWIAFRHTAFTVVWTATVVANVGTWMYN
FT                   AASGWLMTSLEADPLTVSLVQVASSLPMFLFAIPAGALADIVDKRRFLILIEIVLTVFA
FT                   AASAVLVWLGLMNPFQLLLFTFLLGAGAAFAAPAWQSIVPDLVPKEHLASAVASNGVGI
FT                   NVSRAIGPALGGVVIGVAGIAAPFWINALSNFAVIGALLWWRPAAKRAATLPPERLFSA
FT                   IVIGFRHARYNLDLRATLVRAVAFFFFASAYWALLPLVARSRIAGGPELYGILLGAIGL
FT                   GAIVGAFLLQGLKSALGPDRLVAAGTLGTAVSLVLLGSVQRVELATAACFIAGVSWIAV
FT                   LANLNVSVQVALPDWVRGRGLAMFVTVFFGAMTAGSALWGQLASSFGLPAAHFAAAVGA
FT                   VVGIAVTWRWKLRGSAEHDLAPSMHWPAPVLAIDADADQGPVLITVEYHVAADRRDAFL
FT                   LAMRKLSRQRRRDGAYAWDVFEDTSERGRFVEVFKVASWLEHLRQHDRVTNADRIDQNA
FT                   IRHFHASAEPRVTHLLAAKFPA"
FT   gene            210211..211887
FT                   /locus_tag="RPB_0190"
FT   CDS_pept        210211..211887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04901"
FT                   /db_xref="GOA:Q2J3Q9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q9"
FT                   /protein_id="ABD04901.1"
FT                   /translation="MPSPVRKRSADGSDKSDVWWLRKKVPARYRAIVGRGEVWRSLGTT
FT                   DLKAANVACVKLSAELERDWAARLHAAQDAGRVSSPRALTSRELSGLQRLVHEQTRDAQ
FT                   LANPPPRHAWGLDTGDRTDDEHLEELEYDEAKMASFLARNGFEVSEADQRRFLPLFLQA
FT                   RREAYRDLHRATRLDYSDSPLLAKYAPTPLPSVDFLEAFEFYCTSAGIKGGATGPTARR
FT                   WRSKIIEFCEFVNHADLARMTADDGYRWVDHLVDAKGIARKSVRDVWLASLKAVASFIV
FT                   ERRKLASNPFLGIRVRRADTGTKESNQKGFTDSQAVLILTATLANPSHLTIAETRAARR
FT                   WVPWICAYTSARVNEITSLLPSDVRQDPETAIWCFYLRPEMTKGDYMRVIPVHSHLIEQ
FT                   GLLNYVGEREGLSLPLFYDPRRAEGDTVAHPQWQKIAQRLAEWVVNSLGVTGVKPNHGW
FT                   RHRFKSVARHANMHPEVENFITGHGGSDDPGVIQRVSMRYGDAWVKTLKKTIELYPRYE
FT                   IEGLKRRPEPHRRPRRTRQIGAPGTRQASTATGHASHRDPE"
FT   gene            complement(212254..214485)
FT                   /locus_tag="RPB_0191"
FT   CDS_pept        complement(212254..214485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0191"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04902"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q8"
FT                   /protein_id="ABD04902.1"
FT                   /translation="MISAPLPDNEQARLTALRRYDILDTPSEDCFDIFPRLVVRAIGVP
FT                   SAVISFVDSERQWFKARINVTDQQTPRDIAFCAHAILRDRPLVVADATIDPRFHDNPLV
FT                   TASGGVRFYAGAPIRTAEGFAIGVLCAIDKVPRLLGKAQLETLRELASLVADQLDLRLA
FT                   NRRLAREVAERERTENHLRSMSRTLELSNLRLDAALNNFLHGLCMFDGDRKVVVSNARF
FT                   AGIYSLRPDEIRCGVSLSAIQSACRERGTFVESWSERRLGRCSDDISEVSSLQDGRTIL
FT                   VRCQPVAGGGWMTVHEDITERYRSEQQIAHMARHDLLTGLLNRGAFHERMDEACARLRR
FT                   WGETFSVIMLDLDRFKLVNDSLGHPAGDALLRAVVSRLKACIRETDVLARLGGDEFAVL
FT                   QTRTKDSYNEAVAFADRIVNCLIDPIEIDGHQLVISTSAGIALAPQHGTDSDELIKNAD
FT                   LALYRAKAAGRNGYVTFETAMKDRANARQQLEGELRQAILNREFDLYYQPQVEARSGRV
FT                   IGAEALLRWRHPRRGFVPPSEFIPVAEETGLIEKLGEWVLKEAAAEAIRWPAPIKLAIN
FT                   LSPVQLSRGNLTDTVTQALRLSGLPPERLEVEITENVFLEDEVNNLAVIRQLRSLGVSV
FT                   ALDDFGTGYSSLSYLTRFPFDQIKIDKFFSMNLIERSDCATIVSSVITLARGLGISTVA
FT                   EGVETVRQFELLREAGVDYFQGYLFGHPVPASALNFGAAHDITRITEVA"
FT   gene            complement(214614..216680)
FT                   /locus_tag="RPB_0192"
FT   CDS_pept        complement(214614..216680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0192"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04903"
FT                   /db_xref="GOA:Q2J3Q7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q7"
FT                   /protein_id="ABD04903.1"
FT                   /translation="MTSRTTRNGEPRSPGLFDVFTNRRIGTKVAIGFVLVQVLMVVLAV
FT                   LNYSSFEHVRQAFVALDQRVQVVGIVRDVDRGFTAFRRFVREYSLTGDEALISEAESRQ
FT                   NALRQSIAQGLKEIHDPSRLAKMREISQAFDAYTTSFADVFRMRRDQSKLIREVLDPTG
FT                   QQARLKLEQLQAAITANDGGETTSLLVAEAVKQLLLLRLDVNKVLGRHDQAAADAAEKA
FT                   LADLKTAMSALKTAIGSSAGRKQIGEIEVDIKNYANAYQKASRVAHEIEVLVNGTMPKA
FT                   ATAIAGDAANIKQSGIADQQKIAKDTEALLGDTKSQILIITAGVLVVGMLLAWLIGRAI
FT                   SRPIVQMSGAMKELAGGNLNVEVVGSGRLDEIGLMACTVEVFKNNALEVIRLREEQEEA
FT                   ERRSAAQHKAEMQQLADEFEGAVGEIIQTVTSASTELEASAGTLTTTADRSQELATSVA
FT                   AASEQASANVQSVASATEEMASSISEISRQVQTSARIAGEAVDQARKTNDRIGHLADAA
FT                   NRIGDVVELINTIAGQTNLLALNATIEAARAGDAGRGFAVVAQEVKALAEQTAKATGEI
FT                   SQQISGMQAATQDSVGAIREIGGTIERMSEIASTIASAVEEQGAATQEISRNVQQAAQG
FT                   TQQVSSNICDVQRGATETGSASSQVLAAAQSLSRDSNRLKDEVTRFVETVRAA"
FT   gene            217410..218393
FT                   /locus_tag="RPB_0193"
FT   CDS_pept        217410..218393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0193"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04904"
FT                   /db_xref="GOA:Q2J3Q6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q6"
FT                   /protein_id="ABD04904.1"
FT                   /translation="MTTSGANNVRVADSCRSWRTALAEPKRVSAVDRASEEVGRPPRSA
FT                   IRSWGQRKIEAGYWSIDWPGVIQREMSLSTRAFCELSMVLTPVDDMTLLRGETTIRTGP
FT                   LQSGRFRVAPANAALSASVSASGPVKFLKVFFAEETARAIGSAIHSHSIDIELEDPMLG
FT                   TNDPLLVALGREVVENMNDPRPTNRAFAEEAAILMAGRVVSHYSTARYCTSIAVRSPGL
FT                   DPNLDRALQLMRDHIGDSIDLGMLAASVDMSAFSFVRAFKKKYGLPPIRYHRGMRIEWA
FT                   KTLLSTTACPVGKISNMLGFSEPSHFVSAFRKTTGCTPLAYRRFRS"
FT   gene            complement(218930..219772)
FT                   /locus_tag="RPB_0194"
FT   CDS_pept        complement(218930..219772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0194"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04905"
FT                   /db_xref="GOA:Q2J3Q5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q5"
FT                   /protein_id="ABD04905.1"
FT                   /translation="MSSGFVTIKDGVEIFYKDWGPREAQPIVFHHGWPLSSDDWDAQML
FT                   FFLSQGYRVVAHDRRGHGRSSQVDVGHDMDHYAADAFVVMEHLDLKNAVHIGHSTGGGE
FT                   VARYVAKFGQPSGRVAKAVLVSAVPPLMLKTENNPGGLPIEVFDGFRKALADNRAQFYL
FT                   DVAGGPFYGYNRAGAQSSPGVVNNWWRQGMVGSAKAHYDGIKAFSETDQTDDLKAITVP
FT                   TLVLHGEDDQIVPIDDAGRLSVKLLKNGKLKTYPGYPHGMLTTHPDVLNADLLAFIKS"
FT   gene            complement(219879..220400)
FT                   /locus_tag="RPB_0195"
FT   CDS_pept        complement(219879..220400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0195"
FT                   /product="Ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04906"
FT                   /db_xref="GOA:Q2J3Q4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q4"
FT                   /protein_id="ABD04906.1"
FT                   /translation="MSLPLVRPELEGPTDLSSDATRDIAPALRAMLADVFAVYLKTKNF
FT                   HWHMSGPHFRDYHLLLDEQSDQIFAMTDQIAERARKIGGTSLRSIGHIARTQRILDNDA
FT                   DYVDPQDMLSELCSDNQQLTRELRRLHDLCDEYGDVATASLIENWIDESERRIWFLYEA
FT                   VRRGHNSQGR"
FT   gene            220747..220983
FT                   /locus_tag="RPB_0196"
FT   CDS_pept        220747..220983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04907"
FT                   /db_xref="InterPro:IPR021937"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q3"
FT                   /protein_id="ABD04907.1"
FT                   /translation="MKNRIWLVTVLAVSTLAASAASAKPYKWCIDDGISDSLQCEFTTL
FT                   RECRASVSGTGGECTINPKLKFGKAKANKAAAQ"
FT   sig_peptide     220747..220818
FT                   /locus_tag="RPB_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.867 at
FT                   residue 24"
FT   gene            complement(221351..222340)
FT                   /locus_tag="RPB_0197"
FT   CDS_pept        complement(221351..222340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0197"
FT                   /product="sigma 32 (RpoH)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04908"
FT                   /db_xref="GOA:Q2J3Q2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q2"
FT                   /protein_id="ABD04908.1"
FT                   /translation="MTSAFSSSSLAPAHSDAAVFDEKSYMRAIGRYPVLEPDEEARLWQ
FT                   RWLQHRDKAAADALITSHLRLAAKLARDFRRYGFPLGDLIAEANLGLMMALDRFDPERG
FT                   ARFSTCAVWWIRSAIYDHIIRSWSLVRIGRTPAQKKLFFRLRGEIRRLQPDHHGTLTKE
FT                   LAEQISATLDVPLREVIEMEQRLSGDRSLNTPLSDLDESGEWQDLIADDAPNAEAVLAG
FT                   HDELDHQRRALQDALVQLDARERYIFSARHLGERPASFETIGQSLSISAERVRQIEARA
FT                   FAKVANSARRTCGTARPAARVTSNRKTTALTAPPNWIGHNAAAVHASV"
FT   sig_peptide     complement(222287..222340)
FT                   /locus_tag="RPB_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.742) with cleavage site probability 0.592 at
FT                   residue 18"
FT   gene            complement(222420..222725)
FT                   /locus_tag="RPB_0198"
FT   CDS_pept        complement(222420..222725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04909"
FT                   /db_xref="GOA:Q2J3Q1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q1"
FT                   /protein_id="ABD04909.1"
FT                   /translation="MLRKQDRATRGIISVTSTTTDASISRRSPAVLRLPETAALLPAGL
FT                   PRSVIVVSTIVPVLSASSLIWTFAAWRPDQVTSSAAIADKRYEVAACYGICSLPSS"
FT   gene            complement(222746..223471)
FT                   /locus_tag="RPB_0199"
FT   CDS_pept        complement(222746..223471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0199"
FT                   /product="Protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04910"
FT                   /db_xref="GOA:Q2J3Q0"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3Q0"
FT                   /protein_id="ABD04910.1"
FT                   /translation="MRVDDTDGHVPALGIRSQSRSELHLALALLMTSVAGFLDAVGFTH
FT                   LAGLYVSFMSGNSTRLGIAIAQGDRQIFLPVALVIFSFVFGAFLGTLISEIVERFKCAA
FT                   ILAIEIGLLVSAIVLTRYVEGYLGLLPVCAAMGMQNAAHETVAGVEIGKSFVTGFLFGL
FT                   GKALAQLVHGGGSRPQALVYGASWVSFLGGVTLGCLALAQFGLSIALCTACTVLAGLAI
FT                   GAVLDQRRPLEPAPRSLPG"
FT   gene            complement(223625..224761)
FT                   /locus_tag="RPB_0200"
FT   CDS_pept        complement(223625..224761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0200"
FT                   /product="Oxalate decarboxylase"
FT                   /EC_number="4.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04911"
FT                   /db_xref="GOA:Q2J3P9"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017774"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P9"
FT                   /protein_id="ABD04911.1"
FT                   /translation="MPITTDFQPVRGAYGASDPGPRNLALDLQNPDIFIPPPTDNGSLP
FT                   NLKFSFGMAHNRLEAGGWAREVTVRELPAAKGMAGVDMRLGPGVVRELHWHKEAEWGYV
FT                   LDGRCRVTVVDPDRGVYVDDLQAGDIWLFPSGIPHSIQALEEGCEFLLVFDDGNFSENE
FT                   TLLVTELMAHMPIDVVAKNFGIPQQHFANLPPKEKYIFPLPVPPPLDEVLAKLPPKRPA
FT                   MPFTVHRGDFTPTQWDGGKTTIIDVRNFPVTNMAALIIDLEPGALREIHWHPDADEWQY
FT                   YIQGEARMTVFDATSKARTFNYRAGDVGYVPKTLAHYIENIGTTPVRVLNVFNKPLFKD
FT                   VPLNQWLALTPPDLVRGHLGLDDVAMAALDRNPRSVVR"
FT   gene            complement(224996..225457)
FT                   /locus_tag="RPB_0201"
FT   CDS_pept        complement(224996..225457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0201"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04912"
FT                   /db_xref="GOA:Q2J3P8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P8"
FT                   /protein_id="ABD04912.1"
FT                   /translation="MALEQPMPTSRIVLCTAVALGSAVGALSRFGSASIIADLWGAGDL
FT                   VATAFVNIVGSFVIALYATLTATRGAFPMSESSRQFVMAGFCGGYTTRSLMGLDTFMII
FT                   LDHHAFYGVAYVTGVVAMSLLAAASGYGLGRMFDPRSDSRTMEECRALS"
FT   sig_peptide     complement(225362..225457)
FT                   /locus_tag="RPB_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.744) with cleavage site probability 0.325 at
FT                   residue 32"
FT   gene            complement(225447..225845)
FT                   /locus_tag="RPB_0202"
FT   CDS_pept        complement(225447..225845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0202"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04913"
FT                   /db_xref="GOA:Q2J3P7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P7"
FT                   /protein_id="ABD04913.1"
FT                   /translation="MLDTCLLVGLGGAVGGASRFVVSDIVGQRWGTTFPWGTLVVNVTG
FT                   ALLIGIVVGLARIDAGAFNSPRLHDLIITGLLGGYTTVSSFSLQTVNLVLDRRAGLATL
FT                   NVVASTTLCLTAVAFGYFGTIWAARHGA"
FT   sig_peptide     complement(225774..225845)
FT                   /locus_tag="RPB_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.603) with cleavage site probability 0.567 at
FT                   residue 24"
FT   gene            226211..227941
FT                   /locus_tag="RPB_0203"
FT   CDS_pept        226211..227941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0203"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04914"
FT                   /db_xref="GOA:Q2J3P6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P6"
FT                   /protein_id="ABD04914.1"
FT                   /translation="MSNVADRIVETLHQAGVERIFGVVGDSLNGLTEALRQHGSIEWVH
FT                   VRHEEVAAFAAAGESQITGKLAVCAGSCGPGNLHLINGLYDAQRTRTPVLAIAAQIPSA
FT                   EIGGGYFQETHPQNLFRECSVYCELVSDPHQFDYVLENAIRAAVGQRGVAVVVIPGDVA
FT                   LREASTRGVTPVAGLLPPTPIVTPAEPQLDALAALLNGAGRVTLFCGRGCAGAHAPLMA
FT                   LAEALKSPIVHALGGKEHVEYDNPYDVGMTGFIGYASGYEAMHACDVLLMLGTDFPYKQ
FT                   FLPTGARIAQVDIRAENLGRRCKLALGLVGGVHETIEALLPKLTTKTDRGHLDHSVARY
FT                   VASRQGLDDLAKGTPGRKPIHPQYLAKLISDGAADDAVFSFDVGTPTIWAARYLKMNGS
FT                   RRLVGSLVHGSMANALPHAIGVQAAQPSRQVISLSGDGGFTMLMGDLITLTQMKLPVKV
FT                   VIFNNGVLGFVALEMKAAGFVELGTDLQNPDFAAMARAMGIHGVRVEDPGDLPAAVADV
FT                   LAHDGPAVLDVVTATQELSMPPTIGAEQVKGFSLWLLRAVMSGRGDEVIDLAKQNLLPR
FT                   "
FT   gene            228221..230614
FT                   /locus_tag="RPB_0204"
FT   CDS_pept        228221..230614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0204"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04915"
FT                   /db_xref="GOA:Q2J3P5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P5"
FT                   /protein_id="ABD04915.1"
FT                   /translation="MAKQRPDGIRAYEDPAGGWGALKALAVALKDQQLVVEGIPTLLKQ
FT                   NQPEGFDCPGCAWPDPKHTSAFEFCENGAKAVTWESTPKRVGPDFFAQHTVTSLWECSD
FT                   YWLEDQGRLTHPMRYDAQTDKYEPVDWQVAFDDIAAKLDALDDPNQLELYTSGRASNEA
FT                   AFLFQLFGRQFGTNNFPDCSNMCHEPTSVGLPRSIGIGKGTVTLDDFDKAELIISMGHN
FT                   PGTNHPRMMTPLRNASRRGVKIIVLNPLKERALERFEAPQAPLEMATTSSTPIASCYFQ
FT                   VKVGGDAAALKGICKALVAADKVARAADLAPLLDHTFIVGHTAGFDALVDDLEGCSWSA
FT                   IERASGLPRADMERIAADYAASNATIVCYGMGITQHVTGTANVQQIANLLLLKGNIGKP
FT                   GAGICPLRGHSNVQGDRTVGITERPSEAFLDRLRDVFGFEPPRAFGHSVVDSIAAMRDG
FT                   RAKAVICLGGNLAMAASDPQACFKGFRRLDLAVHLATKLNRTHLLTSKTTYLFPVLGRT
FT                   DSDIQASGRQALTVEDSMSMVHASRGFLTPPSDQVRSEVAILAGIAKATLRSKSRVDWD
FT                   ALAGNYDLIRDAIEEVFPDFEAYNDRIRKPGGFQLPNSAAMRIWNTPTGKANFAIFAGL
FT                   EEDETSTDRDVLRMTSLRAHDQYNTTIYGLNDRYRGVFGRRDVLFLNPKDLARLGFAEG
FT                   DVVDVATALDYARPDRVVQALTLVSYNLPDGCCASYYPEIQPLVALEFRDPECLTPSYK
FT                   SIPVKVTAARAPLAADRAVGRDGIVGREPGVETATGPSPVSLID"
FT   gene            230630..232027
FT                   /locus_tag="RPB_0205"
FT   CDS_pept        230630..232027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0205"
FT                   /product="Cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04916"
FT                   /db_xref="GOA:Q2J3P4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P4"
FT                   /protein_id="ABD04916.1"
FT                   /translation="MDQLLLSRLQFAFTIGYHILWPAFTIGIAWFIVVLSALWLRTHDP
FT                   VYRHLVRFWTKVFALAFGMGVVTGVVISYQLGLNWSGYARATADVIGPLFVLEVLTAFF
FT                   LEAGFIGVMLYGEQKVGEKLHFTACLIVAIGTVISAFWIISANSWMQTPTAFTTTADGR
FT                   FVATDFWGVVFNPSMPYRLAHMLTASFITGGFVVVGVSAFWIWRGRPADQPAARKAFSI
FT                   CLGLMAVLVPAQMLIGDQHGLNTRKYQPMKLAAIEARWDTARGVPINVIAWPDEKNERN
FT                   DYALEIPILGSLILTHSLDGEVKGLKEVPASERPPVAPVFFAFRIMVGCGLLLLLVAFA
FT                   GLYLRWRGRLYTARWYQVVCMGCIPLGFIATLAGWVVTEVGRQPYVIYGHFRTSEAVSP
FT                   IAGGAVASSLAVALVLYNLLLLGFFWYAGRLALRGPMSGVPTHPAVPMATVAAALGQGS
FT                   RTTEGAR"
FT   gene            232024..233049
FT                   /locus_tag="RPB_0206"
FT   CDS_pept        232024..233049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0206"
FT                   /product="Cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04917"
FT                   /db_xref="GOA:Q2J3P3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P3"
FT                   /protein_id="ABD04917.1"
FT                   /translation="MSMLSGFDFAVFFAVGAAVVIGLYVVLDGVDLGVGILFPFAPRSS
FT                   DRDLMMATLEPFWDGNETWLVLGGMVLLAGFPLAFAILLPAFYVPLCLMLFGLVIRGIA
FT                   FEFRSQGGPFEIAWSTTFAVGSFIAAFCQGAILGAFVGRYIAVVDGAFAGGPFDWLGLF
FT                   SIATGLGVVAGYGLLGACWLIWKTGGATQMFARELVLPTLLCVGAAILLISVWTPFVKP
FT                   QIADRWFAWPDFVWLAPMPIVAVAAWLGVWLTRWSEREWAPLALSLLLFMASLAGLGAS
FT                   VWPEAVPGSMTIWQASSMHRTQLIVAGALVIVMPIILAYIGYGYWLFRGKTRPAPDLRQ
FT                   N"
FT   gene            233069..234184
FT                   /locus_tag="RPB_0207"
FT   CDS_pept        233069..234184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0207"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04918"
FT                   /db_xref="GOA:Q2J3P2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P2"
FT                   /protein_id="ABD04918.1"
FT                   /translation="MSDDRGQAGSASQSGAWRRLAIPLLAVSAAVAFTIVATLRWDAWI
FT                   GSRAVQTTDDAYVRAQITQLSSRVAGAVKTVAVDDFQRVKAGDLLIQIDPADYIAQVEQ
FT                   AEAAVAGAEAALDNLANQIDLQNATIEQAEAQSVSAQALEVEAQQEDQRQQALVRTEAG
FT                   TVQKFQQAVAAYAKAKADVRAAIAVVAAQRQQMAVLAGTRQQLTATLHGAKATLDAAKL
FT                   RLGYTRIVAPFDGVASERQVQPGDYVNTGSNLINVVPLPRVYVIANYKETQLRRVRPGQ
FT                   RVTIVADTFSGQTLKGEVERISPASGSQFALLPPDNATGNFTKVVQRIPVRIQFAPGQP
FT                   LLERLLPGMSVTTRIHADDGPVGDHVDSAHR"
FT   gene            234162..235745
FT                   /locus_tag="RPB_0208"
FT   CDS_pept        234162..235745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0208"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04919"
FT                   /db_xref="GOA:Q2J3P1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P1"
FT                   /protein_id="ABD04919.1"
FT                   /translation="MSTAHIVESGPVSTGGIGPRPLFAVGAVLLGSFLSNFDSRLFAIA
FT                   LPDLRGAQSLSFDQGAWLSTAATASQIFIAPAVAWMATAFGLRRVLGLPSLAYAVVSLL
FT                   IPLVHSYELMMALSVVHGLLLGIFVPATLLIIFRNLPLRWWLPAISIYAIRVGFSLNFG
FT                   ISVVGFYVDQIGWQWLYWQDALIAPLLGLFVYLGTPAEPVNAPLVKQADWGGMLLLGSG
FT                   MALIFAGLDQGNRLDWLGSGTVVACLGCGAALVAGFFVNERVVAQPWAHANVLFSRNIG
FT                   FALLIILLFSLTSLSNSLLAPDFLASVAGLRPEQSGQLFLVYAVLPMLLWVPLSVWLIR
FT                   RIDVRLVLIAGLAAFCAAGLLGTRLTHAWALGDFVPMVLLQSFGQAFTLLPIVIITLSN
FT                   SDPQRATAFAAYIQVARLGGAELSVSLMTTWLRVREQSYSNLLGLHVAKGDPLVSGVLS
FT                   DLTRHFDGAGSGEAQSRAITTLAQIVQREANTLSFIDGFWLAAWFGVAALLCAACIRAA
FT                   PPGPFTPKGG"
FT   gene            235780..236088
FT                   /locus_tag="RPB_0209"
FT   CDS_pept        235780..236088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04920"
FT                   /db_xref="GOA:Q2J3P0"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3P0"
FT                   /protein_id="ABD04920.1"
FT                   /translation="MSKGCTHIAGIRDVTPSALGCEECLKIGSIWVHLRICRTCGHVGC
FT                   CDESPHKHATRHFHATQHPIIEGYDPPEGWGWCYVDQVMFDLSDRMTPHNGPIPRYY"
FT   gene            236229..237053
FT                   /locus_tag="RPB_0210"
FT   CDS_pept        236229..237053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04921"
FT                   /db_xref="GOA:Q2J3N9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N9"
FT                   /protein_id="ABD04921.1"
FT                   /translation="MSSHSLQIAGERVCARHAAGVSSASSMGRCQQPDEVWSGHLRNRE
FT                   RSNFDLKKMAALIRALTAEGGATPGIVSGLRPPAASGGETVLNFRDRSEGRPGPGDPPC
FT                   TDDDPLVIRLSEALAAAECDSSEFADLYADAIRVVTAVRKLSMQPPAALIEDRKPTGGA
FT                   VLPKWRLKLVANYVSEHLAEKVTLADMAAAARLSRMHFAALFLRATGLRPHEYLLKRRI
FT                   AAAQELLQTGDLPIVQVAMQVGFQTQAHFTTVFKRITGHTPAKWRQTMRPHD"
FT   gene            complement(237384..238070)
FT                   /locus_tag="RPB_0211"
FT   CDS_pept        complement(237384..238070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0211"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04922"
FT                   /db_xref="GOA:Q2J3N8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N8"
FT                   /protein_id="ABD04922.1"
FT                   /translation="MSKSPNLSQSPLICVVDDDEDVRSSLSSLLRSIGYAVKTFAGPLD
FT                   FLASDAVDAASCLILDIQLGEADGLEFQQELVTSDASIPIILISGHGDIPKTVRAMKAG
FT                   AVNFLPKPFEEEALLAAVAEAVSRDQRRRNDAHRDESIRLRYEQLTPREREVMALVAAG
FT                   LMNKQIAWRLSLSEITVKIHRGNMIRKMQVKSVAELVRLADQLGVRAAPETHPDATPSR
FT                   QGNPPL"
FT   gene            complement(238067..238480)
FT                   /locus_tag="RPB_0212"
FT   CDS_pept        complement(238067..238480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0212"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04923"
FT                   /db_xref="GOA:Q2J3N7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N7"
FT                   /protein_id="ABD04923.1"
FT                   /translation="MLHLSTITIVDDDEDVRESISSFFRSVGLHVEGFAAAETFLASPS
FT                   LPDTDCLITDLHMPGMDGLGLHRELLRRGVNIPVIMMTAYSTPEARAEASDLGAAGFVD
FT                   KPVDPEILLHDVEAILRAARHRRVPSDRSGPKS"
FT   gene            complement(238556..240463)
FT                   /locus_tag="RPB_0213"
FT   CDS_pept        complement(238556..240463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0213"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04924"
FT                   /db_xref="GOA:Q2J3N6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N6"
FT                   /protein_id="ABD04924.1"
FT                   /translation="MTTIDQRRRQVVILAAFISLLLIFAADALSPIDGAVAVLYTGVVL
FT                   MVAPLGRRFILAAGYISAVLTATAFLWGHANDLVSGALLRFAVSLVAILITVLLSLRDR
FT                   SARVTLAEQGRILELSHDTVVIRDPSGVVRYWNEGAARLYGWTRGEAIGRQCDDLLQGI
FT                   VPVEEINQSLRRTGAWSGEIVRTRRDGTPLVLATRWLQRRDPEGRPIGVIETSADLTER
FT                   RRAQAEQRRSEHRFSTIFNSGGFAALECDLSGAMRLVLAAGTGEELAPAVRAYPQLLDK
FT                   AADEIRIYNANTAALVMFEAETTADLSSGKVLRGSKQDTGWALETIFTQLAAGAMLVET
FT                   EARFATLSGQPIDAVLRLSVLPDGVDWSRVLLMAFDVTERNRARAKIEQTSVELAHAGR
FT                   VSVLGQLAASIAHEVNQPLAAIINYGKSGKRWLTRAEPDLVEVADCLDKIVSNGNRAAD
FT                   VVGRVRSLARKSAPQAGPVDLAALVQDAAALLARETRSAGTAIRIDQNGRLPQVECDRV
FT                   QVQQVVVNLMMNALQATRGAGSSSEIRVSLDGTADDAIVVAVRDSGTGIAGDPHRIFDP
FT                   FFSTKPDGMGLGLSICKTIIEAQGGSISASNNVGPGATVAFTLPRKASAEAAGARRLIS
FT                   "
FT   sig_peptide     complement(240377..240463)
FT                   /locus_tag="RPB_0213"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.811 at
FT                   residue 29"
FT   gene            complement(240693..241976)
FT                   /locus_tag="RPB_0214"
FT   CDS_pept        complement(240693..241976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0214"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04925"
FT                   /db_xref="GOA:Q2J3N5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N5"
FT                   /protein_id="ABD04925.1"
FT                   /translation="MPLSLSDSFDLAAVVKTSEAVSSELGVPRLMETLMTLVLEHAGAQ
FT                   RGLLILPQQADLTIRTEASTGDDGIQVKLRDDIATEDDLPTSLVNLAARTGEAITVDDA
FT                   QSSPFGDDPYIARMKSRSLLCLPLMKRNKLLAIIFLENDLATGVFTPMKLSVLKLLSSQ
FT                   AAISLKNALLEEKDALVEALQKSQSELMRMSRLTAIGELVISIAHEINQPLTAIITNAD
FT                   VYLRWLGNEQPSIVEAESAARRVIENGRRAAEVVQTIRGLAVKSVPKMLPVDVNAVVQE
FT                   ILSIVQSELRQHTIHLETRLADGAGVVIGNKVQLQQVLLNLTMDAIESMAAIEGRRLLT
FT                   VTTASGDADSIVVTLEDNGLGFHEGRIEQLFEALVTTKPQGMGMGLSISRSIVEAHGGR
FT                   LWARSIKPHGARFQFSLPRSAEADAAAM"
FT   gene            complement(242172..242261)
FT                   /locus_tag="RPB_R0002"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(242172..242261)
FT                   /locus_tag="RPB_R0002"
FT                   /product="tRNA-Ser"
FT   gene            242500..243780
FT                   /locus_tag="RPB_0215"
FT   CDS_pept        242500..243780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04926"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N4"
FT                   /protein_id="ABD04926.1"
FT                   /translation="MTELTIICPNCATSVPLTESLAAPLLKDTQSKYERLIAQKDKDIA
FT                   GREAALEAQRADLDNAKAAVGQQVAERIAVERTRIAAEEAAKAKRLAADDLDAKARQLA
FT                   ELTEAMQQKDVKLAEAQRAQAAFLQKQRQLEDEKRELDLTIEKRVQASLESVRSKAKQD
FT                   AEEGLRLKVAEKEETIATMQRQIDKLKSEQGSQQLQGEVMELELEASLRARFPQDSIEP
FT                   VPKGEFGGDVLHRVVNAANQPCGTILWESKRTKNWTDGWLTKLRDDQRKAKAELALIVS
FT                   NALPKGVHSFDHIDGVWVAEARCAIPVAIALRQSLIELAAARQAGEGQQTKTELVYHYL
FT                   TGPRFRQRVEAIVEKFTEMQSDLDKERRSMMRMWAKREAQIRGVLEATAGMYGDLQGIA
FT                   GKALGEIDGMALPMLEDFSDDEADQAA"
FT   gene            complement(243808..244974)
FT                   /locus_tag="RPB_0216"
FT   CDS_pept        complement(243808..244974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0216"
FT                   /product="Acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04927"
FT                   /db_xref="GOA:Q2J3N3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N3"
FT                   /protein_id="ABD04927.1"
FT                   /translation="MDFALTDQQQAIRDAVAKICADFDDAYWLRKDREGGFPHDFHKAL
FT                   ADAGWLGICVPEAYGGSGLGITEAAIMMRAISESGAGMSGASAVHINVFGLNPVVVFGT
FT                   EEQRRRMLPPMVEGREKACFAVTEPNTGLNTTQLKTRAVRKGDRYIVNGQKVWISTAQV
FT                   AHKILLLARTTPLEDVKSPTHGLSLFYTDLDRRKVEIHEIDKMGRKIVDSNELFFADYE
FT                   IPVEDRIGEEGSGFQYILEGMNPERILIAAEAVGLGKLALSRASDYAKSRIVFNRPIGQ
FT                   NQGIQHPLAKNWVELEAAWLMVMSAAWQYDKGMPCGAAANAAKYLAGEAGFSACEQAVM
FT                   THGGFGYAKEYHVERYLREVLIPRIAPVSPQLALSFIAEKVLGLAKSY"
FT   gene            complement(245119..246162)
FT                   /locus_tag="RPB_0217"
FT   CDS_pept        complement(245119..246162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0217"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04928"
FT                   /db_xref="GOA:Q2J3N2"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N2"
FT                   /protein_id="ABD04928.1"
FT                   /translation="MHIDLNPKLDFRDVLIRPKRSVLSSRFEANISRSFRFRHSSQAWT
FT                   GFPLIASNMDTVGTIEMAEAFRPFGALVALHKFYDPERLAQYLDRHENPNVFLTVGTGA
FT                   ADWERLAAVKAQTRVPMLNIDVANGYTENFVRAVGKLRDENPDAIIMAGTVVTAEMTEA
FT                   LVIAGADIVRVGIGSGSVCTTRDLTGVGYPQLSAVIECADAAHGLKGHVCSDGGCTVPG
FT                   DIAKAYGGGADFVMLGGMLAGHAECGGELQYVEEDGRQVPKSMTFYGMSSETAMNKYHG
FT                   GVADYRAAEGKTVAVPYRGEVRATVETIAGGLRSAMTYMGAENLKEVPKRTTFILVNAQ
FT                   RNTVFDR"
FT   gene            246331..247233
FT                   /locus_tag="RPB_0218"
FT   CDS_pept        246331..247233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0218"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04929"
FT                   /db_xref="GOA:Q2J3N1"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N1"
FT                   /protein_id="ABD04929.1"
FT                   /translation="MKVAVMGAGAVGCYFGALLAQAGHDVTLIGRPDHVAAIDAHGLRL
FT                   ETRDGESFIALKAATDPAALDPPDLVLFCVKSADTETAGRALAPRLRPDTAILSLQNGV
FT                   DNAQRLSAAIGHPVIAAVVYVGTEMAGPGHVRHHGRGELLIGASAQSGVLAAALSEAKI
FT                   PTTVAADIDQALWSKLMMNSAFNALSAVADMAYGRMFEVAGARDVVTSVIAECAAVARA
FT                   GGVSIPDDMLEKALALPASMPNQKSSTAQDLARGKPSEIDFLNGYVVRRGAALGIPTPT
FT                   NLTLQVAVKLIEASRGIGR"
FT   sig_peptide     246331..246393
FT                   /locus_tag="RPB_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.581 at
FT                   residue 21"
FT   gene            complement(247458..248435)
FT                   /locus_tag="RPB_0219"
FT   CDS_pept        complement(247458..248435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0219"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04930"
FT                   /db_xref="GOA:Q2J3N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3N0"
FT                   /protein_id="ABD04930.1"
FT                   /translation="MSNLVEVRDLNIRFTGERTVHAVNNLSLSLGEGEVLGLLGESGSG
FT                   KSVTLRALMRLLPKKRTQISGRVEVMGRDVLALDDDALSNFRGQAVSMIFQEPALALDP
FT                   VYTIGHQIAETVMRHEGKSQQDATARALEMLEVVRIPSAKRRLDAYPHEMSGGMRQRAM
FT                   IALALACRPKILLADEPTTALDATVQIQILLLLRELQREFGMSVIFVTHDIGVAIEICD
FT                   RVAVMYAGQIIEQGTLGQIVRTPQHPYAQGLLASTVHGAKRGARLETIPGAPPSLDKAP
FT                   TACSFAPRCAHVQPRCTEGLPPDVQVGPGRTARCILAEAAPAPV"
FT   gene            complement(248432..249847)
FT                   /locus_tag="RPB_0220"
FT   CDS_pept        complement(248432..249847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0220"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04931"
FT                   /db_xref="GOA:Q2J3M9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M9"
FT                   /protein_id="ABD04931.1"
FT                   /translation="MSTTDPALLSLTEIAQAIAAKTVSSREVTQACLDRIAAQQPRLNA
FT                   FMSIEADSALAAADAADAELARGDSRGVLHGVPLAHKDMYYETGHVVTCGSKIRQDDVA
FT                   TTTSTALQRLKDAGTVRLGSLQMSEFAYGPTGHNAHFGPVHNPWNIDHITGGSSSGSGA
FT                   AVAARLTFAALGSDTGGSIRMPAHFCGVTGLKTTVGRVSRAGAMPLSQSLDTVGPLART
FT                   AQDCALLLGLMAGADPEDLTCIAGELPDYLAATHAPMRGARIGIPKAFYVDDLDPEVAR
FT                   VLDETIATLRAEGASVVEVDLPDQPQLTAACQLVLAVEAAAFHKRWMIERPQDYGPQVL
FT                   MRLQNGLGVPAISYLEAMRWRGPALSAHLAAVADVDAVLAPVAPVPAPTIAESDVGSSL
FT                   NAEAVIQRLTRFTRPINYLGLPSLAIPTGFSASGLPIGLQLIGRPFDEAMILRIGAAFQ
FT                   RVTEFHNKMPASA"
FT   gene            complement(249844..250041)
FT                   /locus_tag="RPB_0221"
FT   CDS_pept        complement(249844..250041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04932"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M8"
FT                   /protein_id="ABD04932.1"
FT                   /translation="MTRPVPDQIKAMAEVAGVPVSDEVAARIANSIGPAFDGFAPIAGS
FT                   LPFDLEPATFLVAQTGKAAS"
FT   gene            complement(250038..251102)
FT                   /locus_tag="RPB_0222"
FT   CDS_pept        complement(250038..251102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0222"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04933"
FT                   /db_xref="GOA:Q2J3M7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M7"
FT                   /protein_id="ABD04933.1"
FT                   /translation="MTQAAELSHGLEPIEDIGGAAQPLLDVRGLTKHFPVRGGLFSAAK
FT                   TVRAVDDVSFAIAKGETVGIVGESGCGKSTTARLLMHLMPRNAGDIIYDGRAVGRELSL
FT                   RELRRGMQMVFQDSYASLNPRLTIEESIAFGPKVHGMADGTARALARELLGKVGLRPEN
FT                   FANRYPHEVSGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLVDLKREFG
FT                   LTYLFISHDLNVVRYISDRVLVMYLGEVVELGPVDKVWDQPAHPYTRALLAAMPSSDPD
FT                   RRTEVPPISGDPPNPIDPPSGCRFHTRCPFAEPLCGGDAPKLTALDPSGHQAACYMAIP
FT                   GSGHSRAPKVMETT"
FT   gene            complement(251104..251991)
FT                   /locus_tag="RPB_0223"
FT   CDS_pept        complement(251104..251991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0223"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04934"
FT                   /db_xref="GOA:Q2J3M6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M6"
FT                   /protein_id="ABD04934.1"
FT                   /translation="MTAITETAVQTAPAGNARGYWSTVGRRLSRDKVSIACAIVLLLIL
FT                   LSAIFAPYLHLADPYQGSMIRRLKPIGTPNYPLGSDELGRDMLARLIYGGRLSLLIGIL
FT                   PVVLAFVLGTSLGLVAGYVGGKVNTAIMRTIDVFYAFPSVLLAIAISGALGAGITNSIV
FT                   SLTVVFLPQITRVAESVTTGVRNMDFVEAARASGAGPFTIMRVHMLGNVLGPIFVYATG
FT                   LISVSMILAAGLSFLGLGTKPPEPEWGLMLNTLRTAIYVNPWVAALPGAMIFAVSICFN
FT                   LLSDGLRSAMDIRN"
FT   gene            complement(252011..252964)
FT                   /locus_tag="RPB_0224"
FT   CDS_pept        complement(252011..252964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0224"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04935"
FT                   /db_xref="GOA:Q2J3M5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M5"
FT                   /protein_id="ABD04935.1"
FT                   /translation="MLVYIARRIVYVIPIVLSVALVCFLLVHITPGDPLVAVLPADASQ
FT                   ELAAQLRAAYGFDRPLPVQFGLWLWKALHGDLGTSIATGRPVLSEVLRAVGNTVTLAIA
FT                   AAIIGFSLGLMFGLLAGYFRDSWIDKVSTSIAIAGVSVPHYWLGMVLVIIFSVQLNWLP
FT                   AVGAGPGGSGQWGWDWAHLKYLVLPAITTSVIPMGIVTRTVRALTGDILSQDFVEALRA
FT                   KGLRETQVFRHVLKNAAPTALAVMGLQLGYMLGGSILIETVFSWPGSGLLLNSAIFQRD
FT                   LPLLQGTILVLALFFVFLNLVVDIAQAAIDPRIKRA"
FT   gene            complement(253123..254784)
FT                   /locus_tag="RPB_0225"
FT   CDS_pept        complement(253123..254784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0225"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04936"
FT                   /db_xref="GOA:Q2J3M4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M4"
FT                   /protein_id="ABD04936.1"
FT                   /translation="MRHLHSFSRTAVLLALTAVGSVAVPQIASSETVLRIGMTAADIPR
FT                   TLGQPDQGFEGNRFTGLTMYDGLTMWDLSSATKASVVIPGLATEWKVEDADKTKWIFKL
FT                   RPGVTFHDGTPFNADAVVWNVDKVLNKEAVQFDASQVGVTASRMPTLVSAKKIDDMTVE
FT                   LTAKEPDSFLPINLTNLFIVSPSKWQALYEKAEGADAKARSQAAWAAFAKDAAGTGPWK
FT                   MAKFTPRERLELVKNDNYWDKARVPKTDRMVLLPMPEANARTAALLSGQVDWIEAPAPD
FT                   AVKEITARGFKIEKNEQPHVWPWQFSRIEGSPWNDIRVRRAANLCIDREGLRDGLLAGL
FT                   MVPATGTFEPGHPWRGNPSFQIKYDLPAAQKLMKEAGFGPDKKLSVKVQTSASGSGQML
FT                   PLPMNEYLQQALAECYFDVKLDVIEWNTLFTNWRRGVKDPSANGSNATNVTYAAMDPFF
FT                   ALVRFLQSSMAPPVSNNWGYINNPKFDELVKKARTSFDAAERDKALAELNAASIDDAAF
FT                   LYVAHDVGPRAMSPKVKGFVQPKSWFVDFSPVSMAP"
FT   sig_peptide     complement(254698..254784)
FT                   /locus_tag="RPB_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.410 at
FT                   residue 29"
FT   gene            254956..256557
FT                   /locus_tag="RPB_0226"
FT   CDS_pept        254956..256557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0226"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04937"
FT                   /db_xref="GOA:Q2J3M3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M3"
FT                   /protein_id="ABD04937.1"
FT                   /translation="MKRFGSALVLAAMIAAAGVIGPARAESVVRYGISMADIPLTTGQP
FT                   DRGAGAYQFTGYTIYDPLVAWEMNVADRPGKLVPGLATEWKVDESDKTKWRFTLRKGVK
FT                   FHDGSDFNADAVIWNLDKVLNEKAPQFDKRQSAQVKTRLPSVKSYAKIDDSTIEITTKA
FT                   VDSFFPYQMLWFLVSSPAQYDKVGKDWDKFAAQPSGTGPFKLTKLVPRELAELTRNADY
FT                   WDKARLPKTDKLVLVPMPEALTRTNALLAGQVDLIETPAPDAVPQLKSAGMKLVDNVTP
FT                   HVWNYHLSVLPGSPWTDVRLRKALNLAIDRDAVVGLMNGLAKPAVGQVDPSSPWFGKPT
FT                   FKIKYDLAEAKRLVKEAGYSPEKPLKAKFIIATGGTGQMLSLPMNEFLQQSFKEIGIDV
FT                   EFKVVELEVLYTAWRKGAADESMAGITANNIAYVTSDPLYAIVRFFHSGQVAPVGVNWG
FT                   GYKNPKVDALIDEAKTNFDPVKQDELLAQAHAQIVDDAALVWVVHDTNPHALSPKVKSF
FT                   VQAQHWFQDLTTIGLQ"
FT   sig_peptide     254956..255033
FT                   /locus_tag="RPB_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(256878..257822)
FT                   /locus_tag="RPB_0227"
FT   CDS_pept        complement(256878..257822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04938"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M2"
FT                   /protein_id="ABD04938.1"
FT                   /translation="MTRAAFETPIEDTGDALAGPWRQPRQMLHAQVYDSHASIHDDATA
FT                   QKLGFKGGTIEGPTHFSQFVPLCERLWGRDWFESGCISAHYRNAAFEGEDVQAIVDKPA
FT                   NGARHAAIRMVKRDGTEVLRGSVSVGADAPPSALDLRLTELKPLTDAVILRDISVGMTT
FT                   APQTVKMDFEQNMGELYPFSLADKLKVITEPSPYYQDASPWGRPIIPVEMLSVLFQYLS
FT                   KKDGLPVRGPAVGLFADQEIRLVAGPLFVGESYRVQRKVVALSGSKRTESLWARTEAFD
FT                   SEGRLVATMLLNSASLKESYAPYQQEYAALGRG"
FT   gene            complement(257855..261163)
FT                   /locus_tag="RPB_0228"
FT   CDS_pept        complement(257855..261163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0228"
FT                   /product="pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04939"
FT                   /db_xref="GOA:Q2J3M1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M1"
FT                   /protein_id="ABD04939.1"
FT                   /translation="MPFRKLLIANRGEIAIRIARAAADAGLATVAIHPADDAASLHVRI
FT                   ADEAREIPGRGARAYLDIEGVIAAAKAAHCDALHPGYGFLSENPDLARRCAEEGIRFIG
FT                   PSPEALRLFGDKVAAKELAKKSGVPIIDGTQGPSTLDEVKAFFGSLGDHAAVMIKAMAG
FT                   GGGRGMRVVERAEDLDEAYARCQSEAKAAFGSDGVYAERLIRNARHIEVQIIGDRHGGI
FT                   SQLWERECTIQRRNQKLVEIAPSPSLSDSLRGRILEAAKTLAGAANYDSLGTFEFLVDG
FT                   EAGEGDGAFAFIEANPRLQVEHTVTEEVLAIDLVRSQIAVAGGATLESLGLDQAAVPRP
FT                   RGFAMQLRINMETMDASGATHPTGGTLSIFEPPSGPGVRVDTFGYAGYRTSAAFDSLLA
FT                   KVIVHTPSQWPDVVAKAARSLREFRIDGVATNIPFIQAILAHPDFKANKVSTSFIDRNV
FT                   AELVGAADKLAAPLIALPGGDAQHGGAKAAVEAAPEGAVVIAAPLQGTVVAITVAEGDV
FT                   VRPGQQLAVIESMKMEHLVAAEQGGRIRRIVTADGVTLMQGEAILYLEPQDVEGDLAVK
FT                   EAEVDLDHIRPDLAEMLARQGNTLDENRPDSVARRRKTNQRTARENIAQLVDDGSFMEY
FT                   GSLAIAGQRRRRALDDLIKNTPADGLVTGVATVNAAQFGEHDARCMVIAYDYTVLAGTQ
FT                   GHMNHKKIDRMLTLVEQWKMPLVFYAEGGGGRPGDTDRLGLTGLDGPSFVQFARLSGLV
FT                   PVIGVVSGYCFAGNAAMLGCCDVIIATQNASIGMGGPAMIEGGGLGVYHPAEVGPVSFQ
FT                   SPNGVVDILVEDEEEATRVAQKYLSYFQGPVKDWRAADQRLLRRAIPENRLRVYDVRHV
FT                   IDLIADEDSVLEIRRDFGVGMVTAFIRIEGKPFGLIANNPKHLGGAIDAAAGDKAARFL
FT                   QLCDAFDIPIVSLCDTPGFMVGPEAEKTAIVRHVARMFVTGASLTVPLFGIVLRKGYGL
FT                   GAQSMIGGGFHASFFTAAWPTGEFGGMGLEGYVRLGFRKEMEAIADPVERETYYKNKVA
FT                   EMYANGKAVSIASVCEIDNVIDPAETRRWIMAGLRSVPTPPQREGRKRPCIDAW"
FT   gene            complement(261224..262939)
FT                   /locus_tag="RPB_0229"
FT   CDS_pept        complement(261224..262939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0229"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04940"
FT                   /db_xref="GOA:Q2J3M0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3M0"
FT                   /protein_id="ABD04940.1"
FT                   /translation="MSAAAKEADYLATLHGLWAESWPKGIPDTPQYPHGEIALSEYLRV
FT                   WARRAPQRPAVIFYGHVTTYAELDRLSDRFAALLMQKGVRKGDRVAVFLPNCPQFHIVF
FT                   FGILKLGAIHVPVSPLSRAFELSYELNDTDAEVIVALDQLVPVVEQVRGETSLREVIVT
FT                   SFADVIPAQPTIPVPDSVSGPRVAVAGATDLLSALAAMPELAPLPPAALDDIAALNYTG
FT                   GTTGMPKGCVHTQRDMVYTAAANHGISVAGDENSVFLSFFPEFWIAGENFGLIFPLFAG
FT                   ATLVLLARWDAVGVLSAIDRYKVDVTAMPVDGAVELMDHPRFKEFDLSSLKQVRVVSFV
FT                   KKLNPVYRKRWKDLTGTILTEASWGMTETHTSNTFTAGFQDDDFDLVSQPIFVGLPVPG
FT                   AEFKITDFETGELVPLGGEGEIRVRTPSLLKSYWNKPQATAESLVDGWLRTGDIGTIDP
FT                   QGFLHFLGRRKEMLKVKGMSVFPPEIEALLGQHPKVLGSGVVGRDDPGKGQVPVAFIQL
FT                   KPEAEGTITAAELQAWCAERMAVYKVPEVRIIEALPMTATGKVKKQELNASAPL"
FT   gene            complement(262969..263847)
FT                   /locus_tag="RPB_0230"
FT   CDS_pept        complement(262969..263847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0230"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04941"
FT                   /db_xref="GOA:Q2J3L9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L9"
FT                   /protein_id="ABD04941.1"
FT                   /translation="MTDVAMTAMAHRPRRMRRFVRWFVSDIRGAVSLTFLLVLLVISLL
FT                   APWISPYDPVAQDVDAALAPMSAAHWLGADDLGRDTLSRLIYGGMASLYASFLAVAIAV
FT                   LIGVPIGVLAGYLGGWVDTMISRVIDSFLSFPAIVLAIAVTGALGIGLTNGMISVGIVF
FT                   APQLARLVRARTLVVRHELYVDAARCFGGSTGRILWRHVLPNAIQPVIVQVTLLLAAAL
FT                   LAEASLSFLGLGIQPPDPSWGAMLARAYQNMEIAPEQMYPPGLAILFTALAYNTLGESL
FT                   RVALDPTMKRN"
FT   gene            complement(263844..264800)
FT                   /locus_tag="RPB_0231"
FT   CDS_pept        complement(263844..264800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0231"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04942"
FT                   /db_xref="GOA:Q2J3L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L8"
FT                   /protein_id="ABD04942.1"
FT                   /translation="MLNAARLHIVGRRVLQAIPVVVLSTFIVFGLLKLVPGDVAVTLAG
FT                   DNASDQRIAEIRELYGLNQPFLLQYGSWLAKAVQGDLSNSLVSNEAVLTSIQRCLPHTL
FT                   LIVTLALLTALLIGVPLGIAAATKPGSWIDSVVMAIASLGVAVPNFWLGMLLVAFFSLQ
FT                   LNWLPATGAVAFTKDPWASLSHAILPAVALASGGIAEVARQLRSSLVEILSSQQVRTLH
FT                   AKGLPPSSILWRHGLKNVSVNLLTVISLLANRMLAATVVVEAVFAIPGMGGLIVNAAMH
FT                   RDFPVVQGVVFTMVLIVVSLNLLTDILYSVLDPRIAA"
FT   gene            complement(264849..266402)
FT                   /locus_tag="RPB_0232"
FT   CDS_pept        complement(264849..266402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0232"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04943"
FT                   /db_xref="GOA:Q2J3L7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L7"
FT                   /protein_id="ABD04943.1"
FT                   /translation="MRILDLGSRTLRRRDILALIGGGAAAAAVGLPALAQEPKKGGVLK
FT                   VAAPANPSSLDPATGGAGSDHSILWTIYDTLVEWDYDTLKPRPGMAKWSYPNPTTMVID
FT                   ITPGIQFHDGTAMDAEAVKFNLDRNRSDQRSNIKSDLASIESIEVTSPLQVTLKLKSPD
FT                   TSLPAILSDRAGMMVSPTNIKALGNETDRKPVGAGPWKFVRWNDNEIIVVARHENYWRK
FT                   GRPYLDGIEFNIITENATALRSVVAGQNDMAFQLPARLKPVIERAKDLTMVSSPTLYCI
FT                   QVYFNYARAPLDNLKVRQAINFAFDRDTFVKAALSGLGESARMTLPSSHWAFNKDVAGT
FT                   YPHDPEKAKKLLAEAGYKDGLELTIGGYTDQDSVRRGEVIQDQLGKVGIRLKFTRGTIA
FT                   EISAQFFAQEKKFDLLVSAWTGRPDPSMTYGLGFDKGAYYNAGRTADPELSKLILESRV
FT                   SEDLAKRAEVFARIQRITVEQALSAPLAFQFELDALSSKVKGFKPNLLGKPKFEYISLA
FT                   "
FT   sig_peptide     complement(266295..266402)
FT                   /locus_tag="RPB_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 36"
FT   gene            complement(266445..267473)
FT                   /locus_tag="RPB_0233"
FT   CDS_pept        complement(266445..267473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0233"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04944"
FT                   /db_xref="GOA:Q2J3L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L6"
FT                   /protein_id="ABD04944.1"
FT                   /translation="MAAQQQNHADAGILAVRDLRILFPSRDGRDTVKAIDGMDFEVRSG
FT                   ETFGIIGESGSGKTTLGRALVSLLRPTHGHILHDGTDPATLGSRAFRKHRRDYQIIFQD
FT                   PNAALNPRMTIIDSVVEPLEVLGEGNAASRRRRGIAVLERVGLSAEAADRYPHQLSGGQ
FT                   KQRVNIARVLTLRPKVIVCDEVVAALDVSIRGDVLNLFADLQREFGLTYVFITHDISVV
FT                   SHISDRIAVTYLGKLMELGPAEDVVERPLHPYTRALLSAEPIPLPSHLRVDRRIILEGE
FT                   IPSPVSPPSGCRFRTRCPSVQPRCADEVPAWRDVRPGHRVACHFATAEGPPADNQQARS
FT                   AS"
FT   gene            complement(267473..268528)
FT                   /locus_tag="RPB_0234"
FT   CDS_pept        complement(267473..268528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0234"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04945"
FT                   /db_xref="GOA:Q2J3L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L5"
FT                   /protein_id="ABD04945.1"
FT                   /translation="MGMIEASASTGTGTHGAVRSGIAPQPLLEVRNLSLSFATAAGALP
FT                   VTRNVSFTVAAGERVGLVGESGCGKTVTGLSLLRLLPAHSARIEGDVLFDGTDLLKLSP
FT                   RRMRAVRGRDIAMIFQEPMSALDPVFTVGDQISEAYRIHFPAGKAEGRERAIAALREVG
FT                   IPAPERRCDEYPHQLSGGMRQRVMIAMALICKPKLLIADEPTTALDVTVQAQITDLLRS
FT                   LSERTGTALIFITHDLGVVAETCTRMITMYAGEVVEDAPVDDVLTRPRHPYTSGLLRSL
FT                   PGLSKRRGVLASIPGRVPSPQAMPAGCRFRSRCAHAAPGCEQDQRMIAIEAGHAARCRR
FT                   APDLALPGAVN"
FT   gene            268853..269656
FT                   /locus_tag="RPB_0235"
FT   CDS_pept        268853..269656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0235"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04946"
FT                   /db_xref="GOA:Q2J3L4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L4"
FT                   /protein_id="ABD04946.1"
FT                   /translation="MAATYRRPATGSDGTHERRFAPRTLPDQVAEELGAEIVSGRRKAG
FT                   ERLVELDLARDFGVSRGPIREAIRILERRRLVELLPRRGAYIKPVSLKSVADLFNVRTA
FT                   LSMLAVRTMATTPVESYIDTLARRCAELKAQVEPDDPIAFARTTTRAVKTIARGSGNQL
FT                   LVELLTDLADQTVWTTIWKSPLDYQTPEIRRLSADLMASTLKAIRQRRPNAAVTHLGEL
FT                   LEGDRDRALATLSQIRGEAFDLSALAHVDETGAAPTTIAGSARTA"
FT   gene            complement(269680..270213)
FT                   /locus_tag="RPB_0236"
FT   CDS_pept        complement(269680..270213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0236"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04947"
FT                   /db_xref="GOA:Q2J3L3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L3"
FT                   /protein_id="ABD04947.1"
FT                   /translation="MIEERSLIVVEDDAGFARTLKRSFERRGYEVVHASTIDEVRDALD
FT                   ERSFGYAVVDLKLGGASGLACVELLHAQDPEMLIVVLTGFASIATAVEAIKLGACHYLA
FT                   KPSNTDDIEAAFRKAEGNADIALASQPTSIKTLEWERIHQTLIESEFNISEAARRLGMH
FT                   RRTLARKLEKRQVR"
FT   gene            complement(270206..271519)
FT                   /locus_tag="RPB_0237"
FT   CDS_pept        complement(270206..271519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0237"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04948"
FT                   /db_xref="GOA:Q2J3L2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L2"
FT                   /protein_id="ABD04948.1"
FT                   /translation="MSASTFVPRLGDVTPGDDATDRKNMALLIQLRWTAVIGQIVTIGA
FT                   VHLWLGAPLPLVPMGAVVLGLIALNIASLAWMRYRVAISNRDLLVALILDVVALTALLY
FT                   LSGGITNPFTSLYLLQVTLGAVLLDSRSSWSLVAVVFTAFIWLTEASRPLVLPPAAGDP
FT                   VNLAVAGMLIGFALNAVLLVVFVTRIHRNLRERDAHLAALRQHAAEQDHIVRMGLLASG
FT                   AAHELGTPLASVSVILSDWRRMPQIMANREIAEDLAEMETALKRCQSIVTGILVSAGEA
FT                   RGEGSSPTTVSAFLSALAEEWQNARCKTTLHVVNVFGEDVPIVSDVTLKQAIFNVLDNA
FT                   FEVSRYWIELVAERDGDNLVLSISDRGPGFPKDMLTQIGKPYQSSKGRAGGGLGLFLVM
FT                   NVVRKLGGSITAENLRTRGAKVKLVLPLSTLAIGNPFD"
FT   gene            complement(271551..272387)
FT                   /locus_tag="RPB_0238"
FT   CDS_pept        complement(271551..272387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0238"
FT                   /product="Surfeit protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04949"
FT                   /db_xref="GOA:Q2J3L1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L1"
FT                   /protein_id="ABD04949.1"
FT                   /translation="MTPDSDPAGSGRSSARRPSLWLTIPAVAAVAGLIALGVWQIERRA
FT                   WKLALIDRVEQRAHAAPTALPPAASWPEVTAARDEYRRVTVTGRFLHDRETLVQAVTDF
FT                   GGGFWAITPLRTDDGRNVLINRGFVPPDWRDRATRSAGAPAGEITVNGLLRVTEPGGGF
FT                   LRHNEPAADRWYSRDVAAIAQTRSVANVAPFFIDADASFNLEGQPIGGLTVIRFPNNHL
FT                   VYALTWFCLAFMLAGWLVVAFGAGSFRRAGGGRRPGQEAQSALATGSHAGPISGHR"
FT   gene            complement(272401..272793)
FT                   /locus_tag="RPB_0239"
FT   CDS_pept        complement(272401..272793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0239"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04950"
FT                   /db_xref="GOA:Q2J3L0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3L0"
FT                   /protein_id="ABD04950.1"
FT                   /translation="MSINSPHVDAHGHDHGHEAHVAAQTHGTLKSYLIGFGLSVVLTAI
FT                   PFWLVMGDVLGNKQATGLVIMAFAAVQIVVHMIYFLHMTTAAEEGWTMMALIFTIVMVV
FT                   IALAGSLWVMHHLTTNMMPAHDMIRR"
FT   gene            complement(272790..273419)
FT                   /locus_tag="RPB_0240"
FT   CDS_pept        complement(272790..273419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0240"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04951"
FT                   /db_xref="GOA:Q2J3K9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K9"
FT                   /protein_id="ABD04951.1"
FT                   /translation="MSVVAAAPQAAEPVFHVVDEHAHPEGASTMLGFWIYLMSDCLIFA
FT                   ILFATYGVLGANYAAGPAPKDLFDLKLVAVNTAMLLMSSITYGFAMLTMEKRQVGATLA
FT                   WLGVTGLFGLAFLGIELYEFHHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIIWLVT
FT                   LMVQVARAGLIEANRRRLMCLSMFWHFLDVVWIGVFTFVYLLGTLR"
FT   gene            complement(273416..275425)
FT                   /locus_tag="RPB_0241"
FT   CDS_pept        complement(273416..275425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0241"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04952"
FT                   /db_xref="GOA:Q2J3K8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K8"
FT                   /protein_id="ABD04952.1"
FT                   /translation="MLTNPDIVKAIFGRLSLESLPLHEPIVVLTFVAVALGGAALVAGL
FT                   TYFKLWGYLWREWFTTVDHKRIGIMYMILGIVMLLRGFADAVMMRAQQAMAFNGSEGYL
FT                   NAHHYDQVFTAHGVIMIFFVAMPMVTGLMNYVVPLQIGARDVSFPFLNNFSFWMTTAGA
FT                   VLVMISLFVGEFARTGWLAYPPLSNIGYSPDVGVDYYIWALQVAGVGTTLSGVNLICTI
FT                   VKVRAPGMTMMRMPIFTWTSLCTNILIVASFPVLTVVLALLSLDRYVGTNFFTNDFGGN
FT                   PMMYVNLIWIWGHPEVYILILPAFGIFSEVTSTFSGKRLFGYTSMVYATVVITILSYLV
FT                   WLHHFFTMGSGASVNSFFGITTMIISIPTGAKMFNWLFTMYRGRIRYDLPMMWTIAFML
FT                   TFVIGGMTGVLLAVPPADFVLHNSLFLVAHFHNVIIGGVVFGLFAGIAYWFPKAFGFKL
FT                   DVFWGKISFWCWVVGFYFAFMPLYVLGLMGVTRRLRVFDDPSLQIWFIIAGFGAFLILI
FT                   GIVAFLIQIAVSVMRREQLRDVTGDPWNGRTLEWATSSPPPDYNFAFTPMVRDSDAWWD
FT                   MKKAGYKRPLEGFKPIHMPSNTGTGIILSGLSMVMAFGLIWYIWWLAALSFIALLAVAI
FT                   GHTFNYHRDFHIPAEEVVRVEDERTRLLAEGAKP"
FT   gene            complement(275434..276591)
FT                   /locus_tag="RPB_0242"
FT   CDS_pept        complement(275434..276591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0242"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04953"
FT                   /db_xref="GOA:Q2J3K7"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K7"
FT                   /protein_id="ABD04953.1"
FT                   /translation="MSRLKILALLPLAVLLSGCNFVVMAPAGDIAVQQRDLIVISTVLM
FT                   LLIVLPVMALTVWFAWRYRHSNDAAKYDPDWDHSTGLELVIWSAPLAIIICLGAITWMG
FT                   THLLDPYRSLDRIAHDRPIDRAKAPLEVDVVALDWKWLFIYPEYGIASLNELAAPVDRP
FT                   ISFRITASSVMNSFYIPALAGMIYAMPGMETKLHAVVNHAGTYKGFSANYSGAGFSGMR
FT                   FDFHGLDDAGFEQWVAKTKASSDTLGRTEYLALEKPSANEPARGFGTVDADLYRAILNM
FT                   CVEPGKMCMSEMMAIDARGGNGMAGLRNTLPLAYDKYARRGTALGPEPSFVAGTCTIDE
FT                   PQGRVTAQVRDSSPLLGAGLKRPPLFTPLGSSTSLLFAPASKSES"
FT   sig_peptide     complement(276523..276591)
FT                   /locus_tag="RPB_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.517 at
FT                   residue 23"
FT   gene            276777..278084
FT                   /locus_tag="RPB_0243"
FT   CDS_pept        276777..278084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0243"
FT                   /product="MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04954"
FT                   /db_xref="GOA:Q2J3K6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K6"
FT                   /protein_id="ABD04954.1"
FT                   /translation="MTETTTAGLGSDPAHKQANPGEIAIGVIIGRTAEFFDFFVYAIAS
FT                   VIVFPRLVFPFASELTGTLYAFAIFAVAFIARPLGTVIFMAIDRRYGKSAKLISAMLLL
FT                   GTATVAIAFLPGYSEIGAASIWLLALARAAQGLAWGGAWDGMASLLALNAPKEQRGWYA
FT                   MVPQLGAPLGLIVASALFAYFTGHLSSEDFFGWGWRYPFFVAFAINVVALFARLRMVVT
FT                   PEYASLFESRELQPSRVLATLGHDGRNIIIGAFAPLASFALFHMVTVFPLSWVFLFTRE
FT                   SPVRFLIIETIGAMFGVAAIIASGMLADRIGRKPLLMGSAIAIAVFSGFAPQMLDAGPV
FT                   GETAYMILGFILLGLSFGQSSGVIASSFRTAYRYTASALTADLAWLFGAGFAPLVALLL
FT                   ATDFGLISSGAYLLSGAVVTILALYISGLRESEEYR"
FT   gene            278258..278812
FT                   /locus_tag="RPB_0244"
FT   CDS_pept        278258..278812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0244"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04955"
FT                   /db_xref="GOA:Q2J3K5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K5"
FT                   /protein_id="ABD04955.1"
FT                   /translation="MGVEKPSMDAIETERLALRDFRSEDAADLFAYLHQPTASCFLSLS
FT                   LADMGAAAAEANARSQSDEHIAVCFKDTGRLIGDLFAVQEDDTFSVGWNFNADFRGAGL
FT                   ASEAARALFGHLFTVRQARRLYAYVEDHNIASQRLCKRLGMRQEGLFKEYVTFKADSKG
FT                   VPIYENTMQFAILRKEWEQQH"
FT   gene            complement(278861..278950)
FT                   /locus_tag="RPB_R0003"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(278861..278950)
FT                   /locus_tag="RPB_R0003"
FT                   /product="tRNA-Ser"
FT   gene            complement(279177..280328)
FT                   /locus_tag="RPB_0245"
FT   CDS_pept        complement(279177..280328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04956"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K4"
FT                   /protein_id="ABD04956.1"
FT                   /translation="MAEDTLTTTNAGIAAHGAERLPSVDVDTYNIELKDDDGFLGDRAS
FT                   KGAFQRMLDASRKPLRKTGDDPLGKKPTEEISKGALDEILNGDDVHAAALVHGAIEEFA
FT                   QELAYVTGRFLKTKAWADTECIVVGGGFRQGRVGELAIARTDILLKSEGLKVDLVPIRF
FT                   DPDEAGLIGCLHLAPSWIFEGHDSILAVDIGGSNIRCGVVETGWKKARDLSKASVWKVD
FT                   LWRHAEDEPTREGAVKRLTKMLQGLIADAEKEGFKLAPFIGISCPGVINSDGTIEKGAQ
FT                   NLPGNWESSRFHLPRSLLEGIPTIGDHDTAILMHNDGVAQGLSEVPFMQDFERWGVLTI
FT                   GTGLGNARFTNRKTKEKGKKAKEKDKDDKPSDKQKDKERKEKA"
FT   gene            280664..281050
FT                   /locus_tag="RPB_0246"
FT   CDS_pept        280664..281050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0246"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04957"
FT                   /db_xref="GOA:Q2J3K3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3K3"
FT                   /protein_id="ABD04957.1"
FT                   /translation="MFAVIKTGGRQYRVVPEDVLEVGKIEGDVGTIVQLGEVLMLGGDT
FT                   PLIGLPTVAGASVAAEVLDHKRGPKVISFKKRRRKNSKRKRGYRDEITVLRITEILADG
FT                   KSPSVGPRPKRVKAEPAPAADAAE"
FT   gene            281136..281405
FT                   /locus_tag="RPB_0247"
FT   CDS_pept        281136..281405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0247"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04958"
FT                   /db_xref="GOA:Q2J3K2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3K2"
FT                   /protein_id="ABD04958.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAYGGEHVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTFVSVLPIAQAAE"
FT   gene            281535..282131
FT                   /locus_tag="RPB_0248"
FT   CDS_pept        281535..282131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0248"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04959"
FT                   /db_xref="GOA:Q2J3K1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K1"
FT                   /protein_id="ABD04959.1"
FT                   /translation="MLQDIPTPTPVLREARPCVLETERLTLRKPALADVTTIARLANDR
FT                   RVAEMTRRLPHPYTRDDAARFVTSLGQTHETVFLIEADFEPVGMVGVDWRNRETPELGY
FT                   WLGVSHWGNGYATEAARAVIDFTFEEYAITQMISAARVVNPASRNVLEKCGFQWTGVEL
FT                   HRMEAIGSSTPVDCFRLTRGVWSSLKSWGKTRRSR"
FT   gene            282314..282490
FT                   /locus_tag="RPB_0249"
FT   CDS_pept        282314..282490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04960"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3K0"
FT                   /protein_id="ABD04960.1"
FT                   /translation="MLTQRYIQAVLTHDIADRITHSADVIEKCERALRVAEQNEPTEQL
FT                   SFRFVDLDRRFGI"
FT   gene            complement(282824..283738)
FT                   /locus_tag="RPB_0250"
FT   CDS_pept        complement(282824..283738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0250"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04961"
FT                   /db_xref="GOA:Q2J3J9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J9"
FT                   /protein_id="ABD04961.1"
FT                   /translation="MGLFRKISIGPDEHGAQAAGIVLMLLAMLAFSFADAVGKKVVATY
FT                   PVGEFLLLRAIAGLVLLAPLIWRQRAAFIRLERPGLQLARMLVSAFEVAAFFLATVYLP
FT                   LADVITFYLASALFVSVGAALFLGETIDRARAIAILVGFAGVLIALQPSPQTMSWPALI
FT                   AILASVLFAALMLITRFLRRTPEIALATQQFIGTALLGSVLLAPSGWIAPPPADWIWFV
FT                   LAGVGSAAGLLCVNRSLRLAPASVVVPYQYTMIIFAAALGWLFFGDVPTLSTLVGVVVI
FT                   VGAGLYLALRDRKTADEAPPQTN"
FT   sig_peptide     complement(283634..283738)
FT                   /locus_tag="RPB_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.543 at
FT                   residue 35"
FT   gene            283922..284983
FT                   /locus_tag="RPB_0251"
FT   CDS_pept        283922..284983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0251"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04962"
FT                   /db_xref="GOA:Q2J3J8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3J8"
FT                   /protein_id="ABD04962.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDV
FT                   VVEAADGLNTLIDYRYQQHFKAQKGVNGMGSDRHGANGKAIVLKVPVGTQIFDEDKETL
FT                   IHDFTTVGERFVLAEGGNGGFGNAHFKSSTNRAPRHANPGLPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNADGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLIDATCEHAGKAYKTVRGELEAYAETLADKIEIVALNKI
FT                   DAVEPDELKKQKDRLKRAAKKTPLLISGITGQGVPEALRALAAVIGEAPVSDKAKGAAD
FT                   NAANAEPWAPQDA"
FT   gene            285115..286245
FT                   /locus_tag="RPB_0252"
FT   CDS_pept        285115..286245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0252"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04963"
FT                   /db_xref="GOA:Q2J3J7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3J7"
FT                   /protein_id="ABD04963.1"
FT                   /translation="MARPKLHDFRRIVVKVGSSLLIDSGAGEVRATWLAALAADIAELH
FT                   RDGRDVMIVSSGSIALGRSRLKLPRGALKLEESQAAAAVGQIALARTWSEVLGHHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATNEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGSNPDAKLIPVVDSVTAEIEGMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLKAIAGGGPCTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVTALRAGKSLLPAGVIRVDGQFARGDAVIVRGPDTHEIGRGLVAYDADDA
FT                   DRIKGRSSPDVMSILGVSGRAEMIHRDDLVVGTAPG"
FT   gene            286398..287690
FT                   /locus_tag="RPB_0253"
FT   CDS_pept        286398..287690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0253"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04964"
FT                   /db_xref="GOA:Q2J3J6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3J6"
FT                   /protein_id="ABD04964.1"
FT                   /translation="MTASLKAIDGSAELATLMHDLGRRARAAARVLALASPEQKNRALE
FT                   AMERAIRAGADKILAANAEDVADANASGANSAFLDRLTLTPARVEAMAEGIAVVRGIPD
FT                   PVGAVTESWQRPNGMTIERVRVPLGVVAVIYESRPNVTADAGVLCLKSGNAVILRGGSE
FT                   SFRSGRAIHDCLVQGLREAGLPEAAITLVPTRDRAAVGLLLGGLNGSVDVIVPRGGKSL
FT                   VARVESEARVPVFAHLEGVNHVYIDRSADLDMAKSIVLNAKMRRTGVCGAAETLLIDRA
FT                   AADTHLAPLVAMLIDAGCEVRGDAIVQHADARVKPATDQDWDTEYLDAVIAAKVVDDVD
FT                   DAIVHIHDHGSHHTDAIVAEDAQTAAKFLGEVDSAIVLHNASTQFADGGEFGFGAEIGI
FT                   ATGKFHARGPVGAEQLTTFKYRIHGTGQTRP"
FT   gene            287721..288350
FT                   /locus_tag="RPB_0254"
FT   CDS_pept        287721..288350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0254"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04965"
FT                   /db_xref="GOA:Q2J3J5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J5"
FT                   /protein_id="ABD04965.1"
FT                   /translation="MTPDPVAARRAVPAYSPGMRIGLLGGSFNPPHEAHRAISRFALTR
FT                   LKLDRIWWLVSPGNPLKDVTALRELDARVGAAQAMADDPRIQVSCLEAAIGTRYTADTI
FT                   DYLLRHCPGARFVWIMGADNLAQFHRWQRWQRIATSLPIAVIDRPPATFRALAAPAAQT
FT                   LKRYRLAGNAAATLADRAPPSWIFLTGLKSPLSSTSLRNPDGSWKK"
FT   gene            288568..288975
FT                   /locus_tag="RPB_0255"
FT   CDS_pept        288568..288975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0255"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04966"
FT                   /db_xref="GOA:Q2J3J4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J4"
FT                   /protein_id="ABD04966.1"
FT                   /translation="MAAASRSAAESLTPDAISATPLTAEETLQLILSRLDDMKAEEPIA
FT                   IDIRGKSAMFDYVVVASGRVNRHVGAIAENVAKALKEAGITKIHVEGLTNCDWVLMDCG
FT                   DVVLHVFRPEVREFYNIERLWTQGPQPAKTL"
FT   gene            289079..289561
FT                   /locus_tag="RPB_0256"
FT   CDS_pept        289079..289561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0256"
FT                   /product="Protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04967"
FT                   /db_xref="GOA:Q2J3J3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3J3"
FT                   /protein_id="ABD04967.1"
FT                   /translation="MRLTVIAVGKLKQGPERELAERYRARFDDIGRKLGFRGLDIHEIS
FT                   ESRARDAATRMAEEAAAIAALVPDGGALVTLDERGKSVDSAAFAAQLGRWRDESVPGTI
FT                   FVIGGADGLLPELRRKAKLCLSFGAATWPHQMVRVMLLEQIYRAATILAGHPYHRA"
FT   gene            289581..290966
FT                   /locus_tag="RPB_0257"
FT   CDS_pept        289581..290966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0257"
FT                   /product="Peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04968"
FT                   /db_xref="GOA:Q2J3J2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J2"
FT                   /protein_id="ABD04968.1"
FT                   /translation="MQHHLATAAKDQASGAGWPSVALLSASLVSGGLVLMSGATIVAAQ
FT                   AQTVPAAVPAPPPTIDLIRQREQELEAARQQQKRATELQDKLRADLAAIGEDRTKLNQQ
FT                   LIDIAAKVRAVEARISEAEARLVPLDARESRIRTSLDQRRGEIGEVLAALQRAGRRAPP
FT                   ALLVRPEDALKSLRTAILLGAVVPDLRERADRLATDLGELIAVRKTIAAERDQLATDRG
FT                   SMTADQTRLAALIDERQHKQSGVEKDIETERARALSLSRQVDSLQGLIAKMEQDLKSAA
FT                   KAAAAATQKGSPVALNGQPNLAALKDPGRLSPAVAFASAKGMLAFPVNGAKIREFGRPD
FT                   GVGGVERGISLSARPGAQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAGMERIS
FT                   VNIGQFVLTGEPVATMGSTSQVASILAANATQPVLYIEFRKDGTPIDPGPWWAANEGEK
FT                   VRG"
FT   sig_peptide     289581..289721
FT                   /locus_tag="RPB_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.854) with cleavage site probability 0.745 at
FT                   residue 47"
FT   gene            290963..292336
FT                   /locus_tag="RPB_0258"
FT   CDS_pept        290963..292336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0258"
FT                   /product="C-terminal processing peptidase-3. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04969"
FT                   /db_xref="GOA:Q2J3J1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J1"
FT                   /protein_id="ABD04969.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRSVLMGSTARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLIESSISGMLTGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGIMANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIMRKGQDNPIEVTLVRDNIRVRSVRARVESDDIGYIRITTFNEQTTEGLKRE
FT                   IANLTKQIGADKLKGFILDLRNNPGGLLEEAVTVSDTFLDRGEIVSTRGRNAEETQRRS
FT                   AHAGDLTKGKPVMVLINGGSASASEIVAGALQDHKRATLIGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQAKGITPDIEVLQDVPDDLKARTDTKGEASLRGHLKGQDG
FT                   DEKTGSQSYVPPEAKDDKALKTAADLLHGIKATATTPTAPVTGEKAAIDKPAGNKAAN"
FT   sig_peptide     290963..291073
FT                   /locus_tag="RPB_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.742 at
FT                   residue 37"
FT   gene            292484..293701
FT                   /locus_tag="RPB_0259"
FT   CDS_pept        292484..293701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0259"
FT                   /product="Protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04970"
FT                   /db_xref="GOA:Q2J3J0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3J0"
FT                   /protein_id="ABD04970.1"
FT                   /translation="MSADELSTPLGQKRSRLRRFRLPFTVTQAIATLLGLFLLAFVGFA
FT                   LFNDDPLGGEPIAHITLKPPTPDEAKEAAAAADKANGAKTEKTERAAAKDAALPGQKTI
FT                   TIIDGSKGTRQDVVVSAGNDDKADTPPAEPAMAGGINPRLLEQSRYGMIPVMAGALKPF
FT                   SAYAMSTDAERAKADRMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGADPGKL
FT                   VEQARAKQHEVLLQIPMEPFDYPDNDPGPQTLLTSGAPEQNLDRLNWHLSRIQGYVGLS
FT                   NFMGARFVATEAAMQPIIREAAKRGLGYLDDGSAPRSVAPALAKSLAMPFARADLAIDS
FT                   VPTGGEIDKALARLEGLAKERGLAIGTASALPLSIERIVSWSKSLESRGILLVPLTTAM
FT                   LKSKST"
FT   sig_peptide     292484..292630
FT                   /locus_tag="RPB_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.697) with cleavage site probability 0.584 at
FT                   residue 49"
FT   gene            293834..294337
FT                   /locus_tag="RPB_0260"
FT   CDS_pept        293834..294337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0260"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04971"
FT                   /db_xref="GOA:Q2J3I9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I9"
FT                   /protein_id="ABD04971.1"
FT                   /translation="MARYEDLPYRTCVGMMLINRAGLVFIGRRAGGIEHVDDTHVWQMP
FT                   QGGVDPGEDTWEAAKRELYEETNVRSVEKIAEVPDWLIYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFAIRFTGQDSEIDIIAPPGHKSEFTSWRWEPMLNLPDLIVPFKRPVYERVVKEFSQL
FT                   AIAV"
FT   gene            complement(294456..295526)
FT                   /locus_tag="RPB_0261"
FT   CDS_pept        complement(294456..295526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04972"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3I8"
FT                   /protein_id="ABD04972.1"
FT                   /translation="MTAPVDPSNARILEIGGGYFKLQYPERTTCLWTWTKLTDDFGKLD
FT                   GFSTPDRIWRELRAARDGKYDVVVVNTLRYSPWHPRYWARGIFYTPRDPWAALTRQFGP
FT                   SMLRWLDVPVPLVAVEMDDHFGIAKSSVFLLDKAKAYFKRELPADAWQVLSGSVHPHLP
FT                   TLRYRRNEKWKRRIGRLQPISLPQYRFESRWRDAPFPDKTHDLFFSGGIDGNSTVRAAG
FT                   LPELEQLRAMGVRIDQPTERLPYDAFMERMSHSWLAWSPEGMGWDCYRHYEAPIVQAVP
FT                   VMNNPTIVRYAPLLSGVHGVYYDIEPGGLVRAVTAALADKDKLRSMALTARDHVLAHHT
FT                   VKAHCDHILRAALAPE"
FT   gene            295742..296695
FT                   /locus_tag="RPB_0262"
FT   CDS_pept        295742..296695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0262"
FT                   /product="sugar nucleotide dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04973"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3I7"
FT                   /protein_id="ABD04973.1"
FT                   /translation="MHMRLSRRILVSGGAGFIGSHLCDKLLAEGHEVLCVDNYFTGWRR
FT                   NIEHLVGTPRFEVMRHDVTFPLYVEVDDIYNLACPASPVHYQHDPVQTLKTSVHGAINM
FT                   LGLAKRTRAKIFQASTSEVYGDPTVHPQPESYWGHVNPLGIRACYDEGKRAAETLFFDY
FT                   HRQHKVRIKVARIFNTYGPRMHPNDGRVVSNFIVQALSGNDITIYGDGSQTRSFCYVTD
FT                   LLDGFGRLMASGDEFIGPVNLGNPVEFSIRQLAELVIEMTDSTSKIVARPLPADDPRQR
FT                   QPDIALARSALGWEPKVALADGLKETISYFRKLLAS"
FT   gene            296719..297213
FT                   /locus_tag="RPB_0263"
FT   CDS_pept        296719..297213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0263"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04974"
FT                   /db_xref="GOA:Q2J3I6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3I6"
FT                   /protein_id="ABD04974.1"
FT                   /translation="MPYRRNVGIALFNAEGRVLIGRRFRDDGPEIILPGLEWQMPQGGI
FT                   DEGEEPHTAVMRELWEETGVQHAELLGEADWIAYDFPPYDGPPHRLEHFRGQRQKWFAL
FT                   RFTGNDSEIDPLAVRNDMPPEFDAWRWERLDRVADLVVPFRREVYREVARSFARFVLPA
FT                   T"
FT   gene            complement(297397..297816)
FT                   /locus_tag="RPB_0264"
FT   CDS_pept        complement(297397..297816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0264"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04975"
FT                   /db_xref="GOA:Q2J3I5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I5"
FT                   /protein_id="ABD04975.1"
FT                   /translation="MSAGMATFHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPV
FT                   VAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLADVATATADVDMQDFAETITTM
FT                   EQQLPGKVGDELDRSIERLDHYKSIQHQLSTTAMH"
FT   gene            complement(297934..299364)
FT                   /locus_tag="RPB_0265"
FT   CDS_pept        complement(297934..299364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0265"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04976"
FT                   /db_xref="GOA:Q2J3I4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I4"
FT                   /protein_id="ABD04976.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGNPIMVPVGVGTLGRIMNVIGEPVDEQG
FT                   PVANEGLRPIHAEAPTYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVALSGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTHKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSPLIVGEEHYQTARMVQQVLQKYKSLQDIIAILGMDELSEEDK
FT                   LAVARARKIERFLSQPFFVAEIFTGSPGKFVDLADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GAIEEAVEKGKKLAAEAA"
FT   gene            complement(299435..300310)
FT                   /locus_tag="RPB_0266"
FT   CDS_pept        complement(299435..300310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0266"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04977"
FT                   /db_xref="GOA:Q2J3I3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I3"
FT                   /protein_id="ABD04977.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPY
FT                   AEKMDSVISNIAGAAAGSPGAPVLLAGTGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RAYALMNQGKEVKFFCVGRKGYEQLRRTFDKQIIENLELRSVRQLGFVNAEDIAKKVIA
FT                   RFNAGEFDVCTLFYSRFKSVISQIPTAQQLIPLVVEAPAAGSVATSYEYEPEEDEILST
FT                   LLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGDMIRKQTLIYNRTRQAMITKEL
FT                   IEIISGAEAI"
FT   gene            complement(300452..301984)
FT                   /locus_tag="RPB_0267"
FT   CDS_pept        complement(300452..301984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0267"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04978"
FT                   /db_xref="GOA:Q2J3I2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I2"
FT                   /protein_id="ABD04978.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDTPVGKGLL
FT                   GRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDHGAGSLTALPVIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALP
FT                   VAKVRAFEDGLLSLLRGKEVGILDAIRTSRDLSDDTAAKLKAVVESYAKTFA"
FT   gene            complement(301984..302544)
FT                   /locus_tag="RPB_0268"
FT   CDS_pept        complement(301984..302544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0268"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04979"
FT                   /db_xref="GOA:Q2J3I1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3I1"
FT                   /protein_id="ABD04979.1"
FT                   /translation="MASEDPSVSGVSGRYATALFELARDEKVVDAVTADLDKFKAMLAD
FT                   SPDLLRLVRSPVFGAEAQAKALGAVLDKAGITGISANFLKLLAANRRLFVVADVIRAYR
FT                   ALVAKFKGEATADVTVAETLGDKNLEALKAALKAVTGKDVTLNINVDPAIIGGLVVKLG
FT                   SRMVDSSIRTKLNSIKHAMKEAG"
FT   gene            303167..303649
FT                   /locus_tag="RPB_0269"
FT   CDS_pept        303167..303649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0269"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04980"
FT                   /db_xref="GOA:Q2J3I0"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3I0"
FT                   /protein_id="ABD04980.1"
FT                   /translation="MTNAKKSPPGIVTRPRTTAALIAATVLLSGAAITEASARSKQKHH
FT                   HQRHHVQNDWRNANATLAEGGGGRTFSGVASYYGNESGNRTASGQRFNASAMTAAHRSL
FT                   PFGTKLRVTHGGRSVVVTINDRGPFIRGRVLDLSTGAARAIGLTSRGVGRVVAEVM"
FT   sig_peptide     303167..303271
FT                   /locus_tag="RPB_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.730 at
FT                   residue 35"
FT   gene            complement(303801..306008)
FT                   /locus_tag="RPB_0270"
FT   CDS_pept        complement(303801..306008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0270"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04981"
FT                   /db_xref="GOA:Q2J3H9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H9"
FT                   /protein_id="ABD04981.1"
FT                   /translation="MDDSPTSPASPSAMRVVDVQVPVAIDQAYSYRVPRGLELKPGDVV
FT                   AVPLGSREVMGVVWAENENPDPRLHNRLKDVAEKLDVPPLREELRRLVDWVANYTLSPR
FT                   GQVLRMTLRMGELGPERVRTGVRLIGPPPQRMTPARRRLIEILSDGLLHGKSDAAKEAG
FT                   CSAGVIDGLVDEGTLSVEPMPREPAAPTPDPDFAPADFSPEQAAAAETMRELVKSGGGF
FT                   QAALLDGVTGSGKTEVYFEAVAEIIRQGRQTLILMPEIALTGQFLDRFALRFGVRPLEW
FT                   HSELTPRTRARNWAAIAAGEAQVVVGARSALFLPYADLGLIIVDEEHDQAYKQEDGAHY
FT                   HARDMAVVRASIAKIPIVLASATPSVETEVNARKGRYRRIPLPSRFGGQHMPQIEAIDL
FT                   RRAPPMRGRFISPPLAEQIGHAIERGEQALLFLNRRGYAPLTLCRACGHRFACTICDAW
FT                   LVDHRFRQRLVCHHCGFSMPRPHQCPHCGAEESLVAVGPGVERLQEEAASLFPQARTMV
FT                   LSSDLITSIEAMRSELNDIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGDP
FT                   RAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPVMKALVACDREAFYASEIDARER
FT                   TLYPPFGRLASLIVSAGDRPSAEGFARKLASCAPVDERVQVLGPAEAPLAVIKGRYRFR
FT                   LLVKSVRSFDLSNYLRSWLAQGPKTKGNLKLEVDVDPQSFL"
FT   gene            306126..307181
FT                   /locus_tag="RPB_0271"
FT   CDS_pept        306126..307181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0271"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04982"
FT                   /db_xref="GOA:Q2J3H8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H8"
FT                   /protein_id="ABD04982.1"
FT                   /translation="MPGASGLLRFARNDGEDLVSVGIRHKHHMAKSQPMPPPIDLPCAA
FT                   ADLNAEFTRWLSHLRAERRLSGKTLEAYARDLRQFLFFLAGHWGGEVTLGRFARLETTD
FT                   VRAFMAARRGDAIAGRSLMRALAGLRSFGRFLEREGKGSVGALSAVRAPKIKKSLPKPI
FT                   QIAAAKRLADADERAGEDRETWVLVRDAAVMALLYGSGLRISEALGLKRRDVPAPGKGD
FT                   TLIVLGKGNKTRMVPVLDAVLAQIADYAKACPHPLPPDGPMFVGARGGPLSPRIIQLAM
FT                   ERLRGALGLPDSATPHALRHSFATHLLSRGGDLRAIQELLGHASLSTTQIYTGIDTERL
FT                   LEVYASAHPRA"
FT   gene            307311..307901
FT                   /locus_tag="RPB_0272"
FT   CDS_pept        307311..307901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04983"
FT                   /db_xref="GOA:Q2J3H7"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H7"
FT                   /protein_id="ABD04983.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKKIALLIAVIALFLAFSETLGKAAQ
FT                   TESLAKNVEASNLWAFFQAKSIRRTVVQTVSEQARLSMGTVGDDAAKAGLQKQIEEWQK
FT                   TAQRYRSEPETGEGSEQLAARAKHAEHDRDLAQARYHHYELASAAFQIGIVLASATIIT
FT                   GMIALAWISGLLALGGLAFTAIGLFAPHAVHLF"
FT   gene            complement(307937..308476)
FT                   /locus_tag="RPB_0273"
FT   CDS_pept        complement(307937..308476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04984"
FT                   /db_xref="GOA:Q2J3H6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H6"
FT                   /protein_id="ABD04984.1"
FT                   /translation="MKRRLLQPLWFILAVLFLVEAWLWEHLEPWVERIVAALPLRELKA
FT                   WTAERVAHLSPPLALVVFAVPLIPLYPFKLFALWLMATQHFIAGLLAFVLAQFVGLGLI
FT                   AFIFDVTKPKLMQMAWFVRAYQFVLAIKAKAHAIVAPVMAAIRARISALIGEGDGPMQR
FT                   LLRKAMQVRKRIRASR"
FT   gene            complement(308513..309916)
FT                   /locus_tag="RPB_0274"
FT   CDS_pept        complement(308513..309916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0274"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04985"
FT                   /db_xref="GOA:Q2J3H5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H5"
FT                   /protein_id="ABD04985.1"
FT                   /translation="MANYDLVIIGTGPGGYVCAIRAAQLGLKVAVVEKNPTLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIGVPAPTLDLPTMMNFKQQGIDGNVKGVEYLMK
FT                   KNKIDVLVGRGKVLGTGKVEVTGNDGKAQTVETKSIVIATGSDVAKLKGIEIDEKRIVS
FT                   STGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAQVTVVEFLDRILPGMDAEIVKQFQ
FT                   RILEKQGFAFKLGAKVTGVDSSGKQLKVSVEAAAGGNPETLEADVVLVAIGRVPFTEGL
FT                   GLQEAGVALDERGRVAIDDHFATSVQGVYAIGDVVKGPMLAHKAEDEGVAVAEIIAGKA
FT                   GHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGLVK
FT                   ILADAKTDRVLGVHIVGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAAL
FT                   AVGKRAIHM"
FT   gene            complement(309947..310693)
FT                   /locus_tag="RPB_0275"
FT   CDS_pept        complement(309947..310693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0275"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04986"
FT                   /db_xref="GOA:Q2J3H4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H4"
FT                   /protein_id="ABD04986.1"
FT                   /translation="MNDRVVVITGGSRGIGRATALAAAARGFKVVVGYASNAEAAQETV
FT                   SAIEASNGRAIAVKCDVGDEADIIALFEAADKFGTLGALVNNAGIVGPTARVDEMSAER
FT                   IQRMMAVNVTGSILCAREAVKRLSTRHGGPGGVIINLSSVAAKLGSPNTYVDYAASKGA
FT                   IDSFTIGLGHEVAGEGIRVAAIRPGLIDTEIHASGGDPDRAHRLSGHVPMQRVGRAEEI
FT                   ANAVVWLMSDEASYVTSAIIDVSGGR"
FT   gene            complement(310701..311102)
FT                   /locus_tag="RPB_0276"
FT   CDS_pept        complement(310701..311102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04987"
FT                   /db_xref="GOA:Q2J3H3"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H3"
FT                   /protein_id="ABD04987.1"
FT                   /translation="MQPMPTEIVVLGWSVVLLIGQMFLASIPATMELGGPYQAGPRDEG
FT                   KVAQGRFAGRAARAFRNLLETYPAFVALALALAVTGKTGGYAATAAVIWLVARVLYAPL
FT                   YIIEIPFARSIAWLVSLLALIAMLIRLLS"
FT   gene            complement(311163..312398)
FT                   /locus_tag="RPB_0277"
FT   CDS_pept        complement(311163..312398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0277"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04988"
FT                   /db_xref="GOA:Q2J3H2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H2"
FT                   /protein_id="ABD04988.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIIAKDGETVAVGALLGQISEGGGAAKPAAPAKPAAAPAAAAAAPAAA
FT                   APKAAPADAPQAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQ
FT                   PAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMAL
FT                   RSQYKDVFEKKHGAKLGFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGT
FT                   DKGLVVPVVRDCDEKSIAAIEKGIADFGKRARDGQLKIEEMQGGTFTITNGGIYGSLMS
FT                   TPILNAPQSAILGMHKIQERPVVVAGKIEIRPMMYLALSYDHRVIDGKEAVTFLVRVKE
FT                   SLEDPARLVLDL"
FT   gene            complement(312499..315456)
FT                   /locus_tag="RPB_0278"
FT   CDS_pept        complement(312499..315456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0278"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04989"
FT                   /db_xref="GOA:Q2J3H1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H1"
FT                   /protein_id="ABD04989.1"
FT                   /translation="MSRQDANAAFALSSFLQGANATYIDDLYSRYENDPNSVDADWQAF
FT                   FKSLKDNPGDIQKNAEGPSWEQAHWPLTPRDDLTSALDGNWAQVEKTVGQKIQSKAQTK
FT                   GVELSTSDVNQATRDSVRALMLIRAYRMRGHFHAKLDPLGLEPAKDHEELDIRSYGFTE
FT                   ADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTMGIEFLHISNGAQKAWLQERIEGPD
FT                   KEISFTREGRRAILMKLVEAEGFEKFCDLKFTGTKRFGLDGGESLIPALEQIIKRGGNL
FT                   GVREIVLGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDEVEGSGDVKYHLGASSDR
FT                   EFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERVSVLPLLMHGDAAFAG
FT                   QGVVAECFGLSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKIAVEYRQKFHKPVVIDMFCYRRHGHNEGDEPAFTQPMMYRKIAGHP
FT                   SALELYSKRLIADGVITEGEVEKAKADWRARLDAELEAGSSYRPNKADWLDGKWAGFKS
FT                   ADQEEDPRRGITGVDLANLKEIGRKITKVPEGFRVHRTVGRFLENRAKAIDSGVGIDWA
FT                   TGEALAFCTLLQEGHRVRLSGQDSERGTFSQRHSVLFDQEDETRYTPFNHLSPDQGHYE
FT                   VVNSMLSEEAVLGFEYGYTLAEPNALTIWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCMLPHGYEGQGPEHSSARLERFLQMCAEDNMQVVHATTPANFFHVLRRQLRREIRK
FT                   PLILMTPKSLLRHKRAVSRLDEFGPDTSFHRVLADDAQVLPDEKIKLVPDAKIRRVVIC
FT                   SGKVYYDLYEEREKRGIDDIYLLRVEQLYPVPLKTLVQEMSRFKEAELVWCQEEPRNMG
FT                   AWHFIEPYLEWVQNQAGATHRRPRYVGRPASAATASGLMSKHLAQLKAFLDEAMR"
FT   gene            complement(315585..316469)
FT                   /locus_tag="RPB_0279"
FT   CDS_pept        complement(315585..316469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0279"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04990"
FT                   /db_xref="GOA:Q2J3H0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3H0"
FT                   /protein_id="ABD04990.1"
FT                   /translation="MSILIDANTKVICQGFTGKNGTFHSEAAVAYGTKMVGGTSPGKGG
FT                   TTHLGLPVFDTVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVKRSLVGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTTSEGLGQTTAVGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEEAAQFL
FT                   IDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSP
FT                   ARLGKTLAEKLKS"
FT   gene            complement(316530..317726)
FT                   /locus_tag="RPB_0280"
FT   CDS_pept        complement(316530..317726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0280"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04991"
FT                   /db_xref="GOA:Q2J3G9"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3G9"
FT                   /protein_id="ABD04991.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAATKLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSVDEVKTYAEQMLHATLVTVQTGPAGKQVN
FT                   RLYIEEGSEIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPAT
FT                   GIMSHHGRAVANALGLKGDQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCL
FT                   DAKMSFDGNSLYRHADIQGLRDESEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMTPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVNAVKGA"
FT   gene            complement(317818..318786)
FT                   /locus_tag="RPB_0281"
FT   CDS_pept        complement(317818..318786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0281"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04992"
FT                   /db_xref="GOA:Q2J3G8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3G8"
FT                   /protein_id="ABD04992.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHMIGLKELGDVVLFDIAEGVPQGKAL
FT                   DIAESSPVDGFDANFTGANSYEAIEGASVVIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGMPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLVKMGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPVAAYLNGEYGVKDMYVGVPVVIGAKG
FT                   VERIVEIEMAGKDREAFDKSVGAVQGLVDACKKIAPDLLGR"
FT   gene            complement(318976..320157)
FT                   /locus_tag="RPB_0282"
FT   CDS_pept        complement(318976..320157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0282"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04993"
FT                   /db_xref="GOA:Q2J3G7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G7"
FT                   /protein_id="ABD04993.1"
FT                   /translation="MSPPLSFRQHYQSLVASGAIEADPAQARAVEAFGALDDTLANYKP
FT                   PKKQGFLGRLFGGGEPDKPPRGLYVHGEVGRGKTMLMDLFFDACPVPHKRRAHFHEFMA
FT                   EAHERINAFRQNIKRGEIPDGDVIGLTAASIFEEAWLLCFDEFHVTDIADAMILSRLFG
FT                   KLFELGTVVVATSNVAPDDLYKGGLNRALFVPFIGQVKQHMEVLRLDARTDYRLEKFAG
FT                   MKVWLAPDDAEATAALDRAWSRITGGAAGKPRDIAIKGRHLHVPKSDHHVARFDFADLC
FT                   EKPLGASDYLRLAHEYHTLLIDHVPAMDYADRNAAKRFIALIDTLYDNAVKLMASAAAE
FT                   PADLYSASEGVEAMEFNRTVSRLIEMGSESYLALPHGRSDSLASGATTGLVET"
FT   gene            complement(320215..320781)
FT                   /locus_tag="RPB_0283"
FT   CDS_pept        complement(320215..320781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0283"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04994"
FT                   /db_xref="GOA:Q2J3G6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G6"
FT                   /protein_id="ABD04994.1"
FT                   /translation="MPRLFTGLEIPADVTRTLSHLRGGLPGARWVDPENYHLTLRFIGD
FT                   IDGVTANEIASTLFRINRKPFDVQLQGLASFGGRKPRAVVASVVPSKPLVELQAELERL
FT                   LRRVGLDPEGRKFTPHVTLAWLRDASCQDVADYLSLRGYFPAKVFKAERFVLYSSRAST
FT                   GGGPYVVEAPYALKHTEETRAVRTA"
FT   gene            complement(320974..321582)
FT                   /locus_tag="RPB_0284"
FT   CDS_pept        complement(320974..321582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0284"
FT                   /product="Lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04995"
FT                   /db_xref="GOA:Q2J3G5"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G5"
FT                   /protein_id="ABD04995.1"
FT                   /translation="MAPTRQAEAQTAAKPLKVVVLGDSLSAGYGLPANAAFPAKLQKAL
FT                   QAKGIATDMINAGVSGDTASGGLARLDWSVPPDTDAVIVELGANDALRGTDPKVPQQAL
FT                   DEIVKRLKARNIAVLLTGMLAPPNYGPDYAKQFNAIYPDLAKKYDVPLYPFFLDGVAAV
FT                   AGLNQPDGIHPTAAGIDLVVANILPTVEAFLRSVAGQKG"
FT   gene            321674..322414
FT                   /locus_tag="RPB_0285"
FT   CDS_pept        321674..322414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0285"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04996"
FT                   /db_xref="GOA:Q2J3G4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G4"
FT                   /protein_id="ABD04996.1"
FT                   /translation="MDSFIEPSSRPGTTPDTISISNVNLSLGSGAARVHILKDISLRVA
FT                   PGEAIGLIGPSGSGKSTLLMVMAGLERPDSGEVVVSGTAFNGLSEDALARFRGRAVGIV
FT                   FQSFHLIPTMTALENVAVPLELAGTPDAAARAARELASVGLGERLNHYPSQLSGGEQQR
FT                   VALARALAPDPAILVADEPTGNLDEATGRQIVDLLFTKHAERGMTLVLVTHDTALAQRC
FT                   DRVVRLRSGRVDTTMPGNARARSA"
FT   gene            322418..325000
FT                   /locus_tag="RPB_0286"
FT   CDS_pept        322418..325000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0286"
FT                   /product="Protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04997"
FT                   /db_xref="GOA:Q2J3G3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G3"
FT                   /protein_id="ABD04997.1"
FT                   /translation="MTLVADPLARSAPPSRGWSLPLRYALREMRGGLNGFYVFIACIAL
FT                   GVMAIAGVGSVAASLGEGLAREGRTLLGGDVAFSLIQREATPQELGYLRDRAPVSVAAS
FT                   MRGMARTAEGASALVEIKAVDSLYPMLGELKLDPPLPLADVLAKRDGAFGAAADAAFLA
FT                   RLDLKIGDRVSVGSAAFQIRSVVASEPDKLAGNPGFGPRFLISEDALRATQLLQPGSLV
FT                   RWIYRVRLPDNRADDKAAQDFADATRAALPQAGWEIRSRGNASPQLERTITRFTQFLTL
FT                   VGLAALLVGGVGVANAVKSHIDRRRDVIASLKALGATGRDVFAIYLTQVLVLATIGSLI
FT                   GLALGAALPFLIVGAFGTLLPLPVVAALHPGELILSLVYGLLTALAFGLWPLAQVRDVP
FT                   VATLFREAATADAHRPSLRHIVWIGAVIALLLAVVIGLAYDKRVAIAFVVAAVLVFLLL
FT                   RGVAAGLMAIARRLPRSRITMLRLAIANIHRPGALTPSVVLSLGLGLSVLVTIAQIDGN
FT                   LRRQFLAALPERAPTFFFIDIPSSETEQFGAFLKQAAPNATVEDVPMLRGRIVAARGVR
FT                   AEDLKPGQDAEWVLQSDRGLTYAAEMPPGSKVVEGHWWPKDYDGKPLVSFEKKLADGLG
FT                   LKIGDEVTVNVLGRELTATISNLRSVDWQSLGINFVLVFSPNTFRGAPHTHIATLTEHG
FT                   STTESDAALIKQVADRFPMVTSVRVREALETVGGVVGNLALAVRGASSVTLISAILVLG
FT                   GALAAGHRHRVYDAVILKTLGATRGRLIGAFALEYMMIGLATAVFGVIAGSAAAWLIVT
FT                   RLMSLSFAWQAGSAAGVVVAALVVTVGLGLVGTLLALNQKPASVLRNL"
FT   gene            325319..326110
FT                   /locus_tag="RPB_0287"
FT   CDS_pept        325319..326110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0287"
FT                   /product="Protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04998"
FT                   /db_xref="GOA:Q2J3G2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G2"
FT                   /protein_id="ABD04998.1"
FT                   /translation="MSDLDRNYASPFGRAAGRVDSAAVDAGLRSYMLRIYNYMTIGLAI
FT                   TGLAALGVYMGAVTPDAAGAAGKIGNTYLTTFGVAMFASPLKWVFILAPLAMVFAISFG
FT                   INRLKPATAQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKR
FT                   DMTGMGSFLIMGLFGVIIASVVNLFVASSMLQFIVSVVGVLVFAGLTAYDTQRLKNDYM
FT                   YGYASEGGDVAERAAITGALSLYLNFINLFTLLLQLLGQKE"
FT   gene            326291..326908
FT                   /locus_tag="RPB_0288"
FT   CDS_pept        326291..326908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0288"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABD04999"
FT                   /db_xref="GOA:Q2J3G1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G1"
FT                   /protein_id="ABD04999.1"
FT                   /translation="MDTRVKPAYDAGIGDQPRVEFRMSDLLIRPAAAADLPAITAIYAD
FT                   AVRTGTATFELTPPDLAEMTRRFETLAGGGFPYLVALLGDRVAGYAYAGPYRPRPAYRF
FT                   TVENSVYLDPLAHRRGLGTALLHELIAQCEARGFRQMIAVIGDSTNAGSVAVHRKSGFD
FT                   LIGVHRNVGFKFGRWLDTVMMQRALGAGGETVPEVGAGPSNA"
FT   gene            complement(327055..327423)
FT                   /locus_tag="RPB_0289"
FT   CDS_pept        complement(327055..327423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05000"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3G0"
FT                   /protein_id="ABD05000.1"
FT                   /translation="MSSISEEADPGDSRAAERQGAAPLQGRVTFNRLELNRILNLYGRM
FT                   VADGEWRDYAIDFLKDHAVFSVFRRASEVPIYRIVKDPRLARKQGAYSVVSASGQILRR
FT                   GHDLDRVLLVIDRKLALV"
FT   gene            complement(327784..328617)
FT                   /locus_tag="RPB_0290"
FT   CDS_pept        complement(327784..328617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0290"
FT                   /product="Protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05001"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F9"
FT                   /protein_id="ABD05001.1"
FT                   /translation="MGRLFVLRRSRTTVEAVVTCSHAKAMMIGVDGFSRWSGALGLCAL
FT                   IAMVRPSAADPRAVVELFTSQGCSSCPPADRIIGELARDPSIIALSMPIDYWDYLGWKD
FT                   TLADSRFSARQKAYSQMRGDRDVYTPQVIVNGQTHLVGSNRVGIDGAIKSTDQIPGTMT
FT                   VPVRMAVNGKEIKVSVAAAPPGERVAQGEVWICSVSKAVPIAIARGENRGREVVYHNVV
FT                   RNLLKVGDWNGAAGSWSVPLENIAHDGIDAAAVYVQDGNRDRPGAMLGAAFTSLH"
FT   gene            complement(328698..331460)
FT                   /locus_tag="RPB_0291"
FT   CDS_pept        complement(328698..331460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0291"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05002"
FT                   /db_xref="GOA:Q2J3F8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F8"
FT                   /protein_id="ABD05002.1"
FT                   /translation="MLARPSKTKIWDPPYMTSLDSFKCRKILKVGSKSYVYYSLPTAEK
FT                   NGLKGISRLPYSMKVLLENLLRNEDDRTVKKADIQAVAKWMRKKALEHEIAFRPARVLM
FT                   QDFTGVPAVVDLAAMRNAMQALGGDAEKINPLVPVDLVIDHSVIVNFFGDNKAFGKNVA
FT                   EEYKQNQERYEFLKWGQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTRKQKMTIGRKTG
FT                   TFEVAYPDSLVGTDSHTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPEVVGFKLSGA
FT                   LKEGVTATDLVLTVTQMLRKQGVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGF
FT                   FPVDAETLGYLKTSGRASARVALVEKYAKAQGLFRTSKSPDPVFTVTLKLDLADVVPSL
FT                   AGPKRPEGRVALPAVAEGFTAAMDAEYKKALDGARYKVDGRNFDLGHGDVVIAAITSCT
FT                   NTSNPSVLIGAGLLARNAAAKGLKAAPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFN
FT                   LVGFGCTTCIGNSGPLPEEISKSINDNGIVAAAVLSGNRNFEGRVSPDVQANYLASPPL
FT                   VVAYALAGTVTKNLSVDPIGTGKDGKPVYLKDIWPTTKEINAFVKKYVTSTIFKKKYAD
FT                   VFKGDTNWRKIKTVDSETYKWNMSSTYVQNPPYFEGMKMQPEPIVDVVDARILAVFGDK
FT                   ITTDHISPAGSIKLTSPAGKYLSEHQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNFM
FT                   LKGADGNIPEGGLTKHWPDGEQMSIYDAAMKYQAEQVPLVVFAGAEYGNGSSRDWAAKG
FT                   TRLLGVRAVICQSFERIHRSNLVGMGVLPLTFEDGTSWASLGIKGDETVTIKGLQGDLK
FT                   PRQMLEAEITPAGGKMRRVPLLCRIDTLDELEYYRNGGILHYVLRKLAA"
FT   gene            331635..332237
FT                   /locus_tag="RPB_0292"
FT   CDS_pept        331635..332237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0292"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05003"
FT                   /db_xref="GOA:Q2J3F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3F7"
FT                   /protein_id="ABD05003.1"
FT                   /translation="MRLSGRGLRCVRGGREVFDGLDFEAAGGEALALIGRNGAGKTSLL
FT                   RLIAGLLMPAAGSIDFDGSEPDTPVAEQAHYLGHRDALKPSLSVVENLAFWRDFLGGEP
FT                   TDLMAGITAVGLSHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVRGQA
FT                   MFARLMSDHLASGGLIVAATHSPLGITTREMRIGAAA"
FT   gene            332608..333276
FT                   /locus_tag="RPB_0293"
FT   CDS_pept        332608..333276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0293"
FT                   /product="heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05004"
FT                   /db_xref="GOA:Q2J3F6"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F6"
FT                   /protein_id="ABD05004.1"
FT                   /translation="MTALGAIIRRDVAIALRVGGGALIGVLFFLTVVVLMPFAVGPDLK
FT                   LLQRLGPAILWLGALLASLLTLDRLFTADAEDGSLDLIVMSRTPLELTCAAKAFAHWLA
FT                   AGLPLIVATPVLGLLLNLDGTASLAVMATLLAGTPALTFTGMIGAALAVALRRGGLLMA
FT                   VLVLPLSIPVLIFGVAASQAAITGPVPFGTPFSILCALSLASLVIGPLAAAASLRHGLD
FT                   "
FT   gene            complement(333696..333893)
FT                   /locus_tag="RPB_0294"
FT   CDS_pept        complement(333696..333893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0294"
FT                   /product="Protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05005"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3F5"
FT                   /protein_id="ABD05005.1"
FT                   /translation="MTTPPERPETSVDRKLLEILVCPVTKGPLEFDAARQELISRGAKL
FT                   AYPIRDGIPIMLPEEARKLG"
FT   gene            complement(333981..334655)
FT                   /locus_tag="RPB_0295"
FT   CDS_pept        complement(333981..334655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0295"
FT                   /product="Peptidase S16, lon-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05006"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F4"
FT                   /protein_id="ABD05006.1"
FT                   /translation="MPINADYRGPADLPEVIPVFPLPGALLLPRGQMPLNVFEPRYLEM
FT                   VDDALRDGHRLIGMIQPDVTHSERDEAPKLFQVGCVGRITQLAESGDGRYILELTGVSR
FT                   FKVVEELKVATPYRQCKVDYFPFVDDFTARKGEDEVDRDTLLTVLTDFLKANNLKVDWD
FT                   GVESAPNEALVNALAMMSPYGAPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTSGDPP
FT                   LQ"
FT   gene            complement(334683..335603)
FT                   /locus_tag="RPB_0296"
FT   CDS_pept        complement(334683..335603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0296"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05007"
FT                   /db_xref="GOA:Q2J3F3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F3"
FT                   /protein_id="ABD05007.1"
FT                   /translation="MTIIEQGSGAAPQAAPDLIKDTTTQTFVRDVIEESKLQPVLIDFW
FT                   APWCGPCRQLTPMLEKAVRAAGGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVDGRPA
FT                   DGFMGAVPESQVAAFIEKLTAGVPGGAPTAAELLQEAEAVMAEGDLQTAGAIYAEVLRA
FT                   DAANVEAIVGLARCYMVSGAVDEAKATLAQVPEARREDAAVKAVQAMIDLAAQAEQVGP
FT                   IAELEQKVAADPLDHQARFDLATALNAAGRRDEATTHLLEIVRRDRKWNEDGARKQLVQ
FT                   LFEAWGPTDDATIEGRKRLSTILFS"
FT   gene            336013..336087
FT                   /locus_tag="RPB_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            336013..336087
FT                   /locus_tag="RPB_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(336433..337215)
FT                   /locus_tag="RPB_0297"
FT   CDS_pept        complement(336433..337215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0297"
FT                   /product="Histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05008"
FT                   /db_xref="GOA:Q2J3F2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F2"
FT                   /protein_id="ABD05008.1"
FT                   /translation="MHFDLSNRNLAQKISILVLGITFVVALAIGGVSQLVLHKVTTDQA
FT                   KQQASVASLDRLIGHGGATLSPVRAADGSIVGMLVMQQDSGAVVMPASYEGQGLVVQAA
FT                   ETVTAPAANYAMSAANTMLLLAGIVVFAVVGLIGTRISRGLLAPLGELEKDVEKLASGE
FT                   TNIRIHALSRSDEIGRIARSIAKIQESLIELAKLKTQRVVGGANSILENLKEMWGDLRS
FT                   AARNAREMLFTDGKTISETLSRSWSEWVHNGLGVPKRA"
FT   gene            338107..338922
FT                   /locus_tag="RPB_0298"
FT   CDS_pept        338107..338922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0298"
FT                   /product="photosynthesis gene regulator, AppA/PpaA family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F1"
FT                   /protein_id="ABD05009.1"
FT                   /translation="MRAVHPESAVHPESIVSTVIPHLLVKHAAAPARLRAAKDPADARA
FT                   DELARLLIAPNLDDAFDLIDHSLTRAASPTALFTGLFESTARKLGDLWSEDACSEFEVA
FT                   IGLCHLQTAMRRISFDLLSAPLTRSQPRTVLVITQPGEPHSFCAALHSELLHQAGWNTV
FT                   GEFPDSEKALTDLVANGWFDAVNLSLSPSLRREHWLPRVAETIRKIRKASRNPALAVVA
FT                   SGRVFAERADACALVGADAATVSSVQIERCLMRSLLNRTARPAANFAWI"
FT   gene            339146..340231
FT                   /locus_tag="RPB_0299"
FT   CDS_pept        339146..340231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3F0"
FT                   /protein_id="ABD05010.1"
FT                   /translation="MQSEGKSYPFDHLPAIDYDAHPAYGRVMSMPMLGARLKAISYFSY
FT                   GFLLASAQRLIDIEHLPRPAEAGKTFVAVLRNLPTTLRQILLQRLARVTAGQAYAPKTE
FT                   RGTAVFVPLQGDGFAVTRLGADAIAQIRTQLAPQLTTLEQRATPAGDPASSRMAIDPAV
FT                   APDLYRWFNQTAADLGLTEAASAYLKRPVGVGAIVAEVVDAPAAPATSPFADVGVDTSP
FT                   CDGFKVDPGTNVLKLVIYLGDVGAGNGPLTYVAGSNRAATRFWDGLIRRANDLAGLSST
FT                   LQTWRETFYALPAGLQRKAAFGADLVADSNFAAAIEANQVAVTSRDGNAVLYDPAGIHR
FT                   DAALTQGRRTAVIVTFTELPR"
FT   gene            complement(340254..341549)
FT                   /locus_tag="RPB_0300"
FT   CDS_pept        complement(340254..341549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0300"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05011"
FT                   /db_xref="GOA:Q2J3E9"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E9"
FT                   /protein_id="ABD05011.1"
FT                   /translation="MTPDDIAGFYATRAELNPDDYIELDFDFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGIDEDFRPRFAAKVLELHAEARQGFSTAVECAVRGPVHACRVTIAHPHRNF
FT                   GPKIPNLLSAVCGEGVFFSPGIPLIRLQDIRFPDSYLAAFEGPRFGIAGLRERLQAFDR
FT                   PIFFGVIKPNIGLPAAPFAELGYQSWRGGLDIAKDDEMLADVDWCPLAERAALLGDACR
FT                   KAAAETGVPKIYLANITDEVDRLIELHDVAVANGAGALLINAMPVGLSAVRMLRRHATV
FT                   PLIAHFPFIAAFSRLATYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLECVRA
FT                   CLEPMGPIKPCLPVPGGSDSAATLERVYRKVGSVDFGFVPGRGVFGHPMGPAAGAASLR
FT                   QAWDAIAAGIPVGEHAASHPELAAALQAFGDR"
FT   gene            complement(341649..342131)
FT                   /locus_tag="RPB_0301"
FT   CDS_pept        complement(341649..342131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0301"
FT                   /product="Protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05012"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E8"
FT                   /protein_id="ABD05012.1"
FT                   /translation="MRVPHAGDLARLRTPDAAMNIVRHRIELATTAPIQIIDITEQVRG
FT                   FVAGSGLKDGLVTVSCLHTTARINVNEREEKLERDMLTFLKRVAPRDGDYLHNLAPIDG
FT                   RDNAHSHLIGLFMNSSETIPLAAGALVLGEWQSIFFIELDGPRERRGVELQIIGQG"
FT   gene            342344..344326
FT                   /locus_tag="RPB_0302"
FT   CDS_pept        342344..344326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0302"
FT                   /product="Acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05013"
FT                   /db_xref="GOA:Q2J3E7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E7"
FT                   /protein_id="ABD05013.1"
FT                   /translation="MRPTYRSDIDGLRAIAVLLVIAFHAFPHSVRGGFVGVDVFFVISG
FT                   FLITSIICQARRSGDFSFAVFYARRINRIFPALALVLITCAVAGWFLLFPVDYRDAGKA
FT                   IGFGAAFLSNLALLHGAGYFETSSELDPLLHLWSLGVEEQFYLLWPPVIVLAWRWPRGA
FT                   LIAALTILLASFAANIALTPVNPLAAFYLPVTRFWELMTGCVLALAANAGPGRDITSIA
FT                   ALGVVRRLFERHAAAIRAACAWLGLGLLAAGAALISNDRGFPGWWAVLPVLGAALLIFA
FT                   GPSPWVSRYLLGNRAMVYVGLISYPLYLWHWPLLAAIRIVRFGEEPPLLMKAITILVAF
FT                   ALAHLTWRFIEPPFRARPSRRKTAAAFAAVAIAGIAGAGIYAASGFPSRFGPDLQAILG
FT                   DLNAEATVAFRAGACFFEGSAQFQEQCDDATPADAPRVVLWGDSHAAQLYPGLREWQRA
FT                   DNSFRISQYTTAGCPPILGLPDPPSKVCAANNAMALERLRTLKPDTVIMVARQWHDYHG
FT                   PDRDPQAVDEMIRATLAEVRATGVRRIVVVGMFPNWRTPPRRILAGYYRARAAGVATAG
FT                   AIPERDRSRHLDSSRAEENEGLRRFFEAAGVAFVSPTSTYCDRDGCLLAVPRSNGTPVV
FT                   YDGSHLTAASSIFFVRETARQLFGR"
FT   gene            complement(344337..344939)
FT                   /locus_tag="RPB_0303"
FT   CDS_pept        complement(344337..344939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0303"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05014"
FT                   /db_xref="GOA:Q2J3E6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E6"
FT                   /protein_id="ABD05014.1"
FT                   /translation="MVQAAPHPTIDSPAPDVRMSPRDRLIESARVLFCRYGINSVGVDA
FT                   IIENAGTAKTTLYKLFGSKDGLVEAVLQREGQSWRTWFIDEIDGPGGSARERLARIGPA
FT                   LKGWFSRPDFYGCPFINAVGESDKADDRMRSLAIAHKTIVHDRLTALCTEAEIAEPAQV
FT                   AHTLGLVIDGAIVMALVTRDAGAADVAGRACAAILPA"
FT   gene            345208..345780
FT                   /locus_tag="RPB_0304"
FT   CDS_pept        345208..345780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05015"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E5"
FT                   /protein_id="ABD05015.1"
FT                   /translation="MTKAATAMTACLTPDSPVAMTGCLAPIDKAGLDELIAKGKADPTA
FT                   VKTLKCKTVAEGRFRHLNFVRTLPPYIVDEPPGLLGDDTAPNPSEASLAALGSCLAVGI
FT                   HANAVARGITVYTLEIELEGDLNITGVWGTGDLSEKPVGFTDVRAKVKFEADRPREELD
FT                   ALVAHARLWSPVANTFSRPVNLDVTMA"
FT   gene            345810..346940
FT                   /locus_tag="RPB_0305"
FT   CDS_pept        345810..346940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0305"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05016"
FT                   /db_xref="GOA:Q2J3E4"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E4"
FT                   /protein_id="ABD05016.1"
FT                   /translation="MLDVQSMNTGDAAALPGAEVVEAVRALSARELPSLVNRIDVDGYY
FT                   PEDLMRAFGRLGAYAHHLPGKSPSVDLMTSINAMAAAGEHCLSTSFCMWCQDALAWYIY
FT                   ASDNEHLRTGIGPQIASGAVLGGTALSNPMKSLFGIEPMRLKGRRVAGGYVVKGLLPYV
FT                   SNLGPDHYFGGIFEVEDGGTTRNVMAAIPCAAEGLSLADNAKFTALDGTRTFAVQMRDV
FT                   MVPDNWVIADPVDDYIKRIRAGFILLQAGMAFGLIRDCLRLIEQCKSPLGHVNKYLDVQ
FT                   AEPLAEGLAAMEAEVARLAATPFESDRDYWRAVIEARLAAGDASVAAAHAAMLHCGARG
FT                   YVAGATAQRRLREAYFVAIVTPATKQLRKMLADMAH"
FT   gene            347080..347961
FT                   /locus_tag="RPB_0306"
FT   CDS_pept        347080..347961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0306"
FT                   /product="Rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05017"
FT                   /db_xref="GOA:Q2J3E3"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E3"
FT                   /protein_id="ABD05017.1"
FT                   /translation="MTEKVLVTPAELSEMLASPTTVVIDTRNPEAYAAGHVPGAVNIHE
FT                   IFTYLATSTPEGVKEMSEKFAAAFGAAGLSGEETAVIYEQSMNTGFGQSCRGYVLLTYL
FT                   GYPKVKILHGGYAAWTAAGLPSTTDVPTPTPKTFAVDPEAASILVDLESMKAAVADQSK
FT                   VKLDTRDVDEWIGESSSPYGKDFCPRKGRIPGAVWIEWYRMMKPSAAGPMFKSSAEILA
FT                   ECASVGITPDTPVVLYCFKGARASNTLVALKEAGIKDVSLYFGSWNEWSRDPSLPIEEG
FT                   APYAAPSLMAAE"
FT   gene            348038..348919
FT                   /locus_tag="RPB_0307"
FT   CDS_pept        348038..348919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0307"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05018"
FT                   /db_xref="GOA:Q2J3E2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E2"
FT                   /protein_id="ABD05018.1"
FT                   /translation="MPAFQPKKAWPGAHIAIQGVSHRYRRASGNALSGIDLEIKPCEAV
FT                   ALVGRSGCGKSTLLHIIAGLVAPSMGEIRIDGARVEGASPRWVVMFQQPHLYPWMSVAQ
FT                   NVGLGLKFAGRPRAEIAARVGELLHLVELDGYAERNAQDLSGGQQQRVALARSLATCPE
FT                   VLLLDEPFSALDAVTRRALQRDVRRIAEEMKITLVIVTHDIPEAVTMADRAVIMRSDPG
FT                   RIAEIVPVAVDRSDADPERRAASIQAAQARLQAAFERATGPAAPDASLTPDSHNQETPR
FT                   TEPLKIVAAGHR"
FT   gene            348932..350176
FT                   /locus_tag="RPB_0308"
FT   CDS_pept        348932..350176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0308"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E1"
FT                   /protein_id="ABD05019.1"
FT                   /translation="MCINCGNDIVHADDDRFRFAINRRQTLDMLAAGGLAALGTMLGGF
FT                   GQSARAADDDVVRIGYLPITDATALLVAHGMGYFKDEGLEAERPTLIRGWSPLVESFAA
FT                   GKFNLVHLLKPIPVWMRYNNNFPVKIMAWAHTNGSGVVVGGESGIASFKDFGGKQVAVP
FT                   FWYSMHNIVLQYALRKSGIKPVIKGQGETLAADECNLQVMAPPDMPPALAAKKIDAYIV
FT                   AEPFNALGETKAGGRMLRFTGDIWKNHPCCVLCMNEEVTRKKPEWTQKVMNALVRAEIY
FT                   ASANKKEVAKLLSKDGEGYLPLPAPVIERAMTYYDDKTYGESGAITHPDWKLGRIDFQP
FT                   WPYPSATKLIVGAMNETVVSGDTTFLKKLDPEFVAKDLVDYHFVKQAMTKYPDWKTSPS
FT                   VNPDDPFARTEVLSL"
FT   gene            350173..351006
FT                   /locus_tag="RPB_0309"
FT   CDS_pept        350173..351006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0309"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05020"
FT                   /db_xref="GOA:Q2J3E0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3E0"
FT                   /protein_id="ABD05020.1"
FT                   /translation="MSLDLTIDDAPAPAAAARNAAFAGRLRSSGHIALGIAVLLGVWWI
FT                   GGFIVASDPRTANFADFAPQPTFERLWQMLISGEAAKMAWPSLGRIAGGLAWAIALGVP
FT                   LGILVGRFRGMREASSVPFQFLRMISPLAWMPIAVMAFASWNAAIVFLIGVAAIWPILF
FT                   STAHGFRRIDPAWFKVARNLGARPWHMLFTIIVPAIMQDSLAGIRLAVGVAWIVLVPAE
FT                   FLGVTSGLGYAINDARDTLEYDRLAATVVIIGLIGFALDFLCERAVKRASWAREE"
FT   gene            complement(351131..351207)
FT                   /pseudo
FT                   /locus_tag="RPB_R0005"
FT                   /note="tRNA-Pseudo1"
FT   tRNA            complement(351131..351207)
FT                   /pseudo
FT                   /locus_tag="RPB_R0005"
FT                   /product="tRNA-OTHER"
FT   gene            complement(351266..352390)
FT                   /locus_tag="RPB_0310"
FT   CDS_pept        complement(351266..352390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0310"
FT                   /product="alginate O-acetyltransferase AlgJ"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05021"
FT                   /db_xref="GOA:Q2J3D9"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D9"
FT                   /protein_id="ABD05021.1"
FT                   /translation="MRRASLTTRIYAGAMIGLVVLFSAVGLAASAFRQAAVGGENRMFA
FT                   QLPGWPRSLAEWESFPQRFDDYFNDHFGLRKLLLRLNTNINALMLGRLPSDRVILGRDD
FT                   WLFYAGEESLELYANKRPLSGAQLDDARDSLTRRVGRAKQLGAAYVLIIAPDKHSIYPE
FT                   HMPRFPTRRGGPSQLDQLLAVARPAGLPVVDPRPALLQGKADGLVYYKDDTHWTDWGAY
FT                   LGYRALMAALPLPEVPIVQLDRRQFSVPGEMKGGLADMANLPWVEQTRKVDPAASRCDV
FT                   TRTPFERLSPNLSIARTHCAGAKYKVIYIGDSFSDWIMPYLSQSFGEIVHIARSGFTPW
FT                   RDLQPTIDREAPDLIIEELVERHVSSIADARESE"
FT   sig_peptide     complement(352304..352390)
FT                   /locus_tag="RPB_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.462 at
FT                   residue 29"
FT   gene            complement(352393..353865)
FT                   /locus_tag="RPB_0311"
FT   CDS_pept        complement(352393..353865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0311"
FT                   /product="Membrane bound O-acyl transferase, MBOAT"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05022"
FT                   /db_xref="GOA:Q2J3D8"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D8"
FT                   /protein_id="ABD05022.1"
FT                   /translation="MLFSSPVFLFLFMPLLLLCYWSVPRSLRNAILLVASIVFYVWGER
FT                   FFFVVMLASIAANWLLGLALDALDAPRQRKAVVAGAVVLNIGLLAFFKYSEFLIANLND
FT                   LLAAIGVAPVTVVSPHLPLGISFFTFHALSYVIDVYRGVATAQRRPVDFALYIAFFPQL
FT                   IAGPIIRYHDIYRQLTRRTVMLELCASGIERFLAGFGKKMLLANPLGEVADKIFALPVA
FT                   ELSPGAAWLGVLCYTLQIYLDFSAYSDMAIGLARIFGFHFLENFNYPYLSRSIQEFWRR
FT                   WHISLSNWLRDYLYIPLGGSRVANWRIYFNLLVVFFICGLWHGANWTFVVWGMIHGCFL
FT                   ILERIGLARLLARLPRPLGHLYTLAVVSLAWVFFRSADVHQAMLYLQTMFGGGGGAPSL
FT                   DALRYVDPLVIGSLIVGSLASAGMFSRLTSDWRCRAGQREGVLHPPLGEVRLDADGGRV
FT                   LGLRLVVLLTVGLLACSQVAAGTYNPFIYFRF"
FT   gene            complement(354073..354148)
FT                   /locus_tag="RPB_R0006"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(354073..354148)
FT                   /locus_tag="RPB_R0006"
FT                   /product="tRNA-Thr"
FT   gene            complement(354342..356093)
FT                   /locus_tag="RPB_0312"
FT   CDS_pept        complement(354342..356093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0312"
FT                   /product="HemY-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05023"
FT                   /db_xref="GOA:Q2J3D7"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D7"
FT                   /protein_id="ABD05023.1"
FT                   /translation="MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNAWRAEMRLPVFI
FT                   LGLGGAIVAIGLVWAIIAALWRAPKRMKHGRAARRSGKANRAITQGLLAVGHGDAAAAR
FT                   SHATAARRHAPHDPLALLLQAQAAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQ
FT                   RANDPQAALAIAEEALRLQPNAAWASQAVLGFRCARADWTGALEILETNLSSGLVDKKA
FT                   FRRQRAVLLTARALDVEDSDQSLSRDSALEANKLAPTLVPAAVLAAKCLAETHQVRRAM
FT                   KVLETAWQAEPHPDLAEAYAHIKPGDPPATRLARIENLIGKKATDFESALALARAAIDA
FT                   GEFSKARLALQPYLDNPTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDPVWTADG
FT                   YISDHWRPVSPVSGRLDAFQWQVPLAALPAKKTVVIEDNPFHDALIASSAPEALPPAKA
FT                   DAAVMVTVEPVADDAIVTPKQPEATVIAVEPEPAADKPKEAKEQRKDSAKEPAKAAAQA
FT                   GPDTVIPMPSPPLFHRRPAAQATSPVIPIVRAPDDPGVDEEPAPEEFDERSTAPAAPAG
FT                   SWRGYRP"
FT   sig_peptide     complement(356028..356093)
FT                   /locus_tag="RPB_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(356101..357531)
FT                   /locus_tag="RPB_0313"
FT   CDS_pept        complement(356101..357531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05024"
FT                   /db_xref="GOA:Q2J3D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D6"
FT                   /protein_id="ABD05024.1"
FT                   /translation="MVENRPGHEDTQHGEDRRLPPAPDGAPDAHAEPITEVDVDAPIEA
FT                   PSHPAPDLTMEQLPASAAEEQEDERRLQAAIDAAPLPEPAADQPETRFAAASPEAAEEP
FT                   AARPSAAEPRRPGIAAAMLPPVLAVAIAAAVVVGAAKTGLLPDYFMTGASAPQGDAAAL
FT                   DALKARLASLEARPVAGPDSAATPAAAADPALAGRVEALEKTVASLSGELAALRTRAES
FT                   APAAAAAAAASTDGTATDRPAADKPAGDSSSVDAAAALAAINTRLTELEQAAKAAPEAK
FT                   AAPEAKPAPEAAPQAAPPPATADDVPLRRLVTATMLDLTVTQGAPYAAILKAAQPLAAD
FT                   PAALRPLAPFAETGVPGAAALGRELLALLPKLLPGGDPANTTSFIDRFQANAERLVRIQ
FT                   RSDVAAGVDRIAVVGRLTAAAQRGDLAEARRELKALAPADRAPVQSWIDRSEARDQAVA
FT                   ASQSFATAALAALSKPSP"
FT   gene            complement(357590..358387)
FT                   /locus_tag="RPB_0314"
FT   CDS_pept        complement(357590..358387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0314"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05025"
FT                   /db_xref="GOA:Q2J3D5"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D5"
FT                   /protein_id="ABD05025.1"
FT                   /translation="MPAAATAPVSLSQARTSGVALLVTRPQPDNDATAAALRAKGYDVL
FT                   LAPMLRFEPAPFPDDQDTDYTGVIVTSANALRAIADQPGFARLLKLPLFAVGKHTARAA
FT                   RDAGFKDVIVAEGDAARLRLKVADSVKGKKKAAGALLYLAGADLSRDLAGELREDGFHV
FT                   VMQTTYRMLPVQTLPATICDEFAANRIEAVLHYSRRSARAFIDATRASGIEISALAIPQ
FT                   CCLSDSVSDVVREAGATQVMVARTPDEKALFEALDRAVGAPAR"
FT   gene            358534..359601
FT                   /locus_tag="RPB_0315"
FT   CDS_pept        358534..359601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0315"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05026"
FT                   /db_xref="GOA:Q2J3D4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3D4"
FT                   /protein_id="ABD05026.1"
FT                   /translation="MLGIETTCDETAAAVVERRADGSGRILSNIVRSQTDEHAPFGGVV
FT                   PEIAARAHVDLLDGIVARAMREAGTGFPELSGVAAAAGPGLIGGVIVGLTTAKAIALVH
FT                   NTPLIAVNHLEAHALTPRLTDATEFPYCLFLASGGHTQIVAVRGVGDYVRLGTTVDDAI
FT                   GEAFDKIAKMLGLPYPGGPQVERAAASGDAVRFAFPRPMLGRPDANFSLSGLKTAVRNE
FT                   ASRLTPLEPQDINDLCAGFQAAVLDSMADRLTSGLRLFRERFGAPKALVAAGGVAANQA
FT                   IRRALREVAAKAQTTLIVPPPALCTDNGAMIAWAGAERLALGLTDSMDAAPRARWLLDA
FT                   NATAPGKFANTRAGF"
FT   gene            359862..360851
FT                   /locus_tag="RPB_0316"
FT   CDS_pept        359862..360851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0316"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05027"
FT                   /db_xref="GOA:Q2J3D3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3D3"
FT                   /protein_id="ABD05027.1"
FT                   /translation="MSSFDTIAVLGGGAWGTALALTAARAGRSVTLWEHDAGNAQHLIE
FT                   ARESRFLPGVRLDDSIKVTQDLAEAARAQALLLVVPAQVLRSVATSLQPLIAARTPLIA
FT                   CAKGIEHGTHRFMTEIIAECAPNAVPAILSGPSFAADVARGLPTAVTIAATDADVAQAL
FT                   AQAMNSGSFRPYHSTDVRGVELGGATKNVMAIAAGIVAGRQLGASALAAMTTRGFVELV
FT                   RFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGMALGRGESIDTAAHGKLAEGYY
FT                   TAPVLLEMAQAKGVEMPISTAVAAILDGRLGVDAAIEGLLTRPLKAEE"
FT   sig_peptide     359862..359924
FT                   /locus_tag="RPB_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.911) with cleavage site probability 0.509 at
FT                   residue 21"
FT   gene            360855..361268
FT                   /locus_tag="RPB_0317"
FT   CDS_pept        360855..361268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0317"
FT                   /product="Protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05028"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D2"
FT                   /protein_id="ABD05028.1"
FT                   /translation="MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMMAMKK
FT                   GDRAFFYHSNEGKEIVGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLAAVKEE
FT                   KKLSEMALLKYSRLSVQPVTADEWKLVCKMGGL"
FT   gene            361424..362119
FT                   /locus_tag="RPB_0318"
FT   CDS_pept        361424..362119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05029"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D1"
FT                   /protein_id="ABD05029.1"
FT                   /translation="MDISSAPLHHPSMSTAIADPLAFIRDNTRLRPVPLVPEISLHVAD
FT                   EALPLWSKTEEELGEAGLPPPFWAFAWAGGQALARYVLDHPDCVAGRDVIDFASGSGLV
FT                   AIAAMKAGARRVTAFDIDGFAREAIAVNAAANGVALAICGDDLLAAEHAAPAQTVLAGD
FT                   IFYQQDIAELAFAMLQRRSAGGAQVLIGDPGRTYLPKDRLSQLASYGVPVTRELEDAEI
FT                   KATGVWTLT"
FT   gene            362549..364507
FT                   /locus_tag="RPB_0319"
FT   CDS_pept        362549..364507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0319"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05030"
FT                   /db_xref="GOA:Q2J3D0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3D0"
FT                   /protein_id="ABD05030.1"
FT                   /translation="MSEKIYDVPSEWASRAFVDDAKYREMYARSVNDPNGFWADQAKRI
FT                   DWIKPPHKIENCSFAPGNVSIKWFEDGVLNVAHNCIDRHLATRGDQVAIIWEGDDPSQS
FT                   RHITYRELHDEVCKFANILRSRNVEKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFA
FT                   GFSPDSLAGRINDCQSKIVITADEGLRGGKKVPLKANVDAALKKCDGVDWVMVVKRTSA
FT                   AIEMDDVRDFWYHEAAEMVTTECPIEHMHAEDPLFILYTSGSTGQPKGVLHTSGGYLVF
FT                   ASMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFW
FT                   DVIDKHKVNIFYTAPTAIRALMQAGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVV
FT                   GDDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEILDPEGVVLEGECT
FT                   GNLCLARSWPGQMRTVYGDHERFEQTYFSAYKGKYFTGDGCRRDADGYYWITGRVDDVI
FT                   NVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGIEPSEELRKEL
FT                   VAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSTLGDTSTLADPAVV
FT                   DDLVEHRQNKHHKDKVG"
FT   gene            364866..365393
FT                   /locus_tag="RPB_0320"
FT   CDS_pept        364866..365393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0320"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05031"
FT                   /db_xref="GOA:Q2J3C9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C9"
FT                   /protein_id="ABD05031.1"
FT                   /translation="MSVGFRSAKMAVAGAVLAATSMLAAPGAEAGPSLVAFRGDYSPGT
FT                   IVVKTHERKLYLVVEPGQAVRYPVGVGKPGKSWQGVTKIDGKYRNPAWAPPADVKRDNP
FT                   AIPDVIAGGTPENPMGVAAMTLAGGEYAIHGTNRPNSIGGFVSYGCIRMLNDDITDLYQ
FT                   RVPVGTQVVVTR"
FT   sig_peptide     364866..364958
FT                   /locus_tag="RPB_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 31"
FT   gene            complement(365653..367608)
FT                   /locus_tag="RPB_0321"
FT   CDS_pept        complement(365653..367608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0321"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05032"
FT                   /db_xref="GOA:Q2J3C8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C8"
FT                   /protein_id="ABD05032.1"
FT                   /translation="MKRIQLALLASTAIVVWQSTTLPAHADATSVIATPMLMAQAAPTD
FT                   KGDEKKGPPAGERKGPPPGAAPGAAPPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAP
FT                   PPPPPPRAEPPAAPRAAPPPPPPAAATPPRPPSPPAEKSAPRAEPPAAPRVAPPPPPPP
FT                   AAAPQRQSAPPPAEKAAPPPPRPAPPAAGQIGAPPAGQTPPAAVQKGAPPPPAQPSAAP
FT                   PPAVQRERAAPPPAAAPDAGRIGAPPAVTQTPPPPPTTQQRDAPPPATAPAERGTVAPP
FT                   PPPPAAGTMGPQGAQPAAPGSLPAGAPVARTPPPTVTTPIPAAPPPPQALAPIAPGAVA
FT                   PGPRNMSDFRGERREVREGGRIVITEPGRIIVRDPGGREFIRHNEMDRFRYGARDIRTE
FT                   DVRGGGTRTVVVRPDGTEIINVIGGDGQLLRRIRRDRDGREIVIIDNSFGPRDRASFYV
FT                   DLPPPVLRIPRDRYIVDYEDASPELIYDTLEAPPVERIERRYSMDEIRYSPSVRQRMPS
FT                   IDLNTITFETGSWDIPPDQAAKLQVIADGLNRAIQRNPREVFLIEGHTDAVGNDTDNLS
FT                   LSDRRAESAATLLTQQFGVPAENLTSQGYGEQYLKVPTDGPERQNRRVTVRRITPLLNG
FT                   GQAALPPPPPGTAPPR"
FT   sig_peptide     complement(367528..367608)
FT                   /locus_tag="RPB_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            367630..367890
FT                   /locus_tag="RPB_0322"
FT   CDS_pept        367630..367890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C7"
FT                   /protein_id="ABD05033.1"
FT                   /translation="MPRAELSIGRSRPVDSINDDPWGRIVAFRPAAQLIISRCVVGERA
FT                   AIHRAFRRRIPRRPPRSVITPRDRDGIATRRSSSCDDAAVT"
FT   gene            complement(368140..368628)
FT                   /locus_tag="RPB_0323"
FT   CDS_pept        complement(368140..368628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0323"
FT                   /product="Pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05034"
FT                   /db_xref="GOA:Q2J3C6"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C6"
FT                   /protein_id="ABD05034.1"
FT                   /translation="MAVNTNQGDAQHAWDLMKTITFAMLATRDGEKIRSRPMAAYIRPD
FT                   EGLIYFLTDVRRHKDDEIAQDHHVNLGFADASAQKYVSVSGYAAISNDRGKIKELFGTA
FT                   AKAWWDSPDDPNIRILKVTPEEAEYWDSPGTLVSYVKMAVAAATGTRPDLGDNRKVAI"
FT   gene            complement(368777..369586)
FT                   /locus_tag="RPB_0324"
FT   CDS_pept        complement(368777..369586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0324"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05035"
FT                   /db_xref="GOA:Q2J3C5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C5"
FT                   /protein_id="ABD05035.1"
FT                   /translation="MTNRARGNEMVEFALPKNSKIVGGKAWPKPEGATEVREFRVYRWN
FT                   PDDGKNPSVDTYYVDKHDCGPMVLDGLIWIKNNIDPTLTFRRSCREGVCGSCAMNIDGE
FT                   NTLACTKAMDDVRGEAVKVNPLPHQPVVKDLVPDLTNFYAQYASIEPWLQTVTPTPQKE
FT                   WRQSHADREKLDGLYECILCACCSTSCPSYWWNSDRFLGPAALLQATRWVEDSRDEATG
FT                   ERLDNLEDPFRIYRCHTIMNCAKACPKGLNPSEAIASLKLKLVERQI"
FT   gene            complement(369667..371490)
FT                   /locus_tag="RPB_0325"
FT   CDS_pept        complement(369667..371490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0325"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05036"
FT                   /db_xref="GOA:Q2J3C4"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C4"
FT                   /protein_id="ABD05036.1"
FT                   /translation="MAANGNGAAAAGGHAYPIEDHVYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISASLGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEDGKIYQRPFGGMTLDFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHSAEFYIEFFAIDLIMDDQGVCRGVIALKLDDGTIHRFKAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLHER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFHGEVVTKKDGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLTPNGKQPELPADSADLSLGRL
FT                   DKYRYAKGGTPTAKLRESMQSVMQNNCAVFRTGEVLSEGKDLIRKVYGGVGDVGVSDRS
FT                   LVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGAHAREDFPDRDDTQWMKHTLAWIG
FT                   DDGGTTIDYRPVHDYTMTNDVQYIPPKPRVY"
FT   gene            complement(371494..371916)
FT                   /locus_tag="RPB_0326"
FT   CDS_pept        complement(371494..371916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0326"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05037"
FT                   /db_xref="GOA:Q2J3C3"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C3"
FT                   /protein_id="ABD05037.1"
FT                   /translation="MSVEESHGTARRRERTMRTPMGKVRKLGPAGSGTSDFWQQRITGV
FT                   AMTLLILPVIVVIMMLLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDY
FT                   IQNEKLKLVTVMANNFFSIAVALAAIFAIFKLASGV"
FT   gene            complement(371913..372311)
FT                   /locus_tag="RPB_0327"
FT   CDS_pept        complement(371913..372311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0327"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05038"
FT                   /db_xref="GOA:Q2J3C2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C2"
FT                   /protein_id="ABD05038.1"
FT                   /translation="MTARIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWW
FT                   LIACAAGPAAYANVQAFTGSWIGRLILFGYTWALMHHLLSGVRHFVWDLGYGFKTADRE
FT                   WLTWAALIGGIVLTVLLWVVAFTMGVAR"
FT   gene            372689..373678
FT                   /locus_tag="RPB_0328"
FT   CDS_pept        372689..373678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0328"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05039"
FT                   /db_xref="GOA:Q2J3C1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C1"
FT                   /protein_id="ABD05039.1"
FT                   /translation="MTHAHDLCHDDHAHPDDSGEIAGRDHAHAHGHGAHSHAPKDFGRA
FT                   FAIGIGLNIGFVIVEAVFGWLGNSMALLADAGHNLSDVLGLAVAWIAAELSKRPPSARF
FT                   TYGLRGSSILAALFNAVFLLLAVGAIGWEAMLRLFNPEPVAGVTMMVVAGVGIGINAAT
FT                   AWLFFSGRHDDLNIRGAYLHMIADAAVSAAVVVAGVVILFSGWTWIDPAVSLLVVGVIV
FT                   WGTWGLLRDSTAMSLGAVPRGIDPAAVRAFLASRPGVTQLHDLHIWPMSTTEVALTCHL
FT                   VIPSGSPGDAFLIEIAHALQHDFGIAHATVQIETDPETPCALAPDHVV"
FT   gene            complement(373834..375369)
FT                   /locus_tag="RPB_0329"
FT   CDS_pept        complement(373834..375369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0329"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05040"
FT                   /db_xref="GOA:Q2J3C0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3C0"
FT                   /protein_id="ABD05040.1"
FT                   /translation="MNAHGNTNMNANLFARLFDAPGDPDKRAIETADGGSISYGELVAR
FT                   AGRVANVLIARGVKIGDRVAAQTEKSVEALVLYLATVRAGAVYLPLNTAYTLHELDYFI
FT                   TDAEPSLVVCDPATRDGIAAIAAKVNAAVETLDAGGQGSLTDAAAQASSDFATVPREGS
FT                   DLAAILYTSGTTGRSKGAMLSHDNLASNSLTLVDYWRFSPDDVLIHALPIYHTHGLFVA
FT                   SNVTLFARASMIFLPKLDPERIIDLMPRATVLMGVPTFYTRLLQSPRLTKDATSHMRLF
FT                   ISGSAPLLAETHREWSARTGHAVLERYGMTETNMNTSNPYDGERVPGAVGFPLPGVSVR
FT                   VTDPDAGRELPRGEIGMIEVKGPNVFKGYWRMPEKTAAEFRPDGFFITGDLGKIDERGY
FT                   VHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGLPHADFGEGVTAVVVRSSQ
FT                   SSLDEAEVLKSLDGQIAKFKMPKKVIIVDELPRNTMGKVQKNVLRSTYKDIYK"
FT   gene            375435..376184
FT                   /locus_tag="RPB_0330"
FT   CDS_pept        375435..376184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0330"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05041"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B9"
FT                   /protein_id="ABD05041.1"
FT                   /translation="MNRNGNRVAWVTGGGSGIGEAGAEALAADGFTVVVSGRRAEALDQ
FT                   VVAKIKARGGTAAAIALDVSDSGAVIAAADRIVATHGRIDCLVNSAGLNVPKRSWADME
FT                   LDGWNKLVEINLDGVLYCMRAVLPTMRAQRDGCIINVSSWAGRHVSKMPGPAYTATKHA
FT                   VLALTHSFNMDECVNGLRACCLMPAEVATPILKLRPVVPSAEDQARMLQPDDLGRTIAF
FT                   VATMPPHVCVNEILISPTWNRSFVGGL"
FT   gene            376744..377325
FT                   /locus_tag="RPB_0331"
FT   CDS_pept        376744..377325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0331"
FT                   /product="Beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05042"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B8"
FT                   /protein_id="ABD05042.1"
FT                   /translation="MSKRIAYLSAAALSALALTATVTVPAQAESKKMMKSEMSGDTVMV
FT                   GGAPMYPSKNIVENAVNSKDHTTLVAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPAG
FT                   TVDTLVKPENKQQLTKILTYHVVPGKLVAADLTDGKKLTTVEGEVLTVKRAGDSVMLVD
FT                   SKGGSSTVTIPNVNQSNGVIHVVDTVLMPS"
FT   sig_peptide     376744..376830
FT                   /locus_tag="RPB_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            377547..378179
FT                   /locus_tag="RPB_0332"
FT   CDS_pept        377547..378179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05043"
FT                   /db_xref="GOA:Q2J3B7"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B7"
FT                   /protein_id="ABD05043.1"
FT                   /translation="MSSTTLSENDAAAGAARQVIQPAWVRVVHWINAAAMIVMILSGWQ
FT                   IYNASPLFDFQFSRAITLGGWLGGGLLWHFAAMWVLMLNGLVYLAVGFATGRFRRKLWP
FT                   ITPSGVVTDLARAATFRLSHADLTTYNYVQKLLYAGIILVGILAVLSGLSIWKPVQFQT
FT                   LTALFGGYDTARYVHFFAMAAIVGFLVIHVVLAVLVPKSLRAMILGR"
FT   gene            378183..378962
FT                   /locus_tag="RPB_0333"
FT   CDS_pept        378183..378962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0333"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05044"
FT                   /db_xref="GOA:Q2J3B6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B6"
FT                   /protein_id="ABD05044.1"
FT                   /translation="MLRIKSLLIPGVDKTLLVKDAARLMPDLTRRRFLSGGASLGALTL
FT                   LTGCDVIDGASAENLLAKVSKFNDAVQAAIFDPNTLAPTYSEKDITRPFPFNAYYSLDE
FT                   APEIDGKDWALEVSGLVDSKKSWTLAELTQLPEVGQITRHICVEGWSAIGSWSGVRLSD
FT                   FLKLVGADTNAKYVWFRCADDYTSPIDMPTALHPQTQMTLKYDGQILPRAYGYPMKIRI
FT                   PTKLGFKNPKYVVAMEVTNDYKGGYWEDQGYNSFSGL"
FT   gene            complement(379097..380284)
FT                   /locus_tag="RPB_0334"
FT   CDS_pept        complement(379097..380284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05045"
FT                   /db_xref="GOA:Q2J3B5"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B5"
FT                   /protein_id="ABD05045.1"
FT                   /translation="MTLLDRPDAPPAHPARLILILSLAPTVGLGIGRFAYSLLLPDMRD
FT                   SLQWSYSAAGFMNTVNAAGYLAGALATSQLVRRYGLAAIVRAGTLACVASLALCALSGS
FT                   FVALSAARLIAGIGAALAFVAGGALATTIAQSQPARSAFLLSLFYAGPGIGILSSGLIT
FT                   PFLLEAAGPGSWWIGWLVMAVLSAAMTLPLLLAPLASAANLGGGAARFTIRPVWIYLAG
FT                   YFMFGAGYIAYMTFMIAYVRDAGGGAAAQSAFWCLIGASAFVTPWVWRRIMAMDRGGMS
FT                   TTIILGVNAVGAVLPLFGLSPLMLAISALVFGVSFFAVVASTTAFVRFNYSQAQWPGAI
FT                   AAMTIAFGIGQTLGPLLVGAITDAIGSLSSALAVSAATLALGAVLSAFQRPLRRA"
FT   gene            380508..381620
FT                   /locus_tag="RPB_0335"
FT   CDS_pept        380508..381620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0335"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05046"
FT                   /db_xref="GOA:Q2J3B4"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3B4"
FT                   /protein_id="ABD05046.1"
FT                   /translation="MATHKLLLLPGDGIGTEVMAEVSRLIDWLNKAGIASFETEHGLVG
FT                   GAAYDADKVAITDATMALAQASDAVIFGAVGGPKWDAVPYDARPEAGLLRLRKDLALFA
FT                   NLRPAVCYPALAEASSLKPEVVEGLDIMIVRELTGGVYFGEPKTITDLGNGQKRAIDTQ
FT                   VYDTYEIERIGRVAFDLARKRRNKVTSMEKRNVMKTGVLWNEVITQVHAREYKDVQLEH
FT                   QLADSGGMNLVKWPKQFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGAVDDTTGKR
FT                   KAMYEPVHGSAPDIAGKGLANPVAMLASFGMALRYSLDMGELADKLDEAIAVVLARGLR
FT                   TADIKSEGSTVVSTSQMGEAIVQEMQALHG"
FT   gene            complement(381907..382299)
FT                   /locus_tag="RPB_0336"
FT   CDS_pept        complement(381907..382299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B3"
FT                   /protein_id="ABD05047.1"
FT                   /translation="MTLKFPAAQTCAKTFAVLLATVAVVAIGVESADAQQTSKKRVYRS
FT                   SDQIRYGDRGPNSSYQAGPRTRVYVTKRSWLDAGTEVLPGDRKFSDYAFPPGYSFAREN
FT                   GQRPLDRQPLNPASDLGGYPERFPLY"
FT   sig_peptide     complement(382195..382299)
FT                   /locus_tag="RPB_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.694 at
FT                   residue 35"
FT   gene            complement(382463..383266)
FT                   /locus_tag="RPB_0337"
FT   CDS_pept        complement(382463..383266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05048"
FT                   /db_xref="GOA:Q2J3B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B2"
FT                   /protein_id="ABD05048.1"
FT                   /translation="MGSNPAFRAAPPQSRIHPALRSFADECRETVMRILAYVGALALIG
FT                   LIIFTAANPLTDAAITAATTPGDRPGWSMATHSHPAFAVSQIDLPGAVASTEILRHPDG
FT                   GRKDVLRWAAPGQAPAVEIELYRLGDEAHGVPDAAADLAARIGAERAESAQPAGLIDSK
FT                   FGPVTLFDLAGPSTRCLGFFRRIDDAALRISGWTCQGDSLPQRRAAAACMLDRLVLLTA
FT                   GGDAALADTFAHAELRRQGCTPAPGQAARADWVFGAQNPRLRGAF"
FT   gene            383425..384459
FT                   /locus_tag="RPB_0338"
FT   CDS_pept        383425..384459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0338"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05049"
FT                   /db_xref="GOA:Q2J3B1"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B1"
FT                   /protein_id="ABD05049.1"
FT                   /translation="MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEV
FT                   SYGDRTLKCKALEHYDFSDIDICLMSAGGAVSKEWSPKIGAQGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALKPLHDKAKITRVVVSTYQSVSGAG
FT                   KEGMDELFSQTKAVYTNQELINKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKI
FT                   LDPAIKLSATCVRVPVFVGHSEAVNIEFENPISADEARDILRSAPGCLVIDKQEPGGYV
FT                   TPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAK
FT                   KKAA"
FT   gene            384717..385280
FT                   /locus_tag="RPB_0339"
FT   CDS_pept        384717..385280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0339"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05050"
FT                   /db_xref="GOA:Q2J3B0"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3B0"
FT                   /protein_id="ABD05050.1"
FT                   /translation="MTDQPDPPKPLSSTKRIERGFETVLFNSRWLMAPFYFGLVLSLLV
FT                   LLYKFVVLLGELILHATLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPR
FT                   DHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNLDTGYDSTKLGWLIGIHLVF
FT                   VVSTLVMALSDRWGGHGGDDKGGH"
FT   gene            complement(385455..386099)
FT                   /locus_tag="RPB_0340"
FT   CDS_pept        complement(385455..386099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0340"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05051"
FT                   /db_xref="GOA:Q2J3A9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A9"
FT                   /protein_id="ABD05051.1"
FT                   /translation="MTSFPKALVEGYEAFRTQRLPTEQTRYRELSERGQSPEVMVIGCC
FT                   DSRVSPEVIFDAGPGEMFVVRNVANLVPVYEPDGGAHGVSAALEFAVQVLKVKHIVVLG
FT                   HAQCGGIKAFTDKTPPLTESDFIGRWMAMFTKPGEVVEQRDHETMQEFRTRIEKAAVHR
FT                   SLENLMTFPCIQIQVARGKIQLHGAYFGVAAGDLFVLDPDSKDFRPAVPRG"
FT   gene            386284..387162
FT                   /locus_tag="RPB_0341"
FT   CDS_pept        386284..387162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0341"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05052"
FT                   /db_xref="GOA:Q2J3A8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A8"
FT                   /protein_id="ABD05052.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKARLLPADGLILDLEDAVAPDAKAA
FT                   ARDQIATAVAAKGYGHREVLVRINALDSPWWRDDIAMAAKVGPDGILVPKVSSIEDIAA
FT                   IAERLTELDADPAIRVWIMIETARGVLHAEELAAQTHIAGTRLAGFVFGPNDISRETGI
FT                   RMLPGRATMIPMISHCILAARAHGLVVLDGPYSDIANVDGFAQECAQARDLGFDGKTLI
FT                   HPGQIDACNATFTPPAEDVAQARAILAAFERPENAGRGAIQLDGRMVERLHAEIAKKTI
FT                   AIADAIERAGR"
FT   sig_peptide     386284..386340
FT                   /locus_tag="RPB_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.658) with cleavage site probability 0.649 at
FT                   residue 19"
FT   gene            complement(387447..388052)
FT                   /locus_tag="RPB_0342"
FT   CDS_pept        complement(387447..388052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0342"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05053"
FT                   /db_xref="GOA:Q2J3A7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3A7"
FT                   /protein_id="ABD05053.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYQDDGSENPDFILNKPAYRSAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVSQDDLDKLFDDAERGSNATVTIDLPAQEIRGPDGGTVKFEID
FT                   PFRKHCLINGLDDIGLTLEKKASIDSYEDKLKTERAWA"
FT   gene            complement(388283..388684)
FT                   /locus_tag="RPB_0343"
FT   CDS_pept        complement(388283..388684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0343"
FT                   /product="Protein of unknown function DUF1025"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05054"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A6"
FT                   /protein_id="ABD05054.1"
FT                   /translation="MWITAKAPSLAEFEEMAHEMFGKLPREFRALCEGVIIRVDDFPTD
FT                   EVLDELGAQTEYDLLGLFQGIGLPQRSSQDIAPMPNMIWLYRRPILDYWAENDETLGHI
FT                   VSHVLIHEIGHHFGLSDDDMEEIEAQVAD"
FT   gene            388800..389132
FT                   /locus_tag="RPB_0344"
FT   CDS_pept        388800..389132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A5"
FT                   /protein_id="ABD05055.1"
FT                   /translation="MIRRMTNTAGLAAAALAAALLLQAAEPAQAQTSRPQASAAAAPLT
FT                   DMSAQERRPPRRLRIYPRVAPGDDVYPRYFPGRNAVRECTATYVQEYRPSGTVITPRMN
FT                   CYWRRG"
FT   sig_peptide     388800..388874
FT                   /locus_tag="RPB_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            389401..389679
FT                   /locus_tag="RPB_0345"
FT   CDS_pept        389401..389679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A4"
FT                   /protein_id="ABD05056.1"
FT                   /translation="MKILKLSGLAAIAGLLLIAAPADRAQAAPMSSAGLATTVQRDVIP
FT                   EASEVQYRHHRGYRHHPRYRHHRAYRRHMHRPHRHYGPRHHYRRHWR"
FT   sig_peptide     389401..389478
FT                   /locus_tag="RPB_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.687 at
FT                   residue 26"
FT   gene            389816..390163
FT                   /locus_tag="RPB_0346"
FT   CDS_pept        389816..390163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A3"
FT                   /protein_id="ABD05057.1"
FT                   /translation="MRCWIAATIVAAVLGAMPEVVMPAVAAQPSTVSAPRAAQAGEARA
FT                   MAATEFSARHRGRAHAHRQARRFAHRHPRRGAHQRYVAPRYDGRPSYYRPYDMAPFFPF
FT                   GFGGYGLQPSW"
FT   sig_peptide     389816..389896
FT                   /locus_tag="RPB_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.788 at
FT                   residue 27"
FT   gene            390310..390975
FT                   /locus_tag="RPB_0347"
FT   CDS_pept        390310..390975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0347"
FT                   /product="Glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J3A2"
FT                   /protein_id="ABD05058.1"
FT                   /translation="MIAPARILTPRRSDRTTLLSRIGSIAVATVAALAVSIAAAPRAQA
FT                   LSPASPATATTSKVATETPIPVVGQIGGGGHRGGGGFHGGGGFRGGGVHHGGGFRGGGF
FT                   RPAFHGGGYRGGGHIGRGPIVHQRQFYGGPRFVGPRHFGPRHYGYRPHYGVRRHYVRPR
FT                   VYGYYGPRYYAPVYYGPRYYAPRRFCRIVYTYYGPRRVCKLRPWRHHHRHHRAWRVYW"
FT   sig_peptide     390310..390447
FT                   /locus_tag="RPB_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.774 at
FT                   residue 46"
FT   gene            complement(391132..392544)
FT                   /locus_tag="RPB_0348"
FT   CDS_pept        complement(391132..392544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0348"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05059"
FT                   /db_xref="GOA:Q2J3A1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3A1"
FT                   /protein_id="ABD05059.1"
FT                   /translation="MSAAKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAF
FT                   EGLRTAGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESAEQIAALAENARDFGVTYYNE
FT                   FDKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLI
FT                   QKKAKNMRVTVDGDLPDGVTAKDIILAIIGEIGTAGGTGYVLEYAGDAIRALSMEGRMT
FT                   VCNMSIEGGARAGLIAPDEKAYAYLKGRPMAPTGAHWDAAMRYWDTLRSDEGAHFDHEL
FT                   RLDAAALPPIVTWGTSPEDVISVTGKVPNPADIADEAKRLSKERALAYMGLTPGTKITD
FT                   IKIDRMFIGSCTNGRIEDLRAAAKVAEGKTVNANVNAIIVPGSGLVKEQAEAEGLDKIF
FT                   VKAGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAA
FT                   IAGHFVDIRDWR"
FT   gene            complement(392860..393255)
FT                   /locus_tag="RPB_0349"
FT   CDS_pept        complement(392860..393255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0349"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05060"
FT                   /db_xref="GOA:Q2J3A0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J3A0"
FT                   /protein_id="ABD05060.1"
FT                   /translation="MNLIQTLEKEQFDKLSAGKTIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKKQDRPAKVAAGAAE"
FT   gene            complement(393368..394126)
FT                   /locus_tag="RPB_0350"
FT   CDS_pept        complement(393368..394126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0350"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05061"
FT                   /db_xref="GOA:Q2J399"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J399"
FT                   /protein_id="ABD05061.1"
FT                   /translation="MTWRATVLTLFPEMFPGPLGVSLAGRGLAAGLWALEARDIRDSAT
FT                   DRHRSVDDTPAGGGPGMVLRADVLAAAIDAADPVPGRPRLVMSPRGRPLTQARVAELAA
FT                   GPGPLIVCGRFEGIDQRVIDARNLEEVSIGDYVLSGGEIAALALIDACVRLLPGVMGKL
FT                   DSSAEESFSAGLLEYPQYTRPKSFEGRPIPEILTSGDHAKVAAWRQAEAEALTRARRPD
FT                   LWAARSVARPAANAPAKGESQKTPKNKTDG"
FT   gene            complement(394275..394823)
FT                   /locus_tag="RPB_0351"
FT   CDS_pept        complement(394275..394823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0351"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05062"
FT                   /db_xref="GOA:Q2J398"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J398"
FT                   /protein_id="ABD05062.1"
FT                   /translation="MPSGPISVARQVCVARIGAPHGVRGAMRLWSFTADPLAVGDYGPL
FT                   STKDGTRSFEIATARAAKDHLVVTLKGVTTRDEAVRLNGLELYVPRDALPPTEDDEYYH
FT                   ADLIGLPAITTSGEPLGRVLAIHNFGAGDIIEIAPASGPTLLLPFTNAVVPTVDLAAGQ
FT                   VIIELPAEIEGDTPNHPEA"
FT   gene            complement(394830..395162)
FT                   /locus_tag="RPB_0352"
FT   CDS_pept        complement(394830..395162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0352"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05063"
FT                   /db_xref="GOA:Q2J397"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J397"
FT                   /protein_id="ABD05063.1"
FT                   /translation="MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMA
FT                   KDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDITGVKKREARNNPEKAVPRKERKAAA
FT                   EAAAKK"
FT   gene            complement(395757..397301)
FT                   /locus_tag="RPB_0353"
FT   CDS_pept        complement(395757..397301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0353"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05064"
FT                   /db_xref="GOA:Q2J396"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J396"
FT                   /protein_id="ABD05064.1"
FT                   /translation="MFDNLSEKLGGILDRLTGRGSLSEADVDAAMREIRRALLEADVAL
FT                   EVVRSFTDKVREQAVGATVVKSVKPGQMVVKIVNDELIAMLGSDSQAIDLNAVAPVPIM
FT                   MVGLQGSGKTTTTAKLARRMTSRDKRKVLMASLDVYRPAAMEQLAVLGRDLSIDTLPIV
FT                   AGQKPPDIARRAMEAGRLGGYDVVLLDTAGRTTLDEDMMTEAAEIKAAANPHEVLLVAD
FT                   SLTGQDAVNLARAFDERVGLTGIVLTRIDGDGRGGAALSMRAVTGKPIKLMGTGEKTDA
FT                   LEDFHPSRIAGRILGMGDVVSLVEKAASTLDAEKAAAAVEKMRKGKFDLADMREQLEQM
FT                   TKMGGIGGLMGMMPGISKMKNQIAAAGVDDKILKRQVAIIDSMTREERKNPDILKASRK
FT                   KRIAAGAGIKVEDVNKLLKMHRNMADMMKAVGRGKGGPMAGLAQAMGFGGGLPSAEQIK
FT                   AMQDKMQSGEMPGGLPELPKDLPPSLRGGLPNLPGLTGLSGKPTLPGLGGLFGKKK"
FT   gene            397568..397813
FT                   /locus_tag="RPB_0354"
FT   CDS_pept        397568..397813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0354"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05065"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J395"
FT                   /protein_id="ABD05065.1"
FT                   /translation="MKHVSLADARANIAELLDEVERGETVTISRDGAKSFDIAPPFDES
FT                   RREEARRAIEEIRELRKTAPRATVEEILSWRDEGRS"
FT   gene            397815..398216
FT                   /locus_tag="RPB_0355"
FT   CDS_pept        397815..398216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0355"
FT                   /product="PilT protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05066"
FT                   /db_xref="GOA:Q2J394"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J394"
FT                   /protein_id="ABD05066.1"
FT                   /translation="MRFVVDASVAVSWCMQDEASAIADRAFDLSRIATAIVPAHWWFET
FT                   RNALLVAVRRKRLELPRLESFLLQLNLVAIEIAPIPDDRSLITLAQRHRLTFYDAAYLE
FT                   LAQRERIELATLDKALARAAKSEDVALIA"
FT   gene            398221..399282
FT                   /locus_tag="RPB_0356"
FT   CDS_pept        398221..399282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0356"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05067"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J393"
FT                   /protein_id="ABD05067.1"
FT                   /translation="MNPISRRTLLASLAALAATAGLSSFWVSRMTSYKGPITDHFDGER
FT                   FFDRDGAAPKGWLDVLRWRFTTKPAKWPDWAPSPFADTPPPRVEGARARLSFVGHASWL
FT                   IQTGGLNILVDPVWSERVSPVSFAGPKRHNDPGIAFDKLPKIDIVLVSHGHYDHLDLAT
FT                   LSRLAAQHAPRVITPLGNDLTMASHDSAIRAEAYDWRDRVELGPGVAVTLVPTRHWTAR
FT                   GPFDRNRALWASFVLETPAGRIYVVCDSGYGDGRHFRNVREAHAPLRLAILPIGAYAPR
FT                   WFMKDQHMNPADAVMALADCGARQALANHHGTFQLTDEAIDAPELELYAALDAAAVPRE
FT                   RFPVLKPGQVFEI"
FT   sig_peptide     398221..398325
FT                   /locus_tag="RPB_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.294 at
FT                   residue 35"
FT   gene            complement(399482..400195)
FT                   /locus_tag="RPB_0357"
FT   CDS_pept        complement(399482..400195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0357"
FT                   /product="Protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05068"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J392"
FT                   /protein_id="ABD05068.1"
FT                   /translation="MTMPFRSVIAAALVVSALVVAAPASAQSAPPSPPSITVTGEAQKS
FT                   VAPDIAQIEAGVSNMAKTARAAAEANNVAMGKVLLELKNAGVDGKDTQTSRLSIQPQYA
FT                   SNRSGPSEINGYLASNLVTVKVRDIARVAGLVDTLVTAGANEIRGIGFRVADPSKLLDD
FT                   VRAEAIADARRKAEVYARAAGVTLGAPLLISEDTQQGIAPMRKMVAMQSAATPVAPGEE
FT                   TLSVSVTVSWAIKAP"
FT   sig_peptide     complement(400115..400195)
FT                   /locus_tag="RPB_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.803 at
FT                   residue 27"
FT   gene            complement(400192..400923)
FT                   /locus_tag="RPB_0358"
FT   CDS_pept        complement(400192..400923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0358"
FT                   /product="transcription activator, effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05069"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J391"
FT                   /protein_id="ABD05069.1"
FT                   /translation="MNRPRLFHASLRGLASAAALMLVTAAASAQTETKPADPAPPPAAT
FT                   TPAPEAAPAPATPAPAPAPPATETPAPPPPAAEAPAVPPVSKVQSADPFGEEITLEPKT
FT                   AVILKGKANWDNAFESLIEAFKSVTALLAKQGIKSNGNPMIVYTSTDDNGFTFQAEIPV
FT                   PEAPKNLPQTMSMGTTPDGKALKFVHRGSYDNMDNTYEAITNHLDEKKLEAKDTFVEEY
FT                   TTDPLTTAEDKLVINVYVPMK"
FT   sig_peptide     complement(400834..400923)
FT                   /locus_tag="RPB_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.886 at
FT                   residue 30"
FT   gene            401137..402018
FT                   /locus_tag="RPB_0359"
FT   CDS_pept        401137..402018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0359"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05070"
FT                   /db_xref="GOA:Q2J390"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J390"
FT                   /protein_id="ABD05070.1"
FT                   /translation="MSALDNRLFAKMNGIGNEIVVVDLRDQPAPVTPDDARAVAAHVPY
FT                   DQLMLLQPARLPGTEAFVRIYNNDGSESGACGNGMRCVARQLFAGSDQQGLTFETRAGL
FT                   LNCWRGPAEGLFTVDMGAPKFGWQDIPLAEEFRDTRGIELQIGPIDAPILHTPSVVSMG
FT                   NPHAIFWVDDIHAYDLGQFGPLLENHPIFPERANITLAHIVDRQHITMRTWERGAGLTR
FT                   ACGSAACATAVAAARLRRTDRIVEMTLPGGKLTIEWREGDDHVLMTGGAELEFEGRFDP
FT                   ALFVGACDTTAA"
FT   gene            402018..403286
FT                   /locus_tag="RPB_0360"
FT   CDS_pept        402018..403286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0360"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05071"
FT                   /db_xref="GOA:Q2J389"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J389"
FT                   /protein_id="ABD05071.1"
FT                   /translation="MPVEIVTFGCRLNAFESEVIRREAEGAGLTETIVVNSCAVTNEAV
FT                   AQARQSIRKLKRARPDARIVVTGCAAQTEPATFAAMDEVDRVIGNDDKIRTEAWREARA
FT                   AFDADAFGLGNEEKIAVADIMAVREMAPHLVDGYQSGLPRVFVQVQNGCDHRCTFCIIP
FT                   YGRGNSRSVPVGAVVDQVRALAERGHAEIVLTGVDLTSYGADLPGTPKLGTLVKKVLRH
FT                   VPELRRLRISSIDSIEADRDLLDALASEERLMPHLHLSLQAGDDLILKRMKRRHARQDA
FT                   IDFCDEVRRLRPDIALGADLIAGFPTETDAMFQRSLDLVAECGLTFLHVFPYSKRPGTP
FT                   AARMPQLDGRVVRQRAAQLRAAGEAALQKRLAAEIGATRAVLIESAAQGRTEHFIPVAI
FT                   AGVAPGDVRTMAIRGHDGVRLIV"
FT   gene            complement(403466..404368)
FT                   /locus_tag="RPB_0361"
FT   CDS_pept        complement(403466..404368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0361"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05072"
FT                   /db_xref="GOA:Q2J388"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J388"
FT                   /protein_id="ABD05072.1"
FT                   /translation="MNESHTDQFDVPELSAEDIQSRVLHRDGLMLVIDKPPGLPVHRGP
FT                   KGGPNLETSFEFLRFGLPRPPVLAHRLDRDTSGCLVLGRHRKATATLGLLFKHSKISKT
FT                   YWAIVEGGPLEDQGTIDLPIGRLNAERGWWQKIDPEGLPSLTKWTVLGRSFSPPPCGAG
FT                   ACPGLDPGAGVDNGSLASGHPHPNPLPQAGEGARSAGGAAAASSPAQAEDPPPLTWLAL
FT                   EPITGRTHQLRVHCAAMGWPIFGDNIYGNGPRFGEPKLHLHAREITIPLSRNKPPVVVT
FT                   APPPPHMHPRLAACGWTGV"
FT   gene            404397..405344
FT                   /locus_tag="RPB_0362"
FT   CDS_pept        404397..405344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0362"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05073"
FT                   /db_xref="GOA:Q2J387"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J387"
FT                   /protein_id="ABD05073.1"
FT                   /translation="MSDTPENAKPSWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAML
FT                   DEIEDVLLRADLGTEVATRISDAVGEGRYDKMISAGDVKEIVAAEVEKVLAPVAKPLVI
FT                   DRAKKPFVVLVVGVNGSGKTTTIGKLSARYAAEGHKVMMAAGDTFRAAAIEQLKVWGER
FT                   TGTPVIAGAQGSDSASLAFNALTTAKEQARDVLLIDTAGRLQNRTELMNELGKVVRVIK
FT                   KVDDTAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLAPFTARDFAQAIAGTETT"
FT   gene            405341..405958
FT                   /locus_tag="RPB_0363"
FT   CDS_pept        405341..405958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0363"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05074"
FT                   /db_xref="GOA:Q2J386"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J386"
FT                   /protein_id="ABD05074.1"
FT                   /translation="MTNETLPNNQPHPLFKLATELGPLLVFFVVNAKWHLFAATGAFMV
FT                   AVIAAIIASYVVTKHVPLMAIVTAVVVLVFGTLTLVLHDETFIKMKPTIVYALFGAVLG
FT                   GGLLFGRSFIAIMFDQVFNLTPEGWRKLTLRWALFFLAMAVLNEAVWRTQSTDFWVNFK
FT                   VFGMIPLTMLFAFAQMPLTKRYQVAPATLEQSAAEEGDVSGR"
FT   gene            complement(406149..406514)
FT                   /locus_tag="RPB_0364"
FT   CDS_pept        complement(406149..406514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05075"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J385"
FT                   /protein_id="ABD05075.1"
FT                   /translation="MRPLNLRHLTLAPLAAALAFGLLASGPVMAQGTQTAPAADKMAPP
FT                   AATKTSPTAGAKTELLDINTATADQLDALPGVGKAYSAAIIKGRPYKAKDELVYKKILP
FT                   EKTYEGIKDKIIAKHKS"
FT   sig_peptide     complement(406422..406514)
FT                   /locus_tag="RPB_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(406823..407416)
FT                   /locus_tag="RPB_0365"
FT   CDS_pept        complement(406823..407416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0365"
FT                   /product="periplasmic protein thiol"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05076"
FT                   /db_xref="GOA:Q2J384"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J384"
FT                   /protein_id="ABD05076.1"
FT                   /translation="MSTPVTDTPSPTRRSLMVALPLLVFAGLAALFWIRLGDRDISKIP
FT                   SALIGREVPQTELPALDALTRDGAAVPGLGPAQFKGKVSVVNVWASWCVPCHDEAPLLT
FT                   ALGDDKRFQIVGINYKDRPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETFVV
FT                   GRDGKIAYKLVGPITPDNLDKVLKPEIEKALGKS"
FT   sig_peptide     complement(407327..407416)
FT                   /locus_tag="RPB_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.838 at
FT                   residue 30"
FT   gene            complement(407589..408323)
FT                   /locus_tag="RPB_0366"
FT   CDS_pept        complement(407589..408323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0366"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05077"
FT                   /db_xref="GOA:Q2J383"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J383"
FT                   /protein_id="ABD05077.1"
FT                   /translation="MTLTELANPTRFLTLAGRLLPWLAGATALLLTVGLVQSMLAPDDY
FT                   QQGATVKIMFVHVPNAWLSMFVWGVMSVAALGTLVWRHPLADVAAKTAAPIGAAFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSMLILFLMYLGLIALWRAVEDPSRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVVRMGGPALDQSFLIPLLVMALGFSLLFLTLHVAAMR
FT                   NEILRRRVRTLQMLQASRAEAA"
FT   sig_peptide     complement(408207..408323)
FT                   /locus_tag="RPB_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.652) with cleavage site probability 0.392 at
FT                   residue 39"
FT   gene            complement(408479..409243)
FT                   /locus_tag="RPB_0367"
FT   CDS_pept        complement(408479..409243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0367"
FT                   /product="conserved hypothetical protein PA1030"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05078"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J382"
FT                   /protein_id="ABD05078.1"
FT                   /translation="MSSSTWIRDALRSEAARLSGRFWRIVEAQHQSATMKLTDSLDEQA
FT                   LLEDIIEDTKPPIPPDCDGLDFLLMTPFRYSATNPWGSRFRRPNADTGVFYASGHPATA
FT                   IAEAVFHRLRFFAESPDTPWPQNPAEHTAFAVLLESDRALDLATLPPPELAPLMRRDDY
FT                   AAAQSFSDAARAAGADIIKYPSVRDPQGGANVAVLSPRAFHSKAPVDRQTWRIHFDRNG
FT                   ARAFCEAPRGSLAFGRDAFDADPRMRGFVWDR"
FT   gene            complement(409203..409601)
FT                   /locus_tag="RPB_0368"
FT   CDS_pept        complement(409203..409601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05079"
FT                   /db_xref="GOA:Q2J381"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J381"
FT                   /protein_id="ABD05079.1"
FT                   /translation="MIAASNPERLVSPMNTEVDAGVVLTKATVRAAERLGLSQKVLSNV
FT                   IGLSESVISRMKSGDYVLDRGKAFELAALFVRLYRSLDAIVAGDETAARKWIKAENLAL
FT                   RGTPVELIQKVQGLFHVVQYLDTRRAPV"
FT   gene            complement(409745..410965)
FT                   /locus_tag="RPB_0369"
FT   CDS_pept        complement(409745..410965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0369"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05080"
FT                   /db_xref="GOA:Q2J380"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J380"
FT                   /protein_id="ABD05080.1"
FT                   /translation="MTAPRSIVIGGGAFAGLALALALRQGLGPEVPIVVADPALAMRPS
FT                   RDPRATAIVAACRRLFEALGVWDEVAPTAQPIIDMVVTDSALEDATRPVFLTFAGEVQP
FT                   GEPFAHMVENKYLNEALASRAEAAGVELRATPVTSYQAGDDATRVTLGDGSVIDASLLV
FT                   AADGAKSKLRERAGIATYGWDYDQSGIVVMVEHERDHHGCAEEHFLPAGPFAILPLTGR
FT                   RSSLVWTESRADAAKIVALSAKEFQAELETRFGLRLGEVKPLDAPKAFPLGYFVAQSFI
FT                   APRLALIGDAAHVIHPIAGQGLNMGLRDVAALAEVVVDAARLGIDPGQADVLENYQRWR
FT                   RFDTMAMGVATNGLNLLFSNKSPLLRSVRDIGLGIVDRLPPLKDVFIRQAAGLTGDTPR
FT                   LLKGEAL"
FT   sig_peptide     complement(410903..410965)
FT                   /locus_tag="RPB_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.773 at
FT                   residue 21"
FT   gene            411182..412057
FT                   /locus_tag="RPB_0370"
FT   CDS_pept        411182..412057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0370"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05081"
FT                   /db_xref="GOA:Q2J379"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J379"
FT                   /protein_id="ABD05081.1"
FT                   /translation="MSKSLIDLISILDLEPLEVNLFRGTSPQTSWQRVFGGQVIGQAMV
FT                   AGCRTVENRLPHSLHCYFILPGDPAVPIIYEVERLRDGKSYTTRRVTAIQHGQAIFSLM
FT                   MSFHDDEETEFDHQDKMPDVPPPEALSAEEIVKQPFFKEMPDFIKRYYESDRPIELRPV
FT                   ELSRYFGQKIEDGRIHVWIRTAAKLPDDPALHMCALAYASDFSLLDAVMARYGRTLFDK
FT                   RMMPASLDHAMWFHRPFRADEWLLYVQDSPSAQSGRGLTRGMIYKADGTLVASVAQEGS
FT                   VRQRRDLPRT"
FT   gene            412194..412532
FT                   /locus_tag="RPB_0371"
FT   CDS_pept        412194..412532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0371"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05082"
FT                   /db_xref="GOA:Q2J378"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J378"
FT                   /protein_id="ABD05082.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDSALADKAVEVITRGARTGQIGDGKIFVTPIDHALRIRT
FT                   GETDSDAL"
FT   gene            412934..413272
FT                   /locus_tag="RPB_0372"
FT   CDS_pept        412934..413272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0372"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05083"
FT                   /db_xref="GOA:Q2J377"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J377"
FT                   /protein_id="ABD05083.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKIKIEVAIATDQVEKTIEAITSAAKTGQIGDGKIFVIGLDHAVRIRT
FT                   GEADAAAL"
FT   gene            413316..414758
FT                   /locus_tag="RPB_0373"
FT   CDS_pept        413316..414758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0373"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05084"
FT                   /db_xref="GOA:Q2J376"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J376"
FT                   /protein_id="ABD05084.1"
FT                   /translation="MTFKRPYGAGLAALAAGLFAATAAYAEPTVNKGDNAWMMTSTVLV
FT                   VLMTIPGLALFYGGLVRSKNMLSVLAQVFYTFSIVIVIWAVYGYSLAFTGGSDFIGGFS
FT                   KAFLAGVTPDSKVASFSVDANVSELIYICFQMTFAAITPALIVGAFAERTRFAAVALFV
FT                   PLWVTLIYFPMAHMVWYWPGPDLITDAAKALAAATDDAAKAAAQAKLDEINADAGFIFK
FT                   KGALDFAGGTVVHINAGIAGLVGALLIGKRTGYGKELMAPHSLTMTMIGAALLWVGWFG
FT                   FNVGSNLEATGVAGLAMTNTFVATAAAAMGWMFAEWIFKGHPSLLGALSGAVAGLVAVT
FT                   PAAGFAGPMGAIVLGLVAGVVCLFFCTVVKNALGYDDSLDVFGVHGVGGIIGALGTGIL
FT                   VNPALGGTGVYDYVAGKVADYDFGTQMIAQCWGVGTTILLSGIGSAILFKVVDVIVGLR
FT                   APVEVEREGLDLVEHTERAYNM"
FT   sig_peptide     413316..413396
FT                   /locus_tag="RPB_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            414883..415248
FT                   /locus_tag="RPB_0374"
FT   CDS_pept        414883..415248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0374"
FT                   /product="DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05085"
FT                   /db_xref="GOA:Q2J375"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J375"
FT                   /protein_id="ABD05085.1"
FT                   /translation="MARWFAPRLTEASQTRRFVLYSAMDRIGALDILRRSQTALHERGV
FT                   RHIALFGSVARGSERPDSDLDIMIEIDPDAHVTAFEYVDLKDYIAGLFDRPVDVVNRDQ
FT                   LKAHVAPSAEADAVYAF"
FT   gene            415238..415639
FT                   /locus_tag="RPB_0375"
FT   CDS_pept        415238..415639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0375"
FT                   /product="Protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05086"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J374"
FT                   /protein_id="ABD05086.1"
FT                   /translation="MRSEITDLALRDILHHIDLATEFVANTDLVVFKNDLRTLYAVTRC
FT                   LEIISEASRRVANDVKIRHPSIGWRQIAAAGNVYRHDYEDVAAQMVWDTVHRALPALRA
FT                   AVSRELADKLQSPVPPHTHRGTPPPPVDG"
FT   gene            415696..416958
FT                   /locus_tag="RPB_0376"
FT   CDS_pept        415696..416958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0376"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05087"
FT                   /db_xref="GOA:Q2J373"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J373"
FT                   /protein_id="ABD05087.1"
FT                   /translation="MRPGALQNWRFRMAVPASSASAHAVGSAHAAAGSERSPFARLTEL
FT                   LAPYQPGERLINLSVGEPQHPVPDFVGPVLARHTAEFGRYPMAKGIAPFRQAAAAWLTK
FT                   RFALPRAPDPETQVLVLNGSREGLFLAAVAAARYVGPRDGTPAILMPNPFYPAYAAGAR
FT                   AAGCEAVFLPTNPANGFLPDLDALDAATLKRTVAIYIASPANPQGAVASTGYFAKLKAL
FT                   ADRHGFLILADECYSEIYTRDAPGSALQAAGPDFRNIAVFQSLSKRSNLPGMRVGFVAG
FT                   DADFLAAYHELRNVAAPQVPVPLQHVAVAAYADEAHVEENRRLYRLKFDLADQIIGARY
FT                   GYQRPAGGFCLWLDVAAQGGDEAATINLFKHGGVRVIPGSYLARPQADGSNPGAGYIRV
FT                   AMVQDSETTAEALHRLVRILE"
FT   sig_peptide     415696..415788
FT                   /locus_tag="RPB_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.973 at
FT                   residue 31"
FT   gene            416975..419452
FT                   /locus_tag="RPB_0377"
FT   CDS_pept        416975..419452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0377"
FT                   /product="Cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05088"
FT                   /db_xref="GOA:Q2J372"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J372"
FT                   /protein_id="ABD05088.1"
FT                   /translation="MSMPAIERVIPLVGHLPTSLRDALARRLRELAGFGLISIAVMAAA
FT                   ALATWSVQDPSLSHATSRKIHNLIGYPGAIGADLAMQILGLGAIGLLLPVATWGWRMIN
FT                   HRPFDRRALRFGAWILCTILAAGFASSFPHDSAWPLPTGLGGVVGDALVRAPSLIFGPG
FT                   LIFRIILSIVLGGAMVACFVMASGYGSREPDPVEAIADDVPLDEDEDRDEGSVSLGWMA
FT                   HAVLSARARLWRLMKLGYRGLVSSGASAGRSAAAFERQEPKLGSGRTSPPIVPRDERDD
FT                   DEPLDLESADAIDDEEEDEPVARAPRKKAAPKPTAKKPGKFELPSVNVLTAPKASDRQP
FT                   LNKAELEANSRALEGVLQDFGVRGEIVKANPGPVVTLYELEPAPGIKSSRVIGLSDDIA
FT                   RSMSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDGNETVHKLPLCLGKNIGG
FT                   DSIIIDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYD
FT                   GIPHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLSEAKARGEEL
FT                   TRTVHTGFDKETGKAIYEDEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMA
FT                   RAAGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDM
FT                   LYMAGGGRISRVHGPFVSDEEVEKVVKHLKTQGQPEYLEAVTAEEPAEGEDGAVFDATG
FT                   MGGDGGGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLIERMELEGIVGQPNHAG
FT                   KREILVAEEDSDF"
FT   gene            419473..420426
FT                   /locus_tag="RPB_0378"
FT   CDS_pept        419473..420426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0378"
FT                   /product="Outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05089"
FT                   /db_xref="GOA:Q2J371"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J371"
FT                   /protein_id="ABD05089.1"
FT                   /translation="MELSGAESRNRHSAKVAAGKLSAGSAAPAQDIALSIDFNGLAPRP
FT                   AIPQGLRGAIAAGIGLLLAVTAPFAAAETVPVPKPSPKGGERLLSAAEPNRPQQRPPQQ
FT                   PAPPVAKLTTPPEPVIPDPRRNVPASIFTTFDAKQKADAAKVSAYLSSLSTLVGNFVQV
FT                   GPDGSRLQGDFYIMKPGKVRFEYDEPSPVSMVSDGQSLAVRDRKLATQDVYPLSQTPLR
FT                   YLLSDRIDLLRDTNVVAISSDELYISIIIEERNAVIGTSRLMLMLGVKDGQLKQWTVTD
FT                   PQGYDTTVAIYNLDTTRRPDPSMFKIDFTDYGTPPG"
FT   gene            420707..421519
FT                   /locus_tag="RPB_0379"
FT   CDS_pept        420707..421519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0379"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05090"
FT                   /db_xref="GOA:Q2J370"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J370"
FT                   /protein_id="ABD05090.1"
FT                   /translation="MSFTLTTWNINSVRLRIELVAKFLKAQRPDVLCLQETKCPDDAFP
FT                   AKRFKRLGYEHIALNGQKGYHGVAVISKIPFLATDIRTFCDNIDSRHISVSLQTGAADP
FT                   PLLLHNFYVPAGGDIPDPEANPKFKHKLSFLDEMRACAPLHPSGDARHILVGDLNVAPH
FT                   EHDVWSHKQLLKVVSHTPVECDKLLAVQAAGNWVDVARERIPLSEKIYTWWSYRAADWT
FT                   IGDRGRRLDHIWVSEALRARVTDFKILRDARSWERPSDHVPVTVTMEL"
FT   gene            complement(421639..422085)
FT                   /locus_tag="RPB_0380"
FT   CDS_pept        complement(421639..422085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0380"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05091"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J369"
FT                   /protein_id="ABD05091.1"
FT                   /translation="MSIEDDVALLERVPTLRLLGDTSLRMLAIGSDQRDFARGDVLFNA
FT                   GDASDAGYVVQSGAFQVTSEDGGPHELIARPGDLIGELALVLPMPRPSSAVALEYSSVI
FT                   RIARSLFQRVLESDPAAAKRLRDEFAARTTTIARDILRAGAKLT"
FT   gene            complement(422148..422834)
FT                   /locus_tag="RPB_0381"
FT   CDS_pept        complement(422148..422834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0381"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05092"
FT                   /db_xref="GOA:Q2J368"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J368"
FT                   /protein_id="ABD05092.1"
FT                   /translation="MPNARKILIVDDDTDLRDALVEQLSLHEEFEASAVDTGAKGVQSA
FT                   KANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRAGQAPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            423017..423586
FT                   /locus_tag="RPB_0382"
FT   CDS_pept        423017..423586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05093"
FT                   /db_xref="GOA:Q2J367"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J367"
FT                   /protein_id="ABD05093.1"
FT                   /translation="MKTVLNSDSYPTAAGCRPSRMVRVRPAPGRPSRGWLTADGLTIPV
FT                   ALGRGGILANKREGDGGTPRGTFRPLRLWWRADRWPQPRTRLPVRAITAADAWCEDPSS
FT                   RHYNRPMRRGPGEPGDRLRRDDHLYDFIVEIDHNTRPRIAGRGSAVFLHLARDNFGPTA
FT                   GCIAMTRGNLLRLLARLGPKTRIVIG"
FT   gene            complement(423846..424511)
FT                   /locus_tag="RPB_0383"
FT   CDS_pept        complement(423846..424511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0383"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05094"
FT                   /db_xref="GOA:Q2J366"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J366"
FT                   /protein_id="ABD05094.1"
FT                   /translation="MSAGPVQGLAAVEQEIARACQEARRDRDSVTLIAVSKTFEADAIL
FT                   PVLAAGQRVFGENRVQEAKAKWPPLLESHPDTALHLIGPLQSNKAKEAVALFDAIHSVD
FT                   RESLCEALAKVLPASGRAVELFVQINTGEEPQKAGIAPQDADAFIAACRDRFGLTIAGL
FT                   MCIPPVDEAPAPHFALTAKIAKRNGLAKLSMGMSSDFATAIAFGATHVRVGSAIFGHR"
FT   gene            424683..426362
FT                   /locus_tag="RPB_0384"
FT   CDS_pept        424683..426362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0384"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05095"
FT                   /db_xref="GOA:Q2J365"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J365"
FT                   /protein_id="ABD05095.1"
FT                   /translation="MSRIAIIRKKAKLRGLLGIRARLVILALILVCPLMFDRVRLLEHT
FT                   RSSEIAAVAATAATLAQRAADAQREVISSVEAVLKSAAYIHAAAAQVDRSCSILRASLR
FT                   VDLPSIRMLSIADARGIIHCSTAAMFVGADVSERAYFRRALESHDFVVSDFLIGAQSGK
FT                   GTILAAYPVSAVDAGEQAVMIAGMNLDWLSDIMANLADRAGVSVALIDGEGTVLATPPD
FT                   QRSKVGQKLDQATLDFALGANPPQREALAALDGTGRRLSVSRIPGTNSRLLVTLDESVV
FT                   AAAINREIRTAYLQLALVCVFVLLGALIAAERLIVRPISMLTSTAKRFAEGDWSARAAR
FT                   ARLPSEFVPLARAFNAMAAQLGQRERELVAINNNLTVMASMDMLSGLANRRGFQSRLDF
FT                   EWARGQQTGHCLALLMLDVDHFKPFNDSYGHPEGDACLSRIGEALAGVADETGGFAARY
FT                   GGEEFCLLLPNTDAAAARDVGELVRATIERLGVPHRTSEFQRVTVSVGVATALPVDTAA
FT                   PRELLEAADAALYAAKHGGRNTVAEHGLVRGADAPAPMAMAG"
FT   gene            426566..429190
FT                   /locus_tag="RPB_0385"
FT   CDS_pept        426566..429190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0385"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05096"
FT                   /db_xref="GOA:Q2J364"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J364"
FT                   /protein_id="ABD05096.1"
FT                   /translation="MSNERYNARESEPKWQAKWDEAKIFATRNDDPRPKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARTMRARGHNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIASMKKQLQTMGLSLDWAREFATCDPTYYKHQQKMFLDFLKVGLAERETRKLNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITRYAQDLLDALETLDRWPDKVRLMQR
FT                   NWIGRSEGLLVRFALDAATTPAGETELKIFTTRPDTLFGAKFMAIAPDHPLAQAAAAKN
FT                   EKIAAFVEECKKRGTAQAEIDTAEKQGIDTGIRALHPFDPTWQIPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYQLGNTPVVCPEGQDPLSFVITDEAYDGDGRLINSRFLDGM
FT                   SIADAKEEVAKRLETATLGNAPVGERKVNFRLRDWGISRQRYWGCPIPVIHCEVCGVVP
FT                   VPDKDLPVVLPEDVSFDKPGNALDHHPTWKHVPCPQCGGKAQRETDTMDTFVDSSWYFA
FT                   RFTDPWNETAPTTPDVVNRMLPVDQYIGGVEHAILHLLYSRFFTRAMKATGHLGLDEPF
FT                   RGMFTQGMVVHETYRTADGHFASPAEVAIVAEGDGRRATLLDGGTPVEIGPIEKMSKSK
FT                   RNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFVQRLWRMVNDAAAI
FT                   ARSAPAERPATFGPEALAVRKAAHGALDKVLSGIERLAFNVSLAHIREFANSFGEALAK
FT                   PGQPSPDLAWAIREAAVILVQLFHPMMPHLAEECWAALGRPGLVSEALWPQIERDLLVE
FT                   DSITLPVQVNGKKRGDITVARDANTQEIEAAVLALDAVRQALDGKPVRKVIVVPQRIVN
FT                   VVG"
FT   gene            429177..429737
FT                   /locus_tag="RPB_0386"
FT   CDS_pept        429177..429737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05097"
FT                   /db_xref="GOA:Q2J363"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J363"
FT                   /protein_id="ABD05097.1"
FT                   /translation="MSSVRPALAKMVARLALAAMLAAPLAGCFQPMYADRGDGSPTLRD
FT                   KLAAIEVPPLDVPNGSRVARLGVEIRNALMFKMYGSATGAPPLYSLKMNLTTQRSSLIV
FT                   DPTTALPTIENYGIDASYRLIEIATGKVVMSGNTFSRVEYDVPGQTQRFARTRAGRDAE
FT                   DRAAQEIAENINTRLASYFYAGI"
FT   sig_peptide     429177..429260
FT                   /locus_tag="RPB_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.640) with cleavage site probability 0.446 at
FT                   residue 28"
FT   gene            429782..430810
FT                   /locus_tag="RPB_0387"
FT   CDS_pept        429782..430810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0387"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05098"
FT                   /db_xref="GOA:Q2J362"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J362"
FT                   /protein_id="ABD05098.1"
FT                   /translation="MVALRGRDATSFLARPDPGRPIILLFGPDAGLVRERADALIASAL
FT                   DDPNDPFALVRLDGDELAAEPSRLVDEANSIPMFGGRRAIRIRAGSRSFVAGVETLVAS
FT                   PPKECRIVIEAGDIKPDNALRKACEKAASAVAIGCYPDAEADLAKLIDDELRAAQLQIG
FT                   RDARGVLMTLLGGDRQASRNEVRKLALYAHGQGEITLDDVIACVSDASDLKLDVIVDAA
FT                   FSGKPQVVESEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLAVDAGTPAATALDSGFPR
FT                   LHFSRKAASETALRNLGPSRLAQIIDQLATAALDTRRQATLGAAIAQRTLLSIAVSARR
FT                   RS"
FT   gene            complement(431056..431946)
FT                   /locus_tag="RPB_0388"
FT   CDS_pept        complement(431056..431946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0388"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05099"
FT                   /db_xref="GOA:Q2J361"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J361"
FT                   /protein_id="ABD05099.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEAAHVERPRAQRKVPIEFIKANP
FT                   RNPRRSFTDAELGELSDSIKQHGVIQPIVVRPVKGTNDRFEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDALALEIAIVENVQRENLNPLEEAQGYHALANEFKRSQDEIAKIVGKSRS
FT                   HVANMMRLTKLPDDVLELIAAGQLSAGHARALIGVPDPSAAAKRIVAEGLNVRQTEALA
FT                   HDEGVPERKPQKPRASASAKPAKDADTLALEKRVSDALGMKVTIDDRDGTGSLQIRYAD
FT                   LDQLDDIIRRLEAGG"
FT   gene            complement(432215..433030)
FT                   /locus_tag="RPB_0389"
FT   CDS_pept        complement(432215..433030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0389"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05100"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J360"
FT                   /protein_id="ABD05100.1"
FT                   /translation="MTEPGRPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLD
FT                   PQGNASTGLGIDRRDRNCSTYDVLAGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELG
FT                   HTRDRAFRLRDAIAVLNKDVDPPLDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEF
FT                   FALEGLSQLLQTVEQVRSTLNPELTIHGIVLTMFDSRNNLSSQVVADVRQFMGKKVYDT
FT                   MIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERELRTTH"
FT   gene            complement(433056..433769)
FT                   /locus_tag="RPB_0390"
FT   CDS_pept        complement(433056..433769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0390"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05101"
FT                   /db_xref="GOA:Q2J359"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J359"
FT                   /protein_id="ABD05101.1"
FT                   /translation="MASRHSPQTAAQPDAADKAQALRLTPVSRETETRLDAYLDLLRLW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLLALAPTARRWLDFGSGGGFPGIVLACAMAEHDG
FT                   GHVTLVERNAKKAAFLREALRVTGAPGTVMLADIGDNVDRFPRALDCITARAVAPLHQL
FT                   IGFAAPLMTEGSKVLFLKGQDVEAELTEATKYWKIEPQLHASLTGGQGWIVELDRIVRH
FT                   APSTTNPEAAAHDRH"
FT   gene            complement(434355..436235)
FT                   /locus_tag="RPB_0391"
FT   CDS_pept        complement(434355..436235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0391"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05102"
FT                   /db_xref="GOA:Q2J358"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J358"
FT                   /protein_id="ABD05102.1"
FT                   /translation="MRNSYDVIVIGGGHAGCEAAAAAARLGAATALVTHRFATVGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQAAIRATANLRVIEGEADTLLNEAGRVTGIRLADGRELVAGAVVITTGTFLRGLIHL
FT                   GEQCWPAGRIDEAPALGLSASFEALGLALGRLKTGTPPRLDGRTIDWGAVEMQPGDDPP
FT                   EPFSVLTPAITTPQIECGITRTLPATHEVIRANVHRSPMYSGQIQSSGPRYCPSIEDKI
FT                   VKFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILATIPGLERTVMLRPGYAI
FT                   EYDHVDPRELEPTLQTKRLRGLYLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGEGVV
FT                   FDRADGYLGVMIDDLVTRGISEPYRMFTSRAEYRLTLRADNADQRLTDKGLALGCVGTE
FT                   RAAFHRGKMAALAEAKALAQSLAITPNEAARHGLSLNRDGQRRSAFDLLSYPEIEWPQV
FT                   RAIWPELAAVSPSIAGHVEIDAKYAVYLERQVADVAAFRRDEGLLLTDVDYAQVPGLSN
FT                   EARGRLERHRPRTVGQAGRLDGITPAALGILAAYLRREARKRPAVVDGEG"
FT   gene            complement(436875..438257)
FT                   /locus_tag="RPB_0392"
FT   CDS_pept        complement(436875..438257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0392"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05103"
FT                   /db_xref="GOA:Q2J357"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J357"
FT                   /protein_id="ABD05103.1"
FT                   /translation="MHPNDQTIFALASGRLPSALAIVRVSGARARDVLAALTGALPPPR
FT                   TVRRVRIRDVNHELIDDAVVLWFAAPASATGEDVAEFHIHGGRAVLAALVKALASFDDV
FT                   RPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTEAQRRLAVRQLGGLLGDRARRWRAQ
FT                   IIEALALIEAGIDFADEGDVQGELMAPALRTIATLHGEIAEVLAAQGKSERLRDGLVVA
FT                   IAGPPNVGKSTLINRLARREVAIVSPHAGTTRDVIEVQLDLGGYPVTLIDTAGIRESED
FT                   SVEQEGVRRAKARAAEADLVLWLGADEAIDVAVEGSAPVWRVRNKIDLVPQADTVGADS
FT                   GGAGLAANLWQTEGNVAAREAFGISAKRGDGVGDMVEALAGFAAQYFAASGEAAVISRE
FT                   RHRLLLQQAEVMLRCSMTVGLAPELVAEELRLAAGALGRLLGRVDVEDVLGEIFGRFCI
FT                   GK"
FT   gene            complement(438366..439631)
FT                   /locus_tag="RPB_0393"
FT   CDS_pept        complement(438366..439631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0393"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05104"
FT                   /db_xref="GOA:Q2J356"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J356"
FT                   /protein_id="ABD05104.1"
FT                   /translation="MREMKLSDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQL
FT                   SAKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRNTKNNAEFFESMNT"
FT   gene            complement(439907..440347)
FT                   /locus_tag="RPB_0394"
FT   CDS_pept        complement(439907..440347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05105"
FT                   /db_xref="GOA:Q2J355"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J355"
FT                   /protein_id="ABD05105.1"
FT                   /translation="MIDWTDIYLWVKTLHVVAVISWMAGMLYMPRLFVYHCSAEIGSVQ
FT                   SETFKIMERRLYKAIMNPAMMVAWAAGLVIAWEQSYFTSGWFHAKLGAVVLMTVIHLML
FT                   GRYVRDFAADRNTRTHKFYRVINEIPTVLMIAAVIFVIVKPF"
FT   gene            440799..441638
FT                   /locus_tag="RPB_0395"
FT   CDS_pept        440799..441638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0395"
FT                   /product="Protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05106"
FT                   /db_xref="GOA:Q2J354"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J354"
FT                   /protein_id="ABD05106.1"
FT                   /translation="MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVNAVEHVYPLV
FT                   RSQKQLDRVLQEIEESPGIVLFTLLEGELVARLEAKCQEINSPSLSIIGPVMQLFEAYL
FT                   GASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTS
FT                   IYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVRQNRLLSLGAGAG
FT                   NDSYIDRQSVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE"
FT   gene            441635..442243
FT                   /locus_tag="RPB_0396"
FT   CDS_pept        441635..442243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0396"
FT                   /product="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05107"
FT                   /db_xref="GOA:Q2J353"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J353"
FT                   /protein_id="ABD05107.1"
FT                   /translation="MTLWLGPGPLVLASQSRARQALLSNAGIPFDAIPADIDERGIAKA
FT                   SGLSAPGEIAALLAQEKAAFVSNHHPGRLVLGADQTLALGARGFNKPADRNEAAKQLRE
FT                   LAGRRHELHAAIALVRNGVTLFADVSIARMTMRPLNDEEIAAYLDLAGDKATSSVGGYQ
FT                   VEGLGVHLFDGIHGDHFTILGLPLLPLLGFLRSQKLLAF"
FT   gene            442274..442873
FT                   /locus_tag="RPB_0397"
FT   CDS_pept        442274..442873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0397"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05108"
FT                   /db_xref="GOA:Q2J352"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J352"
FT                   /protein_id="ABD05108.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAKLFGEAGVPVYDADATVHQIYEGEAVP
FT                   AIEAAFPGTTVDGKVDRALLSEKVVHDSDAMKRLEQIVHPMLRSHHQNFLDDAEASGAP
FT                   VAVVDVPLLFETGGEKRVDAVVVVTTSPEVQRERILARENMTPEKLDAILARQMPDAEK
FT                   RRRADFVVDTSHGLDPVRAQIREILDAAARMPRRRP"
FT   gene            442905..443600
FT                   /locus_tag="RPB_0398"
FT   CDS_pept        442905..443600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0398"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05109"
FT                   /db_xref="GOA:Q2J351"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J351"
FT                   /protein_id="ABD05109.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIYNRMPTGQVYHQYINP
FT                   ERDMPAEAFAVHGLSSEFLADKPVFAQVADAFIDFIGDAPLVIHNASFDIGFINAELAR
FT                   LSRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILAEVPSERSGAGGDTPRRQRSIALTPRVTDADLEAHRAFIALMGDKA
FT                   IWNEYTAAA"
FT   gene            complement(443737..444213)
FT                   /locus_tag="RPB_0399"
FT   CDS_pept        complement(443737..444213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0399"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05110"
FT                   /db_xref="GOA:Q2J350"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J350"
FT                   /protein_id="ABD05110.1"
FT                   /translation="MTNGNGTPPEAAAPPQLNVLAQYTKDLSFENPNAPASLAPQQSQP
FT                   AINIQINVGANNLAENEFEVTLSIEGKAESGSTVLFSFELAYAGVFRIVNVPQENLHPL
FT                   IMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNLERAQQQGQPS"
FT   gene            444674..445381
FT                   /locus_tag="RPB_0400"
FT   CDS_pept        444674..445381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0400"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05111"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J349"
FT                   /protein_id="ABD05111.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPG
FT                   KQDTNVVSMPGSVIDQSPIAPSADVVPPSDRWKGIAEPDSPLEHGLNAVFTQDSSFDAN
FT                   HFLSGAKGAYEMIVMAFANGDRRALKDLLSSEVYESFEAAIKDREKNELKTETRFVAIE
FT                   KAELLGAEVRDHVAQLTVKFVSQMISVTRDKAGAVVDGSPDKVADITDVWTFARDISSR
FT                   DPNWKLVGTGNEL"
FT   gene            445419..446939
FT                   /locus_tag="RPB_0401"
FT   CDS_pept        445419..446939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0401"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05112"
FT                   /db_xref="GOA:Q2J348"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J348"
FT                   /protein_id="ABD05112.1"
FT                   /translation="MLAAALLFAPAAVEAGPRHHHSSGHHSSGHHAKPHHAAAHKRHRL
FT                   PAGPIEIPGGQYAPVSWDQVPGWDSDDQLAAFKTFQASCRPVLARRKPMPDTKALGSSL
FT                   VAPCRAARVAEISDAAQARRFFERHFLPLQISRVGEDAGFVTGYYEPIVDGSRVQTDVY
FT                   NVPVYRRPSNLFVRGYSQGAGLPNGGPVYRKIGRRKLVPYYDRAEIEDGAIAGRGLEIC
FT                   WLKSQTDLLFSQIQGSARVRLEDGSFVRINYDAHNGYPYTPVGRILIDRGIIPKEQMSM
FT                   QRIREWMDANPDGAKELRRANRSFVFFREVRLKDDDEAVGAQGVPLTPGRSIAVDKGLH
FT                   VYGTPFFITGELPVEAPEAKTPFRRLMIAQDTGSAIIGPARADLYFGAGAEAGAVAGRM
FT                   RHPIRFVMLLPNSLDPVARGRTMPLPEPRPSARIAKQFPPTPVAKDKPVEADAAKPTAT
FT                   PATKPASPLEGSAQAVPTPQARPDAAPAASPKRTHRRPHRHRHHRRHR"
FT   gene            446945..447538
FT                   /locus_tag="RPB_0402"
FT   CDS_pept        446945..447538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0402"
FT                   /product="Smr protein/MutS2-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05113"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J347"
FT                   /protein_id="ABD05113.1"
FT                   /translation="MKRVAPPLDPPAAPRRKRSLSEDERVLWDSVAKQVKPLRGRPRLT
FT                   RIELPAAPSDTPVAKPPPPATQQPIKRPVKLATPMSPPPLASLGRRERSHLSRGRKDID
FT                   ARIDLHGMTQARAHHALLRFLQSASHDGLSFVLVITGKGARLGGDPERGVLRRQVPLWL
FT                   SLPEFRAYVVGFDEAAIGHGGEGALYVRVRRARG"
FT   gene            complement(447864..449165)
FT                   /locus_tag="RPB_0403"
FT   CDS_pept        complement(447864..449165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0403"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05114"
FT                   /db_xref="GOA:Q2J346"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J346"
FT                   /protein_id="ABD05114.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGALR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIAQVREKKRKDVQARAQIAAEERVLDALVGPGSSPATRDSFRRKLRTGELNDKEIE
FT                   IETQAGGGSPMFEIPGMPGGQIGAISIGDIFGKMGGRTKTRRLTVVDSHDILVNEEADK
FT                   LLDNDQLVQEAINAVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTVA
FT                   TKHGAVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELNALSRDDMRRILTEPEAS
FT                   LIKQYVALLQTEGVTLEFGDDAIDALADVAVAVNSTVENIGARRLQTVMERVLDDISFG
FT                   APDRGGETIRIDADYVQKNVGDLAKNTDLSRFIL"
FT   gene            complement(449319..449882)
FT                   /locus_tag="RPB_0404"
FT   CDS_pept        complement(449319..449882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0404"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05115"
FT                   /db_xref="GOA:Q2J345"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J345"
FT                   /protein_id="ABD05115.1"
FT                   /translation="MYSAAGESSPQIWHGTTILTVRKGGKVVIGGDGQVSIGQTVIKAN
FT                   AKKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWRTDRYLR
FT                   RLEAMMIVADKDVSLVLTGTGDVLEPEYGVMAIGSGGNYALAAARALADTDQDAETIVR
FT                   KALDIAADICVYTNRNLTLETLTA"
FT   gene            450081..450674
FT                   /locus_tag="RPB_0405"
FT   CDS_pept        450081..450674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0405"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05116"
FT                   /db_xref="GOA:Q2J344"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J344"
FT                   /protein_id="ABD05116.1"
FT                   /translation="MRTATIKRKTKETDIEVTVNLDGAGVSNAATGIGFFDHMLDLLAK
FT                   HSRIDITVKAVGDLHVDFHHTTEDVGIALGQAVRQALGNMAGIIRYASMLMPMDETLTR
FT                   VVIDVSGRPFLVFKAEFPRDKIGEFDTELVREWFQAFAMNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARALRAAVAIDPQAAGEVPSTKGQLGG"
FT   gene            450703..451221
FT                   /locus_tag="RPB_0406"
FT   CDS_pept        450703..451221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05117"
FT                   /db_xref="GOA:Q2J343"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J343"
FT                   /protein_id="ABD05117.1"
FT                   /translation="MPVYTVHAPPPVDDERSAKPDRFVFVRDGFYVWAFVFGPLWLLTR
FT                   RLWLALLGYLVVVVAMTVALATLRVGAGPRFAVMLLMALLLGLEAASLWRWTLRRRGWR
FT                   QLDVVIGDDMPSAERRFFDRWTSRQPTAVSFSLPLDRGAPPPTRSVPMPSSSIYGDIVG
FT                   SFPRPGSSR"
FT   gene            451218..451868
FT                   /locus_tag="RPB_0407"
FT   CDS_pept        451218..451868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0407"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05118"
FT                   /db_xref="GOA:Q2J342"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J342"
FT                   /protein_id="ABD05118.1"
FT                   /translation="MSVAIVDYGSGNLHSAAKAFERAARSMEVPEKIIVTRDPEQVFRS
FT                   DRVVLPGVGAFADCRKGLDAIDGMVEALNETVRVKARPFFGICVGMQLMATRGKEHVTT
FT                   DGLGWIPGDVVRIAPNQEDLKIPHMGWNTLDVLREHPVLERLPLGPKGLHAYFVHSFHL
FT                   AATSEADVLARADYGGPVTAVVGRDTMLGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            452026..452763
FT                   /locus_tag="RPB_0408"
FT   CDS_pept        452026..452763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0408"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05119"
FT                   /db_xref="GOA:Q2J341"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J341"
FT                   /protein_id="ABD05119.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPTAQAKSFAAQGFQ
FT                   YLHVVDLDGAFAGKPMNAQAVESMLKVVSMPVQLGGGIRDLATVEAWLSKGIARVIIGT
FT                   AAVRDPALVKQAAKSFPGRVAVGLDARDGKVAVEGWAESSQVTALEIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVKAMLSPRAHKLEGAIAG
FT                   RALYDGRLDPAEALALIGAARAA"
FT   gene            452773..453540
FT                   /locus_tag="RPB_0409"
FT   CDS_pept        452773..453540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0409"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05120"
FT                   /db_xref="GOA:Q2J340"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J340"
FT                   /protein_id="ABD05120.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQEVV
FT                   SLGAGEILLTSMDRDGTRSGFDLPLTRAIADSIQVPVIASGGVGNLDHLVDGIRDGHAT
FT                   AVLAASIFHFGEYTIRQAKDHMVRCGLPMRLDP"
FT   gene            453596..453919
FT                   /locus_tag="RPB_0410"
FT   CDS_pept        453596..453919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0410"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05121"
FT                   /db_xref="GOA:Q2J339"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J339"
FT                   /protein_id="ABD05121.1"
FT                   /translation="MARFTLHDLEATIEARAASGGEASYTKKLLDKGAQHCAKKFGEEA
FT                   VELVIATVENDRDHLIAEAADVMFHMLVLLKARGVTLDEVEAALGQRTAMSGLEEKAAR
FT                   KRD"
FT   gene            454035..454991
FT                   /locus_tag="RPB_0411"
FT   CDS_pept        454035..454991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0411"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05122"
FT                   /db_xref="GOA:Q2J338"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J338"
FT                   /protein_id="ABD05122.1"
FT                   /translation="MDARSELHHYNPYRVFSRSEWANLRQDTPMTLDAGEVSTLRSLHD
FT                   RLDLSEVEEIYLPMSRLLSIHVGAMQQLYYAQRRFLGVVERKMPYIIGVAGSVAVGKST
FT                   TARVLQALLARWSPRPKVDLITTDGFLHPNAVLERAGLMQKKGFPESYDLPALLAFLSD
FT                   IKSGRRKVRAPIYSHLTYDIVPNKFAVVDRPDILIVEGVNVLQTGRLPRDGKAVPVVSD
FT                   FFDFSVYIDADEPVLRDWYIRRFLALRDTAFHDPRSYFHRYAPLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHVVDSVALRRL"
FT   gene            complement(455117..456130)
FT                   /locus_tag="RPB_0412"
FT   CDS_pept        complement(455117..456130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0412"
FT                   /product="ornithine-acyl[acyl carrier protein]
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05123"
FT                   /db_xref="GOA:Q2J337"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J337"
FT                   /protein_id="ABD05123.1"
FT                   /translation="MRTGRAPPDSVACGREDPMQTDHLARSKKFIKLLRPDMAGAAAQT
FT                   AITWLKPALKIADHGKPIAQPALTPATLGRLGPLEVRLAQKKQDIKRAQKLRYRVFYKD
FT                   GTAIADAATLLARRDKDAFDRICDHLLVLDHAAKPSLSGKQPVVGTYRLLRQEIANRHG
FT                   GFYTENEFDIGGMIARHPRLRFLELGRSCVLPPYRNKRTVELLWHGIWSYVRQHGVDVM
FT                   IGCASFDGTDPARLALPLSFLHHYASAPEPWRARAHPSRYVEMNRMPKEAVNQKAALRE
FT                   LPPLIKGYLRLGATIGEGAVIDHQFGTTDVLIIMPVSAISSRYIEHFGVDATRHAA"
FT   gene            complement(456237..458186)
FT                   /locus_tag="RPB_0413"
FT   CDS_pept        complement(456237..458186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0413"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05124"
FT                   /db_xref="GOA:Q2J336"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J336"
FT                   /protein_id="ABD05124.1"
FT                   /translation="MKRWLRFRSRRRAFAGRFPRLVFALRWSMIFLAAFGGAYGFIIGS
FT                   RAESSGYNPHTFAIGASFLFALACLGLAVQSIRLRWLRRRLQALERHNETLADRNWELR
FT                   DAEERARVLHQARDEADAPRRDEDATRRKSRLLAMASHEIRTPLNGIIGMSGLLLDTAL
FT                   TPEQATYARAVKTSGDALATLIDELLDYSRIEAGRFELDSRPFALTALIEDIVELLAPR
FT                   AQAGALEIAADIDDRVPSRVIGDAARLRQVLLNLAGNAIKFTSVGGVVLIVQPGERDGE
FT                   ISFAVRDTGIGIAREAQTRIFGEFEQADDGIARSFGGTGLGLSISQRIVERMGGRIALD
FT                   SQPGRGSTFTASIPLTAADDSGASPIVQPPDLTGQSIMIAAPQTIEATLVAQRLQRWGA
FT                   HVLALSELSAARTALPERAWSAILIDAGFGADAAEALARSARPHAAQRVVMLTPAARSE
FT                   LLPDLPPAFTGYLVKPLRAASLSARLAGSLIDTVAPGIADGDPPETAATDATAPGGRRL
FT                   SVLVAEDNEINALLIRSLLARLGHRVAVAGDGEQALQSWRAAAADGAPFDLVLMDVQMP
FT                   TSDGIAASRQIRAQEAVGDGRRTPILALTANALAEDREACFAAGMDGFLVKPLDRDKLM
FT                   TALDRVAAARPMVA"
FT   sig_peptide     complement(458043..458186)
FT                   /locus_tag="RPB_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.445 at
FT                   residue 48"
FT   gene            complement(458298..458783)
FT                   /locus_tag="RPB_0414"
FT   CDS_pept        complement(458298..458783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05125"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J335"
FT                   /protein_id="ABD05125.1"
FT                   /translation="MLRIRVLASAVPLLVVGLLARGELIAGPPPCIAVGDRSVQIAPAL
FT                   GRAQIHVGFTDDPARATVRVQIVDSPDAADFAVTDDVVTDEPGGCVSAPESRLVAITTN
FT                   PAATDAVIYLTHDDDGRIDYRIFVRANSFTAREAAALLVASSSRHAPIATASIGSRS"
FT   sig_peptide     complement(458721..458783)
FT                   /locus_tag="RPB_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.343 at
FT                   residue 21"
FT   gene            complement(458905..460443)
FT                   /locus_tag="RPB_0415"
FT   CDS_pept        complement(458905..460443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0415"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05126"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J334"
FT                   /protein_id="ABD05126.1"
FT                   /translation="MVQHVSTVAFEGIDARAVDVQVQVSPGLPAFAVVGLADKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPGDALAGFT
FT                   VLGELGLDGSIAPVAGVLPAAIAANARDEGLICPAACGSEAAWASPDIQIIAARSLIQI
FT                   ANHFKGTQLLSRPQPRVHEAESSTLDLRDIKGQESAKRALEIAAAGGHHLLMVGSPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIRDGALTAKRPFRAPHHSASMAALTGG
FT                   GIKARPGEISLAHQGVLFLDELPEFDPRVLDSLRAPLETGEVAVSRANHRVTYPARVML
FT                   VAAMNPCRCGRAYEPGYACKRGRVERCSADYQSRISGPLLDRIDLRIEVPAVTAADLIL
FT                   PPAAEGSAEVAARVAAARDVQRQRYAAIGLPQFRTNAEAPAAALEATAQPDSAGLKLLR
FT                   DAAETMRLSARGYHRVLRVARTLADLDGADKIGRLHLAEALSYRALGEDVRRAA"
FT   gene            complement(460535..460759)
FT                   /locus_tag="RPB_0416"
FT   CDS_pept        complement(460535..460759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05127"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J333"
FT                   /protein_id="ABD05127.1"
FT                   /translation="MSTQSTPRSNAPVAAEASARARSVSIDTLATTINRAIEQAEELRI
FT                   PSAVQLLMMARLEVDLTEIALETGMKKSA"
FT   gene            complement(460756..461412)
FT                   /locus_tag="RPB_0417"
FT   CDS_pept        complement(460756..461412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0417"
FT                   /product="Autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05128"
FT                   /db_xref="GOA:Q2J332"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J332"
FT                   /protein_id="ABD05128.1"
FT                   /translation="MDVHVVRRENREFYADLIEQQFRIRHQIYVVERKWTELARPDGSE
FT                   IDQFDTDDTVYLLGLQNGEIVAGMRMVPTTSPTLLSDVFPQLALETPVRRPDVYELSRI
FT                   FVVPNRRGEHAGPRAEAVIQAAAMEYGLAIGLSAFTIVLETWWLPRLLDQGWRARPLGL
FT                   PQDIAGMSTTAVLVDVDDQAWLEICARRSVPGPALQWRGLDNVDRNPLPNIMELS"
FT   gene            complement(461487..462215)
FT                   /locus_tag="RPB_0418"
FT   CDS_pept        complement(461487..462215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0418"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05129"
FT                   /db_xref="GOA:Q2J331"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J331"
FT                   /protein_id="ABD05129.1"
FT                   /translation="MLAGESHLWGRRALEFVDAADRLDAPSLVRQFESHIASAGFSAYI
FT                   MAALPAPGAGLAELTLANGWPRGWFELYVGRNYMAVDPVPRHGAATVQPFEWSDAPYDR
FT                   KRDRAAHQVMTDAAEFGLVRGYCIPLHYDDGGAMISMAGEAPDLDPTAKGAMQLIGVYA
FT                   HNRLRSLNRPKPQRRLLTSRECEILSWAAQGKTAWEISMILRIAERTVKFHLIEASRKL
FT                   NAVNRTAAVAKALSLGLIRL"
FT   gene            complement(462324..463265)
FT                   /locus_tag="RPB_0419"
FT   CDS_pept        complement(462324..463265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0419"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05130"
FT                   /db_xref="GOA:Q2J330"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J330"
FT                   /protein_id="ABD05130.1"
FT                   /translation="MTLKVAVQMDPIARINIRGDSTFALLLEAQKRGHAISYFTPDKLS
FT                   LRGTDVVASAQSLSVRDLEGDHFTLGEPERIDMRSFDAVLLRQDPPFDLAYITSTHLLE
FT                   RIHPQTLVVNDPASVRNAPEKLFVMDFAELMPPTLISRNLDEINAFRAEHGAVVMKPLH
FT                   GHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAAATDLSERERAICATLGPKLRERGLLLVGIDVIDGYLTEI
FT                   NVTSPTGIRAVARLGGPDIAARVWDVIEQKRS"
FT   gene            complement(463349..463735)
FT                   /locus_tag="RPB_0420"
FT   CDS_pept        complement(463349..463735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0420"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05131"
FT                   /db_xref="GOA:Q2J329"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J329"
FT                   /protein_id="ABD05131.1"
FT                   /translation="MAKTKHPPAPDRVAAFQTGISAETRAAAYLMAKGYRILARRFKTP
FT                   CGEIDIVAQRRQLIAFVEVKARARLDDAAYAVTPRQQQRIIAAAEAWLMANPDHATFEL
FT                   RFDAVLVAPKRLPQHLPAAFDASP"
FT   gene            complement(463722..464696)
FT                   /locus_tag="RPB_0421"
FT   CDS_pept        complement(463722..464696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0421"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05132"
FT                   /db_xref="GOA:Q2J328"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J328"
FT                   /protein_id="ABD05132.1"
FT                   /translation="MAMRAKTVSSADPVSIPEPDVRTFLVAGQKLTARRASPGLHLVAT
FT                   PIGNLGDITLRALETLAGVDVVACEDTRITHRLIERYGISAQLKPYHEHNAAQARPKIL
FT                   EKLAQGGSVALVSDAGTPLISDPGYKLVREAYDAGHEVIALPGASAVLAALALAALPTD
FT                   RFFFDGFLPSKQGARRARLNELAAIDATLVLFEAGSRIHNSLRDLAEVLGSRDAAVCRE
FT                   LTKLHQEVRRAPLATLAETAETLDTRGEFVVVIGPPDPNAQAMTQDALDDWLRDALQRD
FT                   SVKDAVAQAVEISGRPRREIYARALELARQREAGNDESCDGED"
FT   gene            464874..466073
FT                   /locus_tag="RPB_0422"
FT   CDS_pept        464874..466073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0422"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05133"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J327"
FT                   /protein_id="ABD05133.1"
FT                   /translation="MAELRDRNTTSLRTSRRTAVGLILGAPLLGACSGMQQTLSSQFGQ
FT                   QPTAPEAAQQSQSVGNGRVKVGLVLPLSAAGNAGVAAQSMKNAAEMALAEFNNPDIQLL
FT                   VKDDAGNPQGAQAATQQALDEGAEIMLGPLFAQSVPAAAQLTRARGISMIAFSTDSSVA
FT                   GRGVYLLSFLPESDVNRIIGYASSVGKRSYAALLPDNAYGGVVEAAFKQVVGTKGGRIA
FT                   AFEKYGADRAGPARTIAQALSGADSLLLADDGDALASVSEALTAAGADLRRVQLLGTGL
FT                   WDNPRVFATPALQGGLYAAPDPSGFRSFSGRYRAKFGQEPVRTATLAYDAVALVAALSK
FT                   TQGAKRFSAEVLTNPSGFAGIDGLFRFRADGSNERGLAVMRVATGGAQAVAGSPKSFGA
FT                   "
FT   sig_peptide     464874..464984
FT                   /locus_tag="RPB_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.911) with cleavage site probability 0.413 at
FT                   residue 37"
FT   gene            complement(466138..467310)
FT                   /locus_tag="RPB_0423"
FT   CDS_pept        complement(466138..467310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0423"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05134"
FT                   /db_xref="GOA:Q2J326"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J326"
FT                   /protein_id="ABD05134.1"
FT                   /translation="MGAESDRAFGVQAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEDR
FT                   FARAFAREIEATAQRIGPRDVTSIFLGGGTPSLMQPQTVGAILDAIGKYWRVAPDVEVS
FT                   LEANPTSVEATRFRGYRAAGVNRVSLGVQALDDASLKTLGRLHTAQEAMEAVAIARAAF
FT                   DRYSFDLIYARPGQTPAMWEAELRRAIGEAAEHLSLYQLTIEAETPFFALHRAGKLQTP
FT                   DESASRALYDVTQSVCAELGLPAYEISNHARPGAECKHNLVYWRGQEYAGIGPGAHGRL
FT                   DIGGTRYAIATEKRPESWLMRVEASGTGVVTDDRLNSEERADEFLLMGLRLAEGIDPRR
FT                   YQALAGRSLDPSRIAILREEGAIAVDADGRLRVTQAGFPVLDAVVADLAA"
FT   gene            complement(467300..467932)
FT                   /locus_tag="RPB_0424"
FT   CDS_pept        complement(467300..467932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0424"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05135"
FT                   /db_xref="GOA:Q2J325"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J325"
FT                   /protein_id="ABD05135.1"
FT                   /translation="MHRRISGQLVIATHNPGKLAEMRELLAPYGIAAVSAGELGLGEPD
FT                   ETGDSFRANARIKAEAAAQAAQLPAFADDSGLAVDALDGAPGILSARWAGEGKDFNAAM
FT                   ARIERLLQERGATTPDRRGAHFVSALCVAWPDGHVEEVEARADGTLVWPPRGSAGFGYD
FT                   PIFLPEGHDRTFGEMTSLEKHGLPPLGLGLSHRARAFVELAEICLGR"
FT   gene            complement(467984..468697)
FT                   /locus_tag="RPB_0425"
FT   CDS_pept        complement(467984..468697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0425"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05136"
FT                   /db_xref="GOA:Q2J324"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J324"
FT                   /protein_id="ABD05136.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREAAAGKQNGRTVEIQRLIGRSLRTIVDL
FT                   QALGERQITVDCDVLQADGGTRTASITGAWVALADCLAWMKTRNMLKGQVMRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIVEVQGTAEKTPFSQDEFLALMALAQ
FT                   KGVARLVDLQKMAVA"
FT   gene            468858..469946
FT                   /locus_tag="RPB_0426"
FT   CDS_pept        468858..469946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0426"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05137"
FT                   /db_xref="GOA:Q2J323"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J323"
FT                   /protein_id="ABD05137.1"
FT                   /translation="MAHHEPIGLIAPNTGLAQLNERSRDIFRQIVESYLATGEPVGSRN
FT                   ISRLISMPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP
FT                   ERQSIQAQLSSVGRAQTVEAALGEALTRLSGLTRAAAVVLTAKSNVRLKHLEFVRLEPE
FT                   RALVILVAEDGQVENRVLALPPGVPSSALTEASNFLNARIRGRTLAEARLELETMLSQD
FT                   RTELDQLTQKVISAGIASWSGGDGEDRQLIVRGHANLLEDLHAMEDLERVRRLFDDLET
FT                   KRGVVDLLGRAESAEGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYTARIVSQMLGG"
FT   gene            470134..470754
FT                   /locus_tag="RPB_0427"
FT   CDS_pept        470134..470754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0427"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05138"
FT                   /db_xref="GOA:Q2J322"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J322"
FT                   /protein_id="ABD05138.1"
FT                   /translation="MTDSNGPKDNNQDQAQAAADPVVSKPYIMPDDPEDGANEALIKEA
FT                   AEARDKMLRTLAEMENLRRRTQKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEAR
FT                   ANADAGLKGLIEGVELTERSLINALEKNGVRKFDPSGEKFDPNFQQAMYEVPDPSVPAG
FT                   TVVQVVQAGFMIGERVLRPALVGVAKGGAKPAPAATNGTDTTA"
FT   gene            complement(470755..471693)
FT                   /locus_tag="RPB_0428"
FT   CDS_pept        complement(470755..471693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05139"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J321"
FT                   /protein_id="ABD05139.1"
FT                   /translation="MRQIARLLAIALVLAATPAAADTVYPRGIRVGVTPMPGMTESKSF
FT                   LGFETADNGVKVLLAELPGPAFGEVEAAFKAVPEGAMGKVKPESLETTAGTAYYTAEEG
FT                   VVGADKVRRYSLIVSGSKAFSGYVAVQVADSAAKTYSDEAVKKMLSSVSVRQQVPVEEQ
FT                   VAQMPFDIRELGDFKTVRTLAPGAALLLADGNEDTGIEGAPFMVLGLIGSVPEQTDDRA
FT                   RFAQQAAATIPGLRDARITTSEPMRIDGLPGFETRIEAVSGKDNTPVTVVQWLRFGNAS
FT                   VAMRVIGSSPRDLWSDAFPRFRKVRDGLKAR"
FT   sig_peptide     complement(471628..471693)
FT                   /locus_tag="RPB_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            472084..473985
FT                   /locus_tag="RPB_0429"
FT   CDS_pept        472084..473985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0429"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05140"
FT                   /db_xref="GOA:Q2J320"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J320"
FT                   /protein_id="ABD05140.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKNSKVIENAEGMRTTPSIVAFSDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLVGRRYDDPMVEKDKKLVPYKIVKASNGDAWVE
FT                   ADGQTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKTKAGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVSYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSDIDKMVKDAEAN
FT                   AAEDKKRREAVDAKNHADALVHSTEKALAEHGSKVAEPERRAIEDALSDLRESLKSDDA
FT                   EVIKAKTNTLAQASMKLGEAMYTQQAESDAAKHAAKDDIVDADFTEVDDDKNNKKSA"
FT   gene            474126..475265
FT                   /locus_tag="RPB_0430"
FT   CDS_pept        474126..475265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0430"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05141"
FT                   /db_xref="GOA:Q2J319"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J319"
FT                   /protein_id="ABD05141.1"
FT                   /translation="MSTTKRCYYETLEVERSADESTLKSAFRKLAMKWHPDRNPGDASS
FT                   EIKFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGMGGGGPGFGAGFASSFSDIFEDLFG
FT                   MAGQRGRGTGRERGADLRYNMEITLEDAYKGKTAQIEIPVSVTCESCSGTGAKAGTKPK
FT                   TCSTCGGAGRVRQAQGFFTLERTCPSCQGRGQIIEDPCPSCTGSGRVTKERTLSVNIPQ
FT                   GVEDGTRIRLAGEGEAGVRGGPPGDLYIFLSLASHAIFQRDGADLHCRVPISMVTAALG
FT                   GEFEVPTIERGKTKVKVPSGTQTGRRFRIAGKGMPVLRSRQVGDMYVQVAVETPQNLTK
FT                   KQQELLAEFEKLSSGATQPEAAGFFSKVKDFFGSRANTP"
FT   gene            475359..475961
FT                   /locus_tag="RPB_0431"
FT   CDS_pept        475359..475961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0431"
FT                   /product="Ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05142"
FT                   /db_xref="GOA:Q2J318"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J318"
FT                   /protein_id="ABD05142.1"
FT                   /translation="MALQSTVRALKKQPRLDDEVRFLRSWIEKPLHMGAVMPSGKLLAR
FT                   TMAQYVDIHSTGPVIELGPGTGAITNALVEHGVEQKRLVLVEYNPSFCALLRERYPQAT
FT                   VVQGDAYRLRDSLWDVLAEPATAVVSGLPLVTKPMLTRMKLIRDSFNLLEPGAPFVQFT
FT                   YSVTPPIPKSLPGVATEASERIWMNIPPARVWVYRKG"
FT   gene            476112..476693
FT                   /locus_tag="RPB_0432"
FT   CDS_pept        476112..476693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0432"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05143"
FT                   /db_xref="GOA:Q2J317"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J317"
FT                   /protein_id="ABD05143.1"
FT                   /translation="MSAVKILVIPGSLRTGSHNARLAAAAAHEFARADVDVTRLSLADF
FT                   PLPIYDGDFEAKSGVPIHAINLKRMIGSHHGVLIVSPEYNSAPPALLKNAIDWVSRVQD
FT                   PHETQGQVFRERAFALASASEGKLGGARCLAALRLILSGCRAPVIPNQLALSFAHQAYD
FT                   EADHLKLPADVAAMQAMVRQLIDFAQQMMR"
FT   gene            476700..477407
FT                   /locus_tag="RPB_0433"
FT   CDS_pept        476700..477407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0433"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05144"
FT                   /db_xref="GOA:Q2J316"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J316"
FT                   /protein_id="ABD05144.1"
FT                   /translation="MAQADPADRDRLIVALDVPSVDAAKAMIDKLGDSVGFYKIGYQLA
FT                   YAGGLALVPQLVDAGKKVFVDLKLHDIGNTVARGVESLTALGATFLTVHAYPQTMRAAV
FT                   EARGTSGMKILAVTVLTSYDDADLTDAGYALGVRDLVEARARQALAIGVDGLVCSPEEA
FT                   AHLRGIIGPRMALVTPGIRPAGSAAGDQKRIMTPARAIAAGASHLVVGRPVMEAADPKQ
FT                   AAEAIVAEIAQAK"
FT   gene            477426..477737
FT                   /locus_tag="RPB_0434"
FT   CDS_pept        477426..477737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0434"
FT                   /product="Protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05145"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J315"
FT                   /protein_id="ABD05145.1"
FT                   /translation="MAKGYWVARIDVHDLDGYKRDYVAHNGVVFAKYGAKFLTRGGTYE
FT                   AHEGPSRSRNVVIEFADYATALACYHSPEYQALIKARAPYSQGEIVIVEGYDGPQPQA"
FT   gene            477818..478633
FT                   /locus_tag="RPB_0435"
FT   CDS_pept        477818..478633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0435"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05146"
FT                   /db_xref="GOA:Q2J314"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J314"
FT                   /protein_id="ABD05146.1"
FT                   /translation="MSDMRLIVAGAGGRMGRALTRAISETKGVVLTGALEAPGSELLGQ
FT                   DAGVLAGLPANGVELSADLWTLSANADGILDFTVPGATIANVAIAAQRGIVHVIGTTGL
FT                   SSSDNAVIQSVTRQAIVVKSGNMSLGVNLLAALTKRVAQSLGDNFDIEIVEMHHRAKID
FT                   APSGTALLLGEAAALGRGVDLDSHSARGRDGLTGARKTGDIGFASLRGGTVTGDHSVIF
FT                   AGPYERIELAHKAEDRMIFAHGALKAAQWAHGKKPGLYSMMDVLGLAEF"
FT   gene            complement(478894..480408)
FT                   /locus_tag="RPB_0436"
FT   CDS_pept        complement(478894..480408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0436"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05147"
FT                   /db_xref="GOA:Q2J313"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J313"
FT                   /protein_id="ABD05147.1"
FT                   /translation="MQSRRPVMLVILDGWGWREDPADNAVLQANTPTFDALWTNGPHAF
FT                   LRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIASGEIERAPELLAFIEK
FT                   LRASGGTCHLMGLVSPGGVHSLQDHACALAKILDKAGIPTVLHAFTDGRDTPPQSAVDD
FT                   IARLRADLPPNVPIATVSGRYYAMDRDNRWDRVGKAYKVIAEADGPRFADADAVVAAGY
FT                   ASGVNDEFIVPAVVGDYQGLRDGDGVLCFNFRADRVREILAALLDPAFAGFPRKRVLKI
FT                   AAAAGMTQYSTALDALMRTIFPPQSLVNGLGQVVAATGRHQLRMAETEKYPHVTYFLNG
FT                   GEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVEAINSGKYDLIILNFANPDMV
FT                   GHTGSLPAAIKAVETVDAQLGRIVAAIRASGGALLVTADHGNCEMMRDPVTGGPHTAHT
FT                   TNPVPVLLVGDNGPLADGQLSDLAPTLLKLMDLPQPAEMTGKSLIG"
FT   gene            complement(480510..481406)
FT                   /locus_tag="RPB_0437"
FT   CDS_pept        complement(480510..481406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0437"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada /
FT                   transcriptional regulator, AraC family"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05148"
FT                   /db_xref="GOA:Q2J312"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J312"
FT                   /protein_id="ABD05148.1"
FT                   /translation="MMNLALADHRLTKPGPRDTALADYDAVRRAIAFISQKWKTQPTVE
FT                   AIADAAGLTPDELHHLFRRWAGLTPKAFMQALTLDHAKSLLRGSASVLDAALDSGLSGP
FT                   GRLHDLFVTHEAMSPGEWKSGGAGLTLRYGYHPSPFGTAVVIASERGLAGLAFADPGGE
FT                   EAAFMDLQQRWPRATCIADQAFTAPFAQRVFDPVQWRPEQPLRVVLIGTDFEVRVWETL
FT                   LKIPMGRALCYSDIAHRIASPKASRAVGAAIGKNPISFVVPCHRALGKTGALTGYHWGL
FT                   TRKQAMIGWEAGRLGAG"
FT   gene            complement(481465..481980)
FT                   /locus_tag="RPB_0438"
FT   CDS_pept        complement(481465..481980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05149"
FT                   /db_xref="GOA:Q2J311"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J311"
FT                   /protein_id="ABD05149.1"
FT                   /translation="MTTDSDLDPDRAEPKLFSALLTPHRALSHKAFLVLMGFLGTISFA
FT                   AGLGFWMIGAWPVFGFFGLDLLAIYIAFKVVFARGRATEEISMTPSELRVRRTSPRGQV
FT                   AEWVLNPLWVRLEKIVHAEFGIEQLYLVSSGRRVSVASFLGAEEKASFANALTAALEAA
FT                   RRGPSYQS"
FT   gene            482003..482767
FT                   /locus_tag="RPB_0439"
FT   CDS_pept        482003..482767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0439"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05150"
FT                   /db_xref="GOA:Q2J310"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J310"
FT                   /protein_id="ABD05150.1"
FT                   /translation="MSKITRRVAAPAAPRTAKTTPKSLAANPGQTGGKPAKPPKRPRRW
FT                   TPDEVREAFTRFARANPEPKGELEHLNPFTLLVAVVLSAQATDAGVNKATRSLFAIADT
FT                   PAKMLALGEERVREHIKTIGLFRTKAKNVIALSQKLLSDFGGQVPSTRAELETLPGAGR
FT                   KTANVVLNMAFGQPTMAVDTHVFRVGNRTGLAPGDTPLAVELGLEKAIPPEFMQHAHHW
FT                   LILHGRYTCLARKPRCEVCLIVDLCRWPEKSV"
FT   gene            complement(482994..484511)
FT                   /locus_tag="RPB_0440"
FT   CDS_pept        complement(482994..484511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0440"
FT                   /product="Peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05151"
FT                   /db_xref="GOA:Q2J309"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J309"
FT                   /protein_id="ABD05151.1"
FT                   /translation="MSMSPGFARRVALALILLATTAALAPARAQDASPPATAQSKPAPA
FT                   DAEQHKLPADSTTRHTLALPGRSLSFTATAGSIRLFNDKGEPQADIATTAYQLDNTEAR
FT                   TRPVTFVFNGGPGASSAWLQLGAAGPWRLPMAGDAAVASATPALQPNAETWLDVTDLVF
FT                   IDPVGTGYSRFVASGDDVRKQFYSVDGDVAAIALVIRRWLEKHDRLLSPKYVAGESYGG
FT                   IRGPRVVRNLQTRQGIGVKGLILVSPLLDFREYSGSSLLQYVARLPTMAAAARQRKGPV
FT                   TRADLADVESYARGEFITDLLKGQADQAATQRLADRVAASSGIDPAVSRRLAGRLDTSE
FT                   FQREFDRANGKVTGRFDASVLGFDPFPDSSDAQFSDPSSESLIAPLTSAAMELTRNMLQ
FT                   WRPSGSYHLLNGAVSQQWDFGRGRSPVESVTQLREILAVDPKLQVLVTHGLFDLATPYF
FT                   GSVVAIDQLPPFASKRIRLVTWPGGHMTYARDDARKALRGEVGAMMK"
FT   sig_peptide     complement(484422..484511)
FT                   /locus_tag="RPB_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            complement(484669..486117)
FT                   /locus_tag="RPB_0441"
FT   CDS_pept        complement(484669..486117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0441"
FT                   /product="Glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05152"
FT                   /db_xref="GOA:Q2J308"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J308"
FT                   /protein_id="ABD05152.1"
FT                   /translation="MSALTALSIASEIFPLIKTGGLADVTGALPTALKPHGIAMRTLVP
FT                   GYPAVLGGIENPQQVHSFADFFGGSARLLAARCDELELLVLDAPHLYVRPGNPYVGPDG
FT                   KDWPDNALRFAALAQAGAAIGQGLLLGYAPDILHAHDWQTGLVPAYLAYSGRPAPKCVF
FT                   TIHNLAYQGQFPYELLTRIGLPERAFSLDGVEYYGGIGYLKAGLQLADRITTVSPTYAL
FT                   EIQGPDAGMGLEGLLRLRADRLSGILNGIDTRVWDPTADELIPATYDIETIGARARNKQ
FT                   ALQSRFGLRNAPDALLYGVISRLSWQKGLDMLLDVLPGMLAEGAQLALLGAGDTPLEQG
FT                   FRAAALKYPGQVGAVIGYDEALAHQIQAGADALLVPSRFEPCGLTQLCALRYGAVPVVA
FT                   RVGGLADTVVDANEMAIATGVATGVQFSPVTAQMLAKALTKTAALHADHAAWRNLQING
FT                   MTTDVSWKNPAQHYARLYRELIDA"
FT   gene            complement(486114..487460)
FT                   /locus_tag="RPB_0442"
FT   CDS_pept        complement(486114..487460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0442"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05153"
FT                   /db_xref="GOA:Q2J307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J307"
FT                   /protein_id="ABD05153.1"
FT                   /translation="MVRRCGRIECDELREPERPPATAVMRGFMSNGVTAPLARHAMAYV
FT                   LAGGRGSRLMELTDRRAKPAVYFGGKSRIIDFALSNALNSGIRRIAVATQYKAHSLIRH
FT                   LQRGWNFFRPERNESFDILPASQRVSDDMWYRGTADAVYQNIDIIESYDPKFIVLLAGD
FT                   HVYKMDYEKMLQQHVEQGADVTVGCLEVARSEATAFGVMHVDAKDVIQSFLEKPADPPA
FT                   MPGKPDRALVSMGIYVFDTKFLIEELHRDAANPNSSHDFGKDIIPYIVQHGKAVAHHFD
FT                   KSCRRSHAEDTSYWRDAGTVDAYWAANIDLTDIVPQLDLYDREWPIWTYGEITPPAKFV
FT                   HDKDGRRGEAVSSLVSGGCIISGAALRHTLLFTGVRVHSYSQVEGAVILPYADIARSCR
FT                   LKNVVVDAEVRIPDGLVVGEDPELDARRFRRTDSGICLITQPMIDRLDQ"
FT   gene            complement(487668..489992)
FT                   /locus_tag="RPB_0443"
FT   CDS_pept        complement(487668..489992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0443"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05154"
FT                   /db_xref="GOA:Q2J306"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J306"
FT                   /protein_id="ABD05154.1"
FT                   /translation="MAQEDTQVDTRIHEADLPDSGQTVEYDGAAGGWGSLQGIAQIFGK
FT                   EWNTPTVIETLMRQNKPKGFMCVSCSWAKPADHHTFEFCENGAKATLWELTTKRCTPDF
FT                   FAEHSVTELRNWADYDLEMQGRLTYPMRYDSATDHYVPCSWDEAFQGIAEHLRAIDPAS
FT                   AVFYASGRASLETSYLYALFARLYGHNNLPDSSNMCHETTSVALKKLIGVGVGTVVFDD
FT                   LAKCDAMFFFGQNPGTNSPRFLHPLQEAAKRGVPIVTFNPVRERALESFINPQSPTQML
FT                   TGKETPISSQYHQLRVGGDIAALTGMCKHVFAADDAAKARGDRRVLDVDFIEAHTHGLD
FT                   EFEAKVRATPWQQIEAESGLTRAAIEQAAEVYVKAERVICVYGMGLTQHVHGFDNIAML
FT                   LNLLLLRGNIGREGAGISPVRGHSNVQGQRTVGISEKPELVPLDKMAEQFGFEPPRDKG
FT                   MNTVEACHGLLDGKVHAFIGLGGNFIRAIPDQPVLEKAWSRMQLTVQIATKLNRSHLVH
FT                   GQSAYLLPCLGRTEQDLQATGPQAVTMEDTFSCIQGSIGLRTPASEHLMSELAIVAGIA
FT                   KATLPSNPNVRWDDWVGDYGLVRGLIEESYPEMFHDFNARMFTPGGFYKGNDARERIWQ
FT                   TESGKAEFTTPQMANATGFADAPGRYRLLTMRSNDQFNTTIYGMNDRLRGIEGRRDVLL
FT                   INPDDIARSGLRDGQMVWLQSDAEDGLHREVGPLKVTPFRLPDGCLGGYYPEMNPLIAL
FT                   THHDKESKTPANKSVPVRIRA"
FT   gene            complement(490104..491042)
FT                   /locus_tag="RPB_0444"
FT   CDS_pept        complement(490104..491042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0444"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05155"
FT                   /db_xref="GOA:Q2J305"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J305"
FT                   /protein_id="ABD05155.1"
FT                   /translation="MVEIVTLTPNPAIDLSTSVARMVPSRKLRCAAQQRDPGGGGINVA
FT                   RVVKRFGGDVEAIYPAGGFTGRLLRALLDREQIPSRVVEAVAETREDFSVTESETGQQF
FT                   RFVLPGEALAEGEWRGLLEILGGTDPAPTIVVGSGSLPPGVPHDFYAQAAAVAKRIGAQ
FT                   FFLDTSGDQLIAALAHGVTLIKPNLREMQELAGRPLANDQDYVAAARQQIDAGKVEIVA
FT                   LSLGHLGALLVTKDKALRSPALPVAQVSTVGAGDSFLGAIAFSLAKGRPIEDAFRLALA
FT                   SGSASLTMHGTELCRPADVERLSAEVVIQPL"
FT   gene            491316..492596
FT                   /locus_tag="RPB_0445"
FT   CDS_pept        491316..492596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0445"
FT                   /product="Glycoside hydrolase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05156"
FT                   /db_xref="GOA:Q2J304"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J304"
FT                   /protein_id="ABD05156.1"
FT                   /translation="MARTTRIVLLGASSASFGLSMLRDLFATPELRGSTLVMVGLDAAR
FT                   LATMAELAKLLNATTGAGFVIEHTTDRRAALDGASFVINATAIDRNRLWKMDFEVPKKH
FT                   GIRHPLGENGGPGGLFFTLRTLPLVFDFIRDIEELCPEALFLNYSNPESRIVLALGRYS
FT                   KVRCIGLCHGIFMGRDAVADIMGLPRERVEVWGAGLNHFQCLLQIRDRLTGEDLAPRLR
FT                   AAEQSFDPNAWRFTRRLYRAFGHWLTCSDDHLGEYLAYGWEAGERGYDFAGDDRSRVET
FT                   LAQIDAVLAGTMPIPHWWTEPSGERGAAVIAAMLHDQKRFIESGIVMNRGVIPNLPAEL
FT                   AVEVPVTVDAAGVHPVSLGPLPDPIAKLMLMQASVQQLAVEAAVHASKELALQALLIDP
FT                   VVNSAVAAEKILDELWEINRPYIRACV"
FT   sig_peptide     491316..491399
FT                   /locus_tag="RPB_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.547 at
FT                   residue 28"
FT   gene            complement(492739..493563)
FT                   /locus_tag="RPB_0446"
FT   CDS_pept        complement(492739..493563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0446"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05157"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J303"
FT                   /protein_id="ABD05157.1"
FT                   /translation="MIKDLIVNLERSPSRDEVVNVAIMIARTFDAHVAGVCFAYESLPT
FT                   FTMPDFPSDVLTKMLAENETAARAAVDRFDAACKREGVSAEHRLLETPYGTAGRFPRIA
FT                   RRFDLSVIMQSDPDTADNEVLIEQVLFDSGRPVLIVPYIQKAPLKLDRVICGWDGSRAA
FT                   TRAINDARPLLRRAGAVELLIVRDHKVRDDNELRGIEMANHLARHGIKLDIKMITAPDI
FT                   GVAGAILSHVADCSADLLVMGGYGHSRLREFVLGGVTREMLSSMTVPVLMSH"
FT   gene            complement(493703..494440)
FT                   /locus_tag="RPB_0447"
FT   CDS_pept        complement(493703..494440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0447"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05158"
FT                   /db_xref="GOA:Q2J302"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J302"
FT                   /protein_id="ABD05158.1"
FT                   /translation="MAASGSRHPPISDDATSFAAQRERMVAQQISARGVRDPLVLAAMR
FT                   QVPREAFLPERMRDLAYDDSPLPIGHGQTISQPYIVAAMIEALQLNGGERVLEIGAGSG
FT                   YAAAVLAQIAGEVTTIERIGALADKAAAALAALGIGNVQVRQGDGSRGWPPGAPYDAIV
FT                   VAAGGPHLPQSLKTQLAIGGRLVMPVGADQSAQRLVRLTRTSVDDVRCEQLADVRFVPL
FT                   IGDEGWASVAPEPRADRPATVRK"
FT   gene            494698..495135
FT                   /locus_tag="RPB_0448"
FT   CDS_pept        494698..495135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0448"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05159"
FT                   /db_xref="GOA:Q2J301"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J301"
FT                   /protein_id="ABD05159.1"
FT                   /translation="MSDRLVVCTQCGGVNRLPEQRSALEAKCGKCGAKIFDGHPADVGA
FT                   EIFDKQIARSSVPVLVDVWAPWCGPCRAMAPAYEIAARELEPRVRLIKLNSDNEQQIAA
FT                   KLGISGIPTMILFADGRERARTSGAMPASAIVRWVREHLPG"
FT   gene            complement(495145..495615)
FT                   /locus_tag="RPB_0449"
FT   CDS_pept        complement(495145..495615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0449"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05160"
FT                   /db_xref="GOA:Q2J300"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J300"
FT                   /protein_id="ABD05160.1"
FT                   /translation="MSLDAIDLKILAELQADARIPNLTLAERVGLSPSPCSRRVRLLEQ
FT                   AGVVAGYRALIDRAAVGLSVTAFAGIRVERHSRDNAEAFIAAVRDMPEVIACHLVSGDA
FT                   DFLLEVVVPDIAAYEATVLRGLLALPTVRDIRTSFAMRSDKLDGPLPLPKPA"
FT   gene            495742..496941
FT                   /locus_tag="RPB_0450"
FT   CDS_pept        495742..496941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0450"
FT                   /product="methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05161"
FT                   /db_xref="GOA:Q2J2Z9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006237"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z9"
FT                   /protein_id="ABD05161.1"
FT                   /translation="MSDLSNRHLPNSLGFATRAIHHGYDPQAHLGSLNPPVFLTSTYAF
FT                   DSAAEGAARFAGEAEGFIYGRVGNPTVAVLERRLAELEGGEAALATSSGVGALTALVWT
FT                   LLASGDEIVADQMLYGCTFGLFEHHLPRFGIRVRFADLTDPAGLEAALSPATRMVFTET
FT                   PSNPNMRVVDIAAIAAITRRAGALFVVDNTYCTPYLQRPLELGADIVTHSATKYLGGHG
FT                   DLLAGAVVASQEIIDRLRFTGIKELNGACISAFDAFLILRGLKTLTLRMDRHSATAAKL
FT                   ARDLEAHPAVAAVYYPGLDSHPQHALAQRQMRQMGGMIALELKGGLPAGRALMDNVKIA
FT                   TRAVSLGDAETLIQHPASMTHATYDPDERARHGFTDGLIRISVGLEDYEDLRGDLLGAL
FT                   "
FT   gene            497119..499653
FT                   /locus_tag="RPB_0451"
FT   CDS_pept        497119..499653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0451"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05162"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z8"
FT                   /protein_id="ABD05162.1"
FT                   /translation="MTVQRASLRQPHAREARGWHQEWSLRRAMRMARIGYWESYSAAAT
FT                   DFWISPEFASLFDFQTSKGSVPVDAMQQRRLADSRDVLHVHYAACWAEGRPFAVETKLV
FT                   TSDGRQLDCVVHGEAEFDASGRVQRVFGAVRDVTPETSAHRRLAESEQRLADFVGTASD
FT                   WCWETGPDHRLLPHPDLIDGNAALQTVASGGKARWELSYAPDEQDAMARHKADMEAQRP
FT                   FRDFVYTSIGSDGSRISICTSGKPIFADDGSFLGYRGTASDITQLEVARALLDQRTRAL
FT                   EEAQRLGRIGTWNHRLDTGRTVWSPELYHLLGLDPAAFDPTYDGTKAYFLDDAAERMLE
FT                   IQKRVVRTGTTEAADIRILHGDGTPRDMAIICKAEIRDGKVVGLIGTAQDVTDRKEAER
FT                   RLELLAYTDPLTGLANRALFKRKLAGLFEQPISGDGRNALLLIDLDRFKEVNDSLGHST
FT                   GDSLLIHVASVLRQELDPQAFIARIGGDEFAVLTNGQCASADDPIALADRLIAKLSVPV
FT                   ELAEGEACIGATIGVAILPEHGATAEKASRNADLALYMAKEAGRGRAQLFEPIYAEAVD
FT                   QRLDLGRRLRQAVESGGLTTHYQPQIDLKTGRVSGFEALLRWSHPERGPISPSEFIPVA
FT                   ESTGLIVQLGHWVLRDACRQMRAWLDAGLPPRSMSVNVSPAQIWNGDFEAVVAAVLAET
FT                   GLPAELLCLELTENLFVDHTKQKVSSTLAALSKLGIQLALDDFGSGYSSLGYLTRLPFN
FT                   CLKIDRSFVDGIATVPEKRKLLGGIIALSHGLGMSVVAEGAELAAEVDLLTGFDCDFVQ
FT                   GYVFSPPITADQAPLVAAGIERDAEGMKARRA"
FT   gene            complement(499705..499980)
FT                   /locus_tag="RPB_0452"
FT   CDS_pept        complement(499705..499980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0452"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05163"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z7"
FT                   /protein_id="ABD05163.1"
FT                   /translation="MARTIRKSGVKQVPLSEVKDDLSRYLREAETREIVITRHGKPAGV
FT                   LIGFESEDAWFDYRLENDPRFQQRIEQARSSLKEGRGVRIEDVETD"
FT   gene            complement(500043..500117)
FT                   /locus_tag="RPB_R0007"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(500043..500117)
FT                   /locus_tag="RPB_R0007"
FT                   /product="tRNA-Glu"
FT   gene            complement(500438..500773)
FT                   /locus_tag="RPB_0453"
FT   CDS_pept        complement(500438..500773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05164"
FT                   /db_xref="GOA:Q2J2Z6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z6"
FT                   /protein_id="ABD05164.1"
FT                   /translation="MTETALPEPTPEQAALFARVRRMMMIAGLTTALALAAVLIAIGYK
FT                   LFRAEGSAPVAAEQTLRLPKGAKVVSTGTAGDHIVVTLDVGGATEIRTFDARTMKPAGR
FT                   LTFATEP"
FT   gene            500831..501805
FT                   /locus_tag="RPB_0454"
FT   CDS_pept        500831..501805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0454"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05165"
FT                   /db_xref="GOA:Q2J2Z5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z5"
FT                   /protein_id="ABD05165.1"
FT                   /translation="MVVAGDEGSSRLDRVLATRCPALSRSRLKVLILDGRVAIAGSAVR
FT                   DPAYHASPGETITIDVPPPVAPEPEGEAIALEIVHEDDDIIVINKPRGLVVHPAAGHET
FT                   GTLVNALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGR
FT                   TGELRRGYYAFVWGVPNRARGTIEAPIDRHPYAREKMAVRDGGREAITHWEVLETFTGR
FT                   SGGEIVSLIACQLETGRTHQIRVHLAHLGHPLLGDDVYGPHFKTKASQLSPAARAALAD
FT                   LGRQALHAYLLVLEHPSSGEVMAWESGLPADLARLKAALSATE"
FT   gene            502023..502922
FT                   /locus_tag="RPB_0455"
FT   CDS_pept        502023..502922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0455"
FT                   /product="sigma 32 (RpoH)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05166"
FT                   /db_xref="GOA:Q2J2Z4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z4"
FT                   /protein_id="ABD05166.1"
FT                   /translation="MARAATLPVLNGESGLARYLAEIRKFPMLEPQQEYMFAKRWREHD
FT                   DRDAAHHLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPDKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDMHPDQVKLIA
FT                   KRLGVTEQDVIDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPNQEAVMAEHEELDH
FT                   RRAALNGAIGVLNPRERRIFEARRLADEPMTLEDLAAEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEQAALEAAH"
FT   gene            complement(503151..503513)
FT                   /locus_tag="RPB_0456"
FT   CDS_pept        complement(503151..503513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05167"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z3"
FT                   /protein_id="ABD05167.1"
FT                   /translation="MADIMSVLASGYTAAGLLNPSKTPYVNVDAKLYEGTWSGTYSNTK
FT                   KFAITVSNVQGFRAQVKYQSEGTIKYQTVLIKDGSFRIGDSKFTLGSNGSASIRTAITD
FT                   PVTSQTSLITGTAKRD"
FT   gene            complement(503622..504548)
FT                   /locus_tag="RPB_0457"
FT   CDS_pept        complement(503622..504548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0457"
FT                   /product="Beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05168"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z2"
FT                   /protein_id="ABD05168.1"
FT                   /translation="MTSPSSPQIPSQVSSPRIRAFFDAPTNTISYLVSDPATRRAAVID
FT                   PVLDYDHRDGSVDVRSADAILQAARDDGLTIDWVLETHAHADHLSGAPYIKAKTGARIG
FT                   IGEHIKDVQRIFRPMFNADDLRTDGSDFDHLFKDGERFSIGDLPVEVLHTPGHTPADIA
FT                   YRIGDDAVFVGDTLFMPDYGTARADFPGGDAHQLYRSIQKLLALPPQTRLFMCHDYKAP
FT                   GRDDYAWETTVQAQRDGNVHLRGGVSEQQFVDMRNARDATLSAPTLLLPSIQVNIRAGR
FT                   FPKAQQNGVHYLLLPVHARPGAEAGLS"
FT   gene            504642..505445
FT                   /locus_tag="RPB_0458"
FT   CDS_pept        504642..505445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0458"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05169"
FT                   /db_xref="GOA:Q2J2Z1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z1"
FT                   /protein_id="ABD05169.1"
FT                   /translation="MLTGITSADLITVASGGLVGFILALIGGGGSVLAVPLLVYVVGVR
FT                   SPHVAIGTSAIAVAISALANMLSHWAAGHVRWACALVFSAAGIGGAFAGSSVAKQIDGQ
FT                   QLLVLFGVLMIVIGVLMSRGRAGGGDPTIRLTMATAKAMLPKLIGTGFGVGVLAGFFGI
FT                   GGGFLIVPGLILATGMPLTYAIGSSLVAVFAFGASTAASYALSGLIDWRLAGFFIGGGL
FT                   AGGLIGIGAGKLIGTHDKALRAVFSAVVVIVGLYVCARGVMVFLS"
FT   sig_peptide     504642..504746
FT                   /locus_tag="RPB_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.890 at
FT                   residue 35"
FT   gene            505623..506765
FT                   /locus_tag="RPB_0459"
FT   CDS_pept        505623..506765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0459"
FT                   /product="endonuclease/exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05170"
FT                   /db_xref="GOA:Q2J2Z0"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Z0"
FT                   /protein_id="ABD05170.1"
FT                   /translation="MDYTGLRPRSGAEQRRQTDADRARTVDSLTALRAGLRQLPPKGPG
FT                   NFLLATWNIREFGGNKFRGRIDDALYCIAECISRFDLVAVQEVRQDLVALKRVMRLLGR
FT                   DWDYIYTDVSFADAGNGERLAFVFNRSRVRFTGLAGELVLPSKAATELVAQIARTPFLC
FT                   GFQSGWAKFNLCTVHIYYGEGKKDDPKRIEEIDLTAKLLADKAKSYVNLETSADYSPEN
FT                   LVLLGDFNIFGREDATFQALTENKFVIPEPLLRQTKGSNVAQDKFYDQIAFFKETRGIK
FT                   AISAGVFDFYKYVFNDPKLYKDVMPPKAAFNTWRTYQMSDHLIMWTEFDVDKTDLYLKS
FT                   LAREHSGETAAGGAATTAKKKTTKKVAKKVAKKARKAPAE"
FT   gene            507029..507904
FT                   /locus_tag="RPB_0460"
FT   CDS_pept        507029..507904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y9"
FT                   /protein_id="ABD05171.1"
FT                   /translation="MRNTMLTSFVSALLAVAASVTVAAAADGAIDNGALAKSEFRDHAR
FT                   TFGLVYTLPKTVNDVLDATIRGPLKEKLLNAKLDTEAQMHNIPHVTVVHIHNADPATPE
FT                   KMLAALPKLPPVLDVTLKTFYTTEAAKGAGHPWWLDLGIVKEGKSFEEMMAFNTAATAA
FT                   LAPLRDGPLPRCTGPVYAVMSDAAKDLVRTVGVSGVNVVKDGKELRSHNPHNTLVYSMA
FT                   KFTPELQAQMNQAAKEFNQILPDGIPTSFKSVSIVELGFAGNVLREIYRISLEDGSVLN
FT                   VATGKMASLK"
FT   sig_peptide     507029..507106
FT                   /locus_tag="RPB_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.654 at
FT                   residue 26"
FT   gene            complement(508024..509637)
FT                   /locus_tag="RPB_0461"
FT   CDS_pept        complement(508024..509637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0461"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05172"
FT                   /db_xref="GOA:Q2J2Y8"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2Y8"
FT                   /protein_id="ABD05172.1"
FT                   /translation="MQETGVHNGAHGADKFGLKNLKGVYWNFAAPQLYEHALKNGEAVL
FT                   SADGALCADTGEFTGRSPKDKFTVRDATTETTMWWGGNQSITAEQFETLYQDFLKHAEG
FT                   MTLFAQDLYGGADPSFQIKTRVFTELAWHSLFIRTLLRRPDRAALESFVPELTLIDLPS
FT                   FRADPKRHGCRSENVVAIDFARKIVLIGGTQYAGEMKKSVFTTLNYYLPEKGVMPMHCS
FT                   ANVGPQGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLS
FT                   PEAEPEIFAASSRFGAVLENVVLDEITRKPDFDDGSKTENTRSAYPLESIPNASLTGRA
FT                   GQPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPEPEFSTCFG
FT                   SPFLPRDPSVYGNMLRELIAKHDVDCWLVNTGWTGGIYGTGHRMPIKVTRALLTAALDG
FT                   SLRNVEFRTDPYFGFAVPTSLHGVPSDILDPVKTWADKAAFDATARKLVGMFQKNFAKF
FT                   EAQVDADVRAAAPDVKMAAE"
FT   gene            complement(509825..510559)
FT                   /locus_tag="RPB_0462"
FT   CDS_pept        complement(509825..510559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0462"
FT                   /product="Pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05173"
FT                   /db_xref="GOA:Q2J2Y7"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y7"
FT                   /protein_id="ABD05173.1"
FT                   /translation="MQPTAEFDPAKVAKSLLRRRREGALATLLRDGGAPYCSLVNLASA
FT                   PDGSPVLLISRLAVHTRNLLADPRVSLMLDERAAGDPLEGARIMLQGVASAAAPADLPQ
FT                   LRRRYLAAHPGAADYIDFTDFALYRIETSSAHLVAGFGRIVDLEPSAYLTDLDGAASLL
FT                   DAEESAVEHMNADHLGTMNLYATRLLGAASDDWRCNGLDPEGVDLAAGRTTLRLSFPER
FT                   VTTPAALRHMLKRMADIARETE"
FT   gene            510770..511471
FT                   /locus_tag="RPB_0463"
FT   CDS_pept        510770..511471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0463"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05174"
FT                   /db_xref="GOA:Q2J2Y6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y6"
FT                   /protein_id="ABD05174.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTSP
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRSAPKDPAAAPKETDAKALDRGLLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDDDFEMIET
FT                   LYGVGYRFKET"
FT   gene            511624..513423
FT                   /locus_tag="RPB_0464"
FT   CDS_pept        511624..513423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0464"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05175"
FT                   /db_xref="GOA:Q2J2Y5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y5"
FT                   /protein_id="ABD05175.1"
FT                   /translation="MLDRTAADQEARDGDDAAAQDETATRARPWQRPFAWVRRAGQFFF
FT                   TLSFSSLTRRILSLNLAGLMALSASILYLSQFRAGLIDARAQSLLVQAEIIAGAIAASA
FT                   TVETNTITIDPDRLLDLKPGETYGPPDEYAVLDFPINPERVAPVLRRLISPTKTRARIY
FT                   DRDGVLILDSRSLYGRGDVMRFDLPPPTAEKPGFVERAMIAIRTWFNRGDLPLYRELGP
FT                   ENGNGYQEVADSLKGQKNSMVRINDRGEVIVSVAVPVQRFRAIHGALMLSTQGDDIDQM
FT                   VTAERLAILKIFGLAAIVMFVLSVLLASTIAGPVRRLADAAERVRRRIRARVEIPDFTT
FT                   RRDEIGHLSGALREMTDSLYNRIEAIERFAADVSHELKNPLTSLRSAVETLPLAKNANS
FT                   RSRLLAVIEHDVKRLDRLISDISDASRLDAELQRQDAAPVDLRRLLTTLTLVANETRLG
FT                   NNALVEVRFEGPPNEPFSVPGHDSRLGQVISNLLSNAQSFSREGGKVQIVCRRRKTEIE
FT                   IVVDDEGPGIRDDAFDKIFERFYTDRPHQGFGQNSGLGLSISRQIVEAHGGKIRAENRP
FT                   GPRDAEGEPTIAGARFVVRLPST"
FT   gene            513420..513947
FT                   /locus_tag="RPB_0465"
FT   CDS_pept        513420..513947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0465"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05176"
FT                   /db_xref="GOA:Q2J2Y4"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y4"
FT                   /protein_id="ABD05176.1"
FT                   /translation="MTAPGAPSIHASAVRVGDRAVLIRGPSGSGKSRLAFGLIVAGRAG
FT                   QIPPVELIGDDRVFLEQRDGRLRVRPVPGLAGMIEVRGLGLRRVPAAPEAVVGLVVDLA
FT                   AEDAARLPEAAALRMMLEGVELPRVPVGPGYDPLPLVVAALTTGDAIAPGTQLDDCRKD
FT                   FGNHMSHTIVTE"
FT   gene            514079..514480
FT                   /locus_tag="RPB_0466"
FT   CDS_pept        514079..514480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0466"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05177"
FT                   /db_xref="GOA:Q2J2Y3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y3"
FT                   /protein_id="ABD05177.1"
FT                   /translation="MIGLVLVTHGRLADEFKAALEHVMGPQKQIEAVTIGAEDDADLCR
FT                   SDIIEAVNRVDSGDGVAILTDMFGGTPSNLAISCMSRPKVEVLAGINLPMLVKLAKVRE
FT                   ERALPDAIALAQEAGRKYVTIASRVLAGK"
FT   gene            514477..514803
FT                   /locus_tag="RPB_0467"
FT   CDS_pept        514477..514803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0467"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05178"
FT                   /db_xref="GOA:Q2J2Y2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y2"
FT                   /protein_id="ABD05178.1"
FT                   /translation="MTADVPQPATDAQAGTTAGKISREIPVINKRGLHARASAKFVQMA
FT                   EKFQADVTVTRNGETVGGTSIMGLMMLAAGIGTTVTVSATGPEAQQAVDALAQLMASKF
FT                   GEDE"
FT   gene            complement(514959..516500)
FT                   /locus_tag="RPB_0468"
FT   CDS_pept        complement(514959..516500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05179"
FT                   /db_xref="GOA:Q2J2Y1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Y1"
FT                   /protein_id="ABD05179.1"
FT                   /translation="MTSIATSRARLSLIARWIDALLDPKRQERTVILSLAVYAAIWTAY
FT                   RTIATWPRDLHADETELYAWSQHLAFGTDKHPPFSAWVARAWFSVVPVSDLTFHLLATV
FT                   NIAVTLYIAWRTMRRYMTAEKALFGLATLTLIPFFNFIALKYNANAVLLPLWALTIHGF
FT                   LRAFEQRGWLWPTLAGVFAGASMLGKYWSIVLVGSLGLAALLDRRRARFFASPAPWLMI
FT                   VAGGLVLAPHVAWLVEHRFPTFAYAAAREADGLGHNALDTLRYLAGCVGYAALALIATW
FT                   LLLRPSRAALIESVWPADPQRRLIVTIQVLMIVAPAPVALVTGIRIVPLWTMPAWTLLP
FT                   IVLLSSPLIAVGRDALRRMLIGAAALALTILAAAPGVAVAIHSSSPPEPFEYASLLADD
FT                   IARVWQRHTDRPIALVAGETVLAQNTAYYLRTDSRAFATADLATLKADAAARGAALVCP
FT                   AADQSCLSVAEQIVAAQPQILRSKVWLSRPLLGIAGGTVQDVFFLVLPPSATGKT"
FT   gene            516521..518455
FT                   /locus_tag="RPB_0469"
FT   CDS_pept        516521..518455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0469"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05180"
FT                   /db_xref="GOA:Q2J2Y0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2Y0"
FT                   /protein_id="ABD05180.1"
FT                   /translation="MRGGHQPVRSSPSSTAKAAVFRAVAGALRLAAPESRCYLATMTTA
FT                   PIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKA
FT                   QTVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLAN
FT                   VYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLE
FT                   AIVTRLPPPQGDRSAQLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYD
FT                   LERVGYFTPKMTSVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAI
FT                   PVVFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEII
FT                   QERLSREFDLNLIATAPSVIYKMTLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILT
FT                   PDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFD
FT                   YHLTEYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPI
FT                   QAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEA
FT                   FIAALKVDS"
FT   gene            complement(518459..519280)
FT                   /locus_tag="RPB_0470"
FT   CDS_pept        complement(518459..519280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X9"
FT                   /protein_id="ABD05181.1"
FT                   /translation="MAKAKTPTRRFSTDKTAVSENSIRRELDWAGDRSVVEKGSATDKK
FT                   NYAEGLSRALSQRFADALRKSFDGILPNPDGLGQESKARTGKGLKKLDVNYSTVELGLG
FT                   LGVSIKTINFRDAKTKRYTKNYTRVDNELRAEAADYHERQPYSVLCAVVFIPLDACNDG
FT                   GTAPSSFGQAVQIFRYRAGREKPVDDTTLFERILIGLYDAEPASFGVTGFFDVMDAPPR
FT                   TGRPSSLMTFEQAIGTIVEAYDARNKSAFKWAEGDTEILAAPGREDDDDEV"
FT   gene            complement(519284..519703)
FT                   /locus_tag="RPB_0471"
FT   CDS_pept        complement(519284..519703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0471"
FT                   /product="putative patch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05182"
FT                   /db_xref="GOA:Q2J2X8"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X8"
FT                   /protein_id="ABD05182.1"
FT                   /translation="MSSTACETPVDPARSALMRRVRQKRTRAEDDVADVLRELGLRFRR
FT                   NVRTLPGSPDFANKTHHWAIFVNGCFWHRHQGCHRTTTPTRNREFWLAKFAANVKRDKI
FT                   KTRLLRAMGFRVVTIWECETRTPTKVRRRLKGLMR"
FT   gene            complement(519700..520872)
FT                   /locus_tag="RPB_0472"
FT   CDS_pept        complement(519700..520872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0472"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05183"
FT                   /db_xref="GOA:Q2J2X7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X7"
FT                   /protein_id="ABD05183.1"
FT                   /translation="MKIAGLFAGIGGLELGLHRAGHETVILSEIWQPAGAVLEHRFKGA
FT                   PNVGDVATLTSLPSEVELMTAGFPCQDLSQAGKTAGIKGGKSGLVTHVFRLIDRSRPKW
FT                   VLLENVSFMLRLDGGSAMTRLVSEFERRGYRWAYRVVNSLSFLPHRRARVFFLASIEGD
FT                   PADVLLVDDAEPAGLQTSLQSHAHGFYWTEGTRGLGWGPDCVPTLKNGSTVGIPSPPAI
FT                   LMPNGEIVTPDIRDAERLQGLPADWTKPAERVARASFRWSLVGNAVSKPVAAWIGQRLN
FT                   APGAYDRSRDGGSVVRGDWPKAARSDGKACREVAISEFPKWAKRPSLQDFLRYEPRLLS
FT                   ARATAGFLSRIEKSSLRFVPGFKDRVRSHLDHVRAIDAFVQEGRTLLAAE"
FT   gene            521031..522848
FT                   /locus_tag="RPB_0473"
FT   CDS_pept        521031..522848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0473"
FT                   /product="(Isocitrate dehydrogenase (NADP+)) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05184"
FT                   /db_xref="GOA:Q2J2X6"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2X6"
FT                   /protein_id="ABD05184.1"
FT                   /translation="MTATRHPFASDIDAATRIAEPDFDLLDALVRTDDPDDQAHTLARV
FT                   VLAAFDNYYAVSRRIPALAQAAFEARDWAATVRLSKIRLGLYTACIDQLVPLLKAGLPE
FT                   LANDEQLWARAEAELLAAIAERYEADFAFAFWQSLRRKLVSDEWRPVSYDTGPAARPKA
FT                   TSAAILKTIATTLPIRPAVIRDILDGAGLRGPWRDRDGDAALAAAAIEAALEPLGPRAG
FT                   ETAKIEIAESGFFRNRGACLVGRVRLRDRGDMPMRNLPLLIALLNEDDGLVVDAVLCDA
FT                   DELQYAFSSTLANYHATNPHYHELARLLHELMPKRPLGTQYSCIGFHHLGKVAVMTEIL
FT                   AEHRRSKEKLDTAPGFKGTVAIAFTMPSSAYVLKIIRDHPTDDYKFDYFDGLDAVLRKY
FT                   NLVHEIDRAGSMLDNIIYSNVKLERTMFAPDLLDELLESGIDTVTLERGALVFRHLIVQ
FT                   IKLTPLPLYLTTASAADARAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIRKVYLFD
FT                   YDAVEPLTDVRVRGDDAPPGPEFEDGVVFRPADMLGGLRIDDPALRRAFRDAHPELMQP
FT                   EYWQGMQRALRAGKVPRVMNYPAARRLRR"
FT   gene            522972..523718
FT                   /locus_tag="RPB_0474"
FT   CDS_pept        522972..523718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0474"
FT                   /product="Protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05185"
FT                   /db_xref="GOA:Q2J2X5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X5"
FT                   /protein_id="ABD05185.1"
FT                   /translation="MLDAAIKALTQILSPPMRSILWRSIGFALALIAVAAIGLQRLLSW
FT                   AATSSELWAEAALGGFQTPLNILSWVLSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVEREYYPHEEPGVALPVGVALIETIKTALLTILVYLIALPFLFFAGAGVIVFFVATG
FT                   WLLGREYFELAAMRFRPAAEAKAMRRDNATTVFIGGLVIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRMSGSRPELIAPERREIGAR"
FT   sig_peptide     522972..523112
FT                   /locus_tag="RPB_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.893 at
FT                   residue 47"
FT   gene            complement(523766..524017)
FT                   /locus_tag="RPB_0475"
FT   CDS_pept        complement(523766..524017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05186"
FT                   /db_xref="GOA:Q2J2X4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X4"
FT                   /protein_id="ABD05186.1"
FT                   /translation="MNAENFGSQSCKSFQYSSQHTPELTGGGHRQRSRRITGDLVPNGR
FT                   DAMKMSHLANFLLMIVGGAAQEVAVAVKRRWRRDDRAP"
FT   gene            524269..525261
FT                   /locus_tag="RPB_0476"
FT   CDS_pept        524269..525261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0476"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05187"
FT                   /db_xref="GOA:Q2J2X3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X3"
FT                   /protein_id="ABD05187.1"
FT                   /translation="MRRRWCHRRNNENNAMMRALNDNAPPPRSPLAKPRWDIEGRDWPN
FT                   RDASRFVHAAGLRWHVQESGRGPVLLLIHGTSAATHSWRRLAPLLAEPFTVVAPDLPGH
FT                   GFTETPAAARMTLDAMAQDLATLLRGLDHAPAVVAGHSAGAALLARMCLDGSIAPAGLV
FT                   ALNGALLPIGGAAGRVMLPLARLLASSALVPRLLARFAGNPGMVERMLADTGSSIEPEG
FT                   IDYYRRLVRSPGHVAAALRMMASWRLERTAQQLPQLATRLLLIAGSNDKTIAASNSARV
FT                   QRMVPGAGIAVMPGLGHLAHEERPHDVRDIMVEFARDAGLLPRSLAAAE"
FT   gene            complement(525292..526290)
FT                   /locus_tag="RPB_0477"
FT   CDS_pept        complement(525292..526290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0477"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05188"
FT                   /db_xref="GOA:Q2J2X2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X2"
FT                   /protein_id="ABD05188.1"
FT                   /translation="MSSAATASLKSTAAAPAHQPGRGRVYDSVADAYGDTPLVRLNRLP
FT                   GLNGVNATILAKLEYFNPASSVKDRIGAAMIAAMERDGIIKPGTILIEPTSGNTGIALA
FT                   YVAAAKGYRLKLVMPESMSIERRKMLAFLGAELVLTEAAKGMKGAIAKAEELIASTPNA
FT                   VMPQQFKNLANPEVHRRTTAEEIWNDTNGAIDIFVAGVGTGGTITGVGQVLKPRKPSVR
FT                   IVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDRSVIDEIIKVAGPVAIETSRALAR
FT                   HEGIPGGISSGAAIAAAIELGKRPENAGKTIVAIVPSFSERYLSTALFEGV"
FT   gene            526575..527132
FT                   /locus_tag="RPB_0478"
FT   CDS_pept        526575..527132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0478"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05189"
FT                   /db_xref="GOA:Q2J2X1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X1"
FT                   /protein_id="ABD05189.1"
FT                   /translation="MNAHVSHGGWPVLVLNADFRPLSYYPLSLWSWQDAIKAVFLDRVN
FT                   IVAHYDRAIHSPNLEIQLPSVVSLKSFVKPSTHPAFTRFNVFLRDRFSCQYCGAPEDLT
FT                   FDHIIPRSKGGQTTWENVVAACSPCNLRKGNMTPAQARMFPRQTAFAPTVHQLHRNGRL
FT                   FPPNYLHESWLDYLYWDTELDP"
FT   gene            527607..528389
FT                   /locus_tag="RPB_0479"
FT   CDS_pept        527607..528389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0479"
FT                   /product="Secretin/TonB, short-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05190"
FT                   /db_xref="GOA:Q2J2X0"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2X0"
FT                   /protein_id="ABD05190.1"
FT                   /translation="MSRQHVPDDRRGGATRSLMARLAALGSKPRSRLGFAASATVATIA
FT                   GTWVASLELVKAASAPSTPSIIAFDIAAQPLSSALDAFSAVTGLQLVYDGALAQGRRSN
FT                   AVFGTMSPQEALRGLLAGSGLMPVRGSDAFTVIPSDAAGPPKQTLAGLMPYLGAMQASL
FT                   ASAFCRLPETRPGSYATTLEFWIGPSGQILKPHLFGSTDPARDQAIVRLLGDLSIQHPP
FT                   PDLPQPIIIAIGSRPPAETGDCAPERGGAPAQARARHD"
FT   gene            528382..528930
FT                   /locus_tag="RPB_0480"
FT   CDS_pept        528382..528930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0480"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05191"
FT                   /db_xref="GOA:Q2J2W9"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W9"
FT                   /protein_id="ABD05191.1"
FT                   /translation="MTEASWTVLREVLAERYDELCRRLAVRLGSKEAARETLHETWLHL
FT                   RSGNDPVEVQRPFGYLLRTALNLAISRERTEQRRNKQLDVVDMLELVDPAPGPEREAEA
FT                   RRQVEFLEQVLQELPPRRRAILLASRVEGVPLKRIAEHLGLSQRFVEMELKAALEYCAR
FT                   RFGKKLTRRFGPRSKEASS"
FT   gene            528992..529975
FT                   /locus_tag="RPB_0481"
FT   CDS_pept        528992..529975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0481"
FT                   /product="putative FecR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05192"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W8"
FT                   /protein_id="ABD05192.1"
FT                   /translation="MMQFDDPPEQLGALRREALERVRRLGSGRATPADVEATKQWGRQS
FT                   PDHAEALWQASLLWDRLGCAGDNVLRRSGAALGGVQAAAPAPSRRAFVAGAAATAAAAY
FT                   LVVRPPLDLWPSLGDVMADYHTATGETKDVSIPGDIRLSLNTATSIKLQKPADTIERIE
FT                   LLRGEATVTVGAQPGRELIIVAGAGEARARHAQFNVLHEQDATCVTCLQGEVEVRLGTA
FT                   SSVLRLGQQLRYGADGLGSATPADIGEVTAWREGLLIFHQRPLMDVVAEINRYRPGRVM
FT                   VVNAELGRRVVNGRFRVDNVDGVMAMFEQIFGAKLTRLPGGIVLLG"
FT   gene            530172..542195
FT                   /locus_tag="RPB_0482"
FT   CDS_pept        530172..542195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0482"
FT                   /product="haemagglutinin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05193"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR021026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W7"
FT                   /protein_id="ABD05193.1"
FT                   /translation="MSPALHHDVGRRHSRVTAEDGGQLRVTAKRRALSRRLMLTSTSAL
FT                   ALTVLLTAAPAMARSLGGAAPDYSAAAVAAAAATAAAQQGSAAAQRSVESLTQAAQALQ
FT                   GIQAAQAAARAAAQAAGVSVTAPVVVPNGLAAGGLVPDSGLAAPGAARPVLSWTNARTP
FT                   VQSGPADAPTVTVQQTGAQAILNWASFNVGASTSVVFDQQGNSNWVALNRVVGAASPSQ
FT                   ILGSIGADGSVYIINQNGIIFGGASQVNVGSLIASAAQVTDAQFKANGIYSSLSGSSYL
FT                   PSFSGATGAITVEQGALINTSAPGAVTQGGGFVMLLGTSVSNAGTITTPKGQTVLAAGR
FT                   DFVVRKGYATDANSFSTTRGNEIAPGLWNASSSSWTPGGGAVTNSGLVFAQQGDITLAG
FT                   HAVAQNGVAIATTSVDIRGSIHLLNAASDASGSVTLGAASLTQIMPELGSADTALNSKR
FT                   DALIADSATQNAARATASFGQFGNLSSLADRQDLGRVEIVSGGVVTFDGGSLTLAQGGQ
FT                   IAVSARARVFAAGDAVLDVSGTSSVLPMSANSLKINVQPNEMRDAPVNRESGVLTNQDV
FT                   WIDARDLVLVPAGTGGYASDRYYTKGGLLEVSGYLANTGHSVGEWTAVGGIITLSAAEL
FT                   VAQAGSVFNLSGGTISYQAGQVLTSNVMGADGRLYPIGSVPADMPIIALGRSFTVDHSR
FT                   WGVKDVWGSPSHGATTSRWDDGYTVGRDAGQLVLSAPTSVFEGSIVAEVITGLRQTAAR
FT                   PTGVSDGYKLTQTTVPLAGALMLGQYGAIGRTGAVASEVIIGDVADITSGLGAEAALPS
FT                   GRANTAWFDAGALNEAGLGGLSIASSNSIRVSSDLTLARGGILELVAPTIDVAATLTAR
FT                   GGAVTLSTLLSRVYPNGDSIGRGTLPLTPALGRASITLEENAVIDTRGLWTNALLDPAG
FT                   DASGQAFADGGAVTLRSSGDVTLGTGSIIDASAGAALLAGGKLKGGNGGNISLIASESL
FT                   TDVNGTTSGNTIHGDLTLRGTLISYGFGKGGKLTLQTGGSVSIGGTSASLNLSPELFGS
FT                   GFSAYSINGLTRLMVADGVAITATMPVLRADPNRAFSAPSGGAATAVASLWTPPLYLEN
FT                   PAKGTLAQRAGASVALLSGAGADSSGYITTEGALSIGTGASITVDPGQSVRLAASGQVT
FT                   VDGTITAPGGSIAITNNYTQLHYVDPAAMSVWIGEHAVLDVAARAYIAADVAGRRYGVI
FT                   PDGGAITLGSTGGAFKVMGSSTNEVYEPGNEASTHAYVVIRPGAVLDASGTSGELDIAT
FT                   GGSLRSAFAPVTVASDGGTIALRSWSGIHAEGTMQAFAGGAGAAGGTLIVSLEAPIQTA
FT                   VASIVVPTNLKVGRVLTVTQDIAGTLAAGLQPGQSDATLALGQGTIAVSQIAAGGFDDV
FT                   SLLGRGAILFDGDVSLEAGRSLSLEAGQYADLGGGRAVVSAPYVRFGGQDVFIFDYNTV
FT                   PSTVPAYAAVGTLAVDGDLIELGGNVATTFATTSFTSHGDLRFVTSASVPNPGLYAAHD
FT                   LTLSAVRIYPESGTMATVAAGYTKSSYSPGSSQSWMFTDPAAVLTLVRPDAGAAVEAPY
FT                   SAFGELSLTAGTIRHGGALFAPFGGITLTATRVGSNVVNTAPAVVEFLPGSITSVSGAG
FT                   LVMPYGGTTDGVGWTVNGTDGATVHLITGQYMKADGTVITLGARRSTGISIRATTIVGD
FT                   AGATLDLSGGGALTGAAFISGRGGSVDTLLASLTKGGTVYAIVPGVVTTPVAGNYYSAW
FT                   TGAVPAVGQTITIPAGVPGLPAGTYTLLPANYALLPGAFRVELGGTGTTAFAGTIGLTN
FT                   GSWLTSGYQGIAHTAIRDVLPTSVTITPAATVRTYSQYNETSYDAFQIAQADTFDMVRP
FT                   RLEADAGNLTFLFSALNASGAAAAVPALVWDGTTDLTPAAGGYGGTVSVMVGGSQDLII
FT                   AADGSTTERSATKTVLSASAINALNAPHLFIGGKPMISSNISIIGGDPFTQNNSANAIT
FT                   LESGVVLTGGQIVMNVRQGGTIRLDPGAMIDTRGFADVALLDSSLGYYLGGGVPMLVAS
FT                   NGAVALYTNNAANATGTISIGAGAGIFTRNAIGFVSAMGVSFDGTPLLGAENLELVAAS
FT                   INLGTAANLAAARAAGTLPVGFDLTQELFASLVAGDPSRNITGVRKLGLGTGNSVNIYG
FT                   SVNLDLSALDSLTLTTAAIYGAGGGNDSAVLKAGSLNWNVGQRTVSTDGNGTPNYGSAL
FT                   PGAVTANGPGTGRGSLTIQARDITLGHADMLGGGSTVTFDRLILGFQDVTLSASNSITS
FT                   EDHNTLSFWRTGASPTSTFDAKTYTGEVGHRLSLITPLLTGESGSVLSVYSGSSIFVTA
FT                   PEGSTPVDTSTVSSLGATINLHSIYNGVVLDTAVALPSGRFTATGGGMNVELRNRAHLD
FT                   LSGRAVSFGDVTRYSWGGDIGLEASTSGAVIFFQGAVLDVSAVNNDAGSISIAAPESYG
FT                   GGFVVFVDGQGRTLSSLDGMFKGAATGGYEGGSFKLETYHLDSGPGWSNTTSFARLNRA
FT                   LNASGFFGSREFNLKDGNLTIGDELKAHHVVVSVDDGSLTVNGHIDASGATPGTIRLAA
FT                   SDNLTIASSAVLDVHGTELQVDSYGQPIEAKNRGHIELTSSDGTLSLGAGSVMDLSTPS
FT                   GAYGQVVLNARRTSETSGDIRISAAGSLAIRGASSIALNAFWRYGNYASNTVVTQAMLD
FT                   TFDIASQSFIKAAYDNDLATGQLTAGLKGKLAGLTAHGSAFHLRPGVEISSGGDLATSG
FT                   DLDLAKYRYGPNADRYTTSASFGAGEPGALVIRAGGNLTIGGSISDGFGTPVSVYLGEA
FT                   AGAQETLNATKTLTAATGISTASIPIASLPTTLNFDAVLNTSNSLRRGIAIPFAFTSAA
FT                   NVAQTGWTATANIYNASGTLLYATGSMVTTTLPSGTQFAAGSTLPGSGALRIQAGAVIP
FT                   ANTVIKTYISQTTSLFLGSQTLPLGATLPSGTAINYATTPMYGQTSRMLAAGSQSWSIR
FT                   LVAGSDLSAASTLVLRAASGLAGSGNIVLNNAGAVDFRGIPIPSVIRTGTGDLELLAGG
FT                   DLTMRSLYGVYTAGTDAGATGLPAGTYMPDHGGDLTVTAQGDVTGYSYNCTYSSCGNAK
FT                   SWSPAIWLIRSGDSTTNAAWSIAFDRTISGSSASYITGFAGFGTLGGGDVTLTAGGDAG
FT                   AMTRTYTGSGVTAQTYGALQVAVAASGKVLSVTKDGAIVTGGTLVQAGGGDLVVKVGGS
FT                   LNTGYNYSNSEQAADGSLSIFTNLRGDTTITAGAIGAIGEIYGFKETGDPRGLDANEAN
FT                   LASARGGIALIPGDGTITVRTAGDLVIGSYADAGQLGGTASSTSFSLWQPQTTAISLFS
FT                   AGGNLVPVTNMGIGNPWSMKTLSTSVVMAPGLFDAVAADGSIYLGGNYAFTFELAPSPN
FT                   GRLNLLAGQSIYGAGLWVGGLVNVTAAGSSTRIVVSSAASGVNDIPNPFRPSTATGSFF
FT                   SFQDDRVSASTTDDTTPNRIVALTGDIINLALGETLTDVYYDNAYHVISHGTGKSAQVI
FT                   AGGDIVNFGAGSAGATAGLILNTRPTDVSVIRAGGSIFYLNMNIAGPGALDISAVDTIY
FT                   QGNLGAITSIGPLASGDTRPGASIVVAAGLGSDGADYAALTKYLDAANLAATGIPLADQ
FT                   SGKVARSYDAELIAWLFDYYGYRAQNAADARAVFAAKPAEQQNIFLRSVYFAELKAGGR
FT                   EYNDPSSSRYGSYLRGRRAIAALFPEDRSYAGDLIMFGGSGIRTLYGGDIAILTPGGRQ
FT                   VLGVEGTVPPASSGVITQGAGDIGLYSKGSILIGLSRIMTTFGGGILGWSAEGDINAGR
FT                   GSKTTQVYTPPKRIYDSYGNVTLSPAAPATGAGIATLNPVPGTPAGDVDLIAPLGTIDA
FT                   GEAGIRVAGNANLAARQILNAANIQVQGASSGLPTVQAPPTAALTAANNVAGAATPTAA
FT                   GPAQDNDRPSIILVEFLGFGGGDGGDTKPRSPDRDDRRRTEQQGYNFNSAFQIIQLGDL
FT                   AGPARSNSR"
FT   sig_peptide     530172..530348
FT                   /locus_tag="RPB_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.734) with cleavage site probability 0.724 at
FT                   residue 59"
FT   gene            complement(542285..542689)
FT                   /locus_tag="RPB_0483"
FT   CDS_pept        complement(542285..542689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05194"
FT                   /db_xref="GOA:Q2J2W6"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W6"
FT                   /protein_id="ABD05194.1"
FT                   /translation="MTDADDVIKANDAAVRSASEALRSNPLRIGISTRALFNLEEEHRV
FT                   FEEEGVEAYSEMQLGREEVVLEKGAGFEVIKRLLALNEHGEPPYVQVILLSQNSPDLSL
FT                   LAFKSFEHYGLAVKTGSFTGGRSLAPYVLA"
FT   gene            complement(542807..543268)
FT                   /locus_tag="RPB_0484"
FT   CDS_pept        complement(542807..543268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05195"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W5"
FT                   /protein_id="ABD05195.1"
FT                   /translation="MRDAAGALAAQRSSPYVGAALIYSGGFMGTAGRIRQSNGSRTFYC
FT                   LDAVSRAAEVEAFERALYGGMDIATAFWGDLDYAGMSILTVLRTSFLGARAWEPGYAPL
FT                   LARLEAGEGHTPEEARKSGQKPVSTTGCSYADGVLIPTLAKHSRFVDQE"
FT   gene            543341..543970
FT                   /locus_tag="RPB_0485"
FT   CDS_pept        543341..543970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0485"
FT                   /product="SAM binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05196"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W4"
FT                   /protein_id="ABD05196.1"
FT                   /translation="MDRLGRVGALLQPEQRRNEVGSKVSWFQETPASSLALIDGLPLTA
FT                   SSPIVDIGGGASRLVDHLLARDHRDITVLDLSEAALAAARARLGAHADRVHWIVADVTT
FT                   WRPMRRYALWHDRAAFHFLTEQSQRDAYRARLNDALEPGGHVVIGTFAPDGPERCSGLP
FT                   VVRYDADGLHHVFGSDYALIESRLDSHATPWGSDQTFQFVTLRRRI"
FT   gene            544592..545179
FT                   /locus_tag="RPB_0486"
FT   CDS_pept        544592..545179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0486"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05197"
FT                   /db_xref="GOA:Q2J2W3"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W3"
FT                   /protein_id="ABD05197.1"
FT                   /translation="MDHPRRKPPAVSQDLSDCIVRIATDHDEAAFDVLFRHYAPRLKSY
FT                   FTRRGGDPAMAEEITQETMVSVWKNAAQFDPAKASATTWIFTIARNLGIDRLRRAKRPS
FT                   FDPHDPAFVPDEEDPPDRQFERAEAQRRVRDVMNTLSSNEKSVLMLSFYENQSHGEIAQ
FT                   RLGLPVGTVKSRIRLAFGKLRAALEPLTGAGR"
FT   gene            545176..545835
FT                   /locus_tag="RPB_0487"
FT   CDS_pept        545176..545835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0487"
FT                   /product="anti-sigm factor, ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05198"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W2"
FT                   /protein_id="ABD05198.1"
FT                   /translation="MTVRHHIGDDLLLSYAAGTLDEASSLLVATHLALCPACRARAAAA
FT                   DDLGGALLDALPAAELSPGLHDAVLARLRAEPLAAPAPATPLRPRSEIVIPEPLRSYLG
FT                   GDFETLRWTKLAPRVHQIAIDLPNCRPRARLLRFQAGTRVPAHSHAGRELTLVLSGSLC
FT                   DRDAVLARGDVAETDEHTEHQPHAGPGDDCICLAVTDAPLRFKGVLARLLQPWFGI"
FT   gene            complement(546115..547230)
FT                   /locus_tag="RPB_0488"
FT   CDS_pept        complement(546115..547230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0488"
FT                   /product="Protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05199"
FT                   /db_xref="GOA:Q2J2W1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W1"
FT                   /protein_id="ABD05199.1"
FT                   /translation="MRAGDNKFFIFLLAAASVAFVWILLPFYGALLWGVVIAILFAPLY
FT                   RQLNRAFGFRRNLAAVVGVTVIVLLVLLPFSAIGTALAKEATGLYARIESGNLALLNNL
FT                   RNFIEQPPSWINDLLERFGIGSVAELQQRLSSVLMRGSQYLAGQALTIGQSTVDFTVNL
FT                   FVMLYLLFFLLRDGDLIAGRLRRGLPLSVDQQNLLLNKFTVVIRATVKGNMLIALIQGA
FT                   LGGLAFYVLGIGGALLWAVVMAFVSLLPAVGAGLVWAPVAVYLIATGSMWQGILLIAYG
FT                   ALVIGMVDNVLRPVLVGKDTRMPDYVVLISTLGGLQVFGLNGFVIGPVIAAMFIAVWDI
FT                   YSASREDAANAGEATTGGVPSSGEVRSADAP"
FT   sig_peptide     complement(547165..547230)
FT                   /locus_tag="RPB_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.354 at
FT                   residue 22"
FT   gene            547666..549360
FT                   /locus_tag="RPB_0489"
FT   CDS_pept        547666..549360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0489"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05200"
FT                   /db_xref="GOA:Q2J2W0"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2W0"
FT                   /protein_id="ABD05200.1"
FT                   /translation="MLAKFSIRTKITTLVAALLIAMSGLGAIGLLKMQGINAATVEITS
FT                   NWLPTVMTLGDMRAEVISYRMKLRNHLLETNAGRMADIEKQLADNEDRIKKAQNGYEPL
FT                   ISSPEERQIYETWVSEWAKYRAVVPKLLELSRNSPEGRISVEGVEMLSRTFNPIGERMD
FT                   EAMNKDLAFNNKGAHHASETAASTYSSAFFIVVSILGVAIVVGVIASVMVVRDITSGIA
FT                   AIIKPMQTFGQGDLSADVPYRGASTEIGAMADALQVFKEALIAKKAADEAAAHEAEAKI
FT                   ARAQRVDTATRKFESAIGQIVETVSSASTELEASASTLTATAGHAQELTTAVAAASEEA
FT                   STNVQSVASATEEMASSVNEISRQVQESARIANDAVDQARKTNDSVGMLSAAASRIGDV
FT                   VELINTIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKATGEIGQQISG
FT                   IQAATDQSVSAIKEIGMTIGRMSEIASTIASAVEEQGAATQEISRNVQQAAQGTQQVSA
FT                   NITDVQRGASETGSASSQVLSAAKSLSQDSNRLKEEVATFLETVRAA"
FT   sig_peptide     547666..547746
FT                   /locus_tag="RPB_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.560 at
FT                   residue 27"
FT   gene            549524..550597
FT                   /locus_tag="RPB_0490"
FT   CDS_pept        549524..550597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05201"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V9"
FT                   /protein_id="ABD05201.1"
FT                   /translation="MSDAVVDDIVALLPPLLRSIEALDFVARYLHPPDFGEVMRLAGEP
FT                   ETELRAALPRLAAWPDTFAHLREPLKLAGDHVVAAFDGLRAVDGGDGDLVAVFRALRHL
FT                   PQALEALYPLAATLPPLSGLYLDPELRADDAVLARLAQPKHPDSGVFHFDNEPGSRGGF
FT                   SFYVPEDYTPDRAWPLVVALHGGSGHGRLFLWSWLRDARSRGAIVVAPTAIGRTWALMG
FT                   EDADTPNLARIVDFIGSRWSVDPRRRLVTGLSDGGTFCYVTGLERESPFTHLAPIAASF
FT                   HPLLAGMADPERLRGLPIQIVHGRHDWMFPVELARQAQQALSAAGADVGYREIDDLSHT
FT                   YPREINAALLDWLGKAD"
FT   gene            complement(550600..551097)
FT                   /locus_tag="RPB_0491"
FT   CDS_pept        complement(550600..551097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05202"
FT                   /db_xref="GOA:Q2J2V8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V8"
FT                   /protein_id="ABD05202.1"
FT                   /translation="MTDASALPKSAFPKPALPASAAATHRMHGATSRRAVALIVAAAAI
FT                   IAALVATLSDATSLTAQQADPELVMLLRFMAGVKALLALAALGAAVWRLGYPTSPTLTL
FT                   GYTLAPALMCAAPVVIWQIAHVGVGAALFHAGFVLLLLALYADRGEATELAKSTVLRLR
FT                   RA"
FT   gene            complement(551346..552071)
FT                   /locus_tag="RPB_0492"
FT   CDS_pept        complement(551346..552071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0492"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05203"
FT                   /db_xref="GOA:Q2J2V7"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V7"
FT                   /protein_id="ABD05203.1"
FT                   /translation="MSAADPFALWVYLSQTPLLWLTVTLLVYAATDAMSQATGRNPLMN
FT                   PVLHAMWIIGAFLWLTGTSYTTYFSGAQFVHFLLGPATVALAVPLYENRHRVVAAILPM
FT                   AIALVVGCVAAIVSVVVLAQLAGLPEPVVLSLAPKSVTAGVAMGISESLRADPSLTAVA
FT                   VILTGIMGAIVVTPLMNALGIRDFRARGFAVGLASHGIGTARAFQVDAIAGVFAGIAMS
FT                   LNALITALLVPVLVTLLVR"
FT   gene            complement(552068..552466)
FT                   /locus_tag="RPB_0493"
FT   CDS_pept        complement(552068..552466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0493"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05204"
FT                   /db_xref="GOA:Q2J2V6"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V6"
FT                   /protein_id="ABD05204.1"
FT                   /translation="MIASLGLILLCQLAAEVVVRALALPLPGPVLGLMLLLGLLLARDR
FT                   LRWLAVGPLRQDGAGHDGVETASKAMLAHLSLLFVPAGVGVVQQLDLIAAHGVAIALVL
FT                   AGSVLITLLVTVATFLVTARLLSMWGAR"
FT   gene            complement(552609..553115)
FT                   /locus_tag="RPB_0494"
FT   CDS_pept        complement(552609..553115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05205"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V5"
FT                   /protein_id="ABD05205.1"
FT                   /translation="MRAPPFATMAAALLAAALPTSASVTSAAALTAQECSARYQAAKTA
FT                   GTLNGQGWNDFRKAQCGGDTATAEAKDKAEPTADSKAEAKTGPKTDAKPKAKPKSAEPA
FT                   TPQGPAVYPASIDAKFAKEKPTLARLHTCAEQWKANKAANTTGGLRWIQKGGGYWSECN
FT                   KRLKG"
FT   sig_peptide     complement(553032..553115)
FT                   /locus_tag="RPB_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.457 at
FT                   residue 28"
FT   gene            553296..554375
FT                   /locus_tag="RPB_0495"
FT   CDS_pept        553296..554375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0495"
FT                   /product="Putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05206"
FT                   /db_xref="GOA:Q2J2V4"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V4"
FT                   /protein_id="ABD05206.1"
FT                   /translation="MSQNPALTGTTLRSKTLNVLETIAIGAAGGGLSYWVQLPGGLITG
FT                   AMVAVAAAGLAGRNMGLPPPLAHIVLMALGVSLGSMVSPAMIQNLSSYPVTIGLLAVAT
FT                   FCATFGSAIYLQRVHGWDRTSALLAGSPGALSQIIMLATERKADVPGIAVVQIMRVIIL
FT                   TSAVPLLIAMTGMTAGGSLPVRGPEATPLVLVAIAVVAVGASLLLRLIKFPASWMFGAM
FT                   LGSSVLHGSGLVEGTLPEWAYLSALVGIGTLIGSRFGAIKLRTILSHLAAALGSFAVAI
FT                   AISAVFVVALLLTTPVRTADLVVAFAPGAMDAMMALALTLHIDPVFVGAHHLSRFVYVS
FT                   IVTPGIVHWFGRSPDDLDD"
FT   gene            complement(554482..555213)
FT                   /locus_tag="RPB_0496"
FT   CDS_pept        complement(554482..555213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0496"
FT                   /product="Photosynthetic reaction center protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05207"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V3"
FT                   /protein_id="ABD05207.1"
FT                   /translation="MTTAKLLVVAAVIGTVGTTQALAACEIADAKLEEAIQENPRFRGP
FT                   ANSQAVRDLRSLRDAAFTLRSYGRHDDCERLLANIRELIAGPPMGSLGDNDEEQADIQN
FT                   SAREPKSRRGTPAGSRDDKDAKPLIRIDQLTPGLRTDEMIGAEVRSSDDKIVGEVRNIV
FT                   FGTKDGRDYAIIASGGFFTTGKDSIVVPIRSLKVTQDRSSFFLPIVKDVMETVPVMPDQ
FT                   DYNWLSDPKWRARNDAFFEKP"
FT   sig_peptide     complement(555142..555213)
FT                   /locus_tag="RPB_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.763 at
FT                   residue 24"
FT   gene            complement(555304..555681)
FT                   /locus_tag="RPB_0497"
FT   CDS_pept        complement(555304..555681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0497"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05208"
FT                   /db_xref="GOA:Q2J2V2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V2"
FT                   /protein_id="ABD05208.1"
FT                   /translation="MASIHPPIRVLVVEDEMFIRMDVVEFLRAAGVDVVEAISAAEGIR
FT                   LLERDPDIRLMFTDIDMPGAMNGLKLAAAVRERWPPIKIIATSGHFKLQAGDLPPDALF
FT                   FLKPYQPAEIIDAVRRLTYAA"
FT   gene            complement(555756..557018)
FT                   /locus_tag="RPB_0498"
FT   CDS_pept        complement(555756..557018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0498"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05209"
FT                   /db_xref="GOA:Q2J2V1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V1"
FT                   /protein_id="ABD05209.1"
FT                   /translation="MRLSCGQLLCEVTRPRIGSFMPSETRLVSPSASDASLNRQDELPY
FT                   RRRQQALLREFGTAALQSRDFRHILQQAAGLSARGLGCSYAKVLEYEPGEKRLIVRAGI
FT                   GWPAGTVDHVSLGADIESPAGYAFQTGQSVISNHLQKETRFRTPKLLADHGIKRAINVL
FT                   IRRGGEGDTAFGILEADSPDPGQFDDADADFLAGFAGLLGIAIERQQADAKLQDALEHE
FT                   ALLTREMSHRVKNSLTSVVGLLRVQARGSESADVKNALENAAMRVASIAEVHDHLWRGS
FT                   KVGFVDLSDFVGHLCKNLQSSAPEHTLQSRSDPVILSADKAIPLGLLVNELVTNAIKYA
FT                   YVDGPGVIRMDAREINGHLLVEISDEGTGLPDGFDINQPRKSLGFRVILGLVRQLMGEL
FT                   EISKNIPRGALFTIKFPLDPP"
FT   gene            complement(557130..557675)
FT                   /locus_tag="RPB_0499"
FT   CDS_pept        complement(557130..557675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05210"
FT                   /db_xref="GOA:Q2J2V0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2V0"
FT                   /protein_id="ABD05210.1"
FT                   /translation="MTASPLDQSGLATRPARAARVAQTVALTIGAVSVAALATAWYFQL
FT                   FLDFHPCPLCLEQRYAYYASVPLAALIAIAARREAPVSLLLAGLAVLALLALGNAGLAA
FT                   YHAGVEWKFWAGPSDCSGPVLDLSRAGSLLDQLDKVTVVRCDEAQWRMFGLSFAGYNVL
FT                   LSLAIAALAGWGIGRIRR"
FT   gene            557873..557957
FT                   /locus_tag="RPB_R0008"
FT                   /note="tRNA-Leu1"
FT   tRNA            557873..557957
FT                   /locus_tag="RPB_R0008"
FT                   /product="tRNA-Leu"
FT   gene            558477..559358
FT                   /locus_tag="RPB_0500"
FT   CDS_pept        558477..559358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U9"
FT                   /protein_id="ABD05211.1"
FT                   /translation="MAAEFGDRRLVVAPEMRRPLRDVSDPGAGFAAKLDSSDQFGGGRG
FT                   SGEELAPQRGRIDTLSPQADIVSIPWREGHAIEGCFVASGAPASDDVPVILCVGESRLS
FT                   KEQLLAAFAQSAHESGMSLLGIDLPAPIRSLEAEPPATPETAIVAAIDYLHERAGVDAE
FT                   RIAVVADGSPSSMVARGVALDGRVAAAVCDAGVWQLWEHDQICGLEAAGSIEPLAVRAL
FT                   RCPTLMLIRSNDGIDPEHVRQLLARSGTRDVDLREFAPSGPDRTEPLASAAEIVVQWLT
FT                   EQLQGRAPASPV"
FT   gene            complement(559355..559861)
FT                   /locus_tag="RPB_0501"
FT   CDS_pept        complement(559355..559861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0501"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05212"
FT                   /db_xref="GOA:Q2J2U8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U8"
FT                   /protein_id="ABD05212.1"
FT                   /translation="MKKHIKDPIAGAAGPERDLTRRFASITTNVAVFLDEIRHYRAKNL
FT                   GISGPQFAILMAVMDLDEGEGVSVRHVAKAMHVDSSFITTQSKLLEKKALVRRRPDPTD
FT                   ARVVKLSLSDKAYKSIASFAAEEQSLNDFIFEGLSNESLEDLVQQLTALKLRLEKACLK
FT                   IAGGF"
FT   gene            560323..561774
FT                   /locus_tag="RPB_0502"
FT   CDS_pept        560323..561774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0502"
FT                   /product="putative Omp2b porin"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05213"
FT                   /db_xref="GOA:Q2J2U7"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U7"
FT                   /protein_id="ABD05213.1"
FT                   /translation="MRVIKRLALGTAAALLTAGVAQAADLPMKAKAVEYVKVCSIYGAG
FT                   FYYIPGTDTCIKLGGYLRADATFGGSGAYDSPAWSGTSGAKSRNANSYVFRSRQDINID
FT                   TRTATEYGVVRTYFDATFNWTTGSDSTAGGTLGVYFAFIQFAGFTFGKAVSQFDTPWSG
FT                   YPGNNTSFLIGGYDDVTGINQVAYTAEFGNGVSASISLEDASSYNQSALYNTSTMTAAN
FT                   FATGVYGTNSYAGSQIPDIVGKIRVDQAWGLFQVSAAAHQVRASYYNTALETSGHPSDT
FT                   WGYAVQGAISLKNLPTGPGDSINFTATYSNGATRYVIGGSSPNSFAMYGSSSSAYQSLA
FT                   IAGVADGVFSGTDVSNGSGISKTTAWGVRGAFNHNWNPYWSTSLFGSYTSIDYNGTATA
FT                   QICATAVGFTCNPDFKIAQIGTVTRWTPVKNLTFSGEVMYTYLDQSYSGNVALPAVSSV
FT                   SKPAATYELKDQGAWSGNLRVQRTF"
FT   sig_peptide     560323..560394
FT                   /locus_tag="RPB_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            562278..563924
FT                   /locus_tag="RPB_0503"
FT   CDS_pept        562278..563924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0503"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05214"
FT                   /db_xref="GOA:Q2J2U6"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U6"
FT                   /protein_id="ABD05214.1"
FT                   /translation="MALFGEPIRRIGSITSAGPAGPRSERAVMVVSASRVQAPHLRSKI
FT                   MTAADAAAQIPSGANVGMSGFTGAGYPKLLPLALAERINAHHARGQKFKVSVWTGASTA
FT                   PELDGALAKVDGIEMRLPYQSDPTCRKRINAGRMEYIDIHLSHVAQHVWFGFLGKLDVA
FT                   IVEVAGIREDGSLIPSSSIGNNKSWLDLADKVILEVNAWQDLRLEGMHDVYYGTQLPPH
FT                   RKPIPILATGDRIGEPYLRCDPSKIVAIVETNLPDRNSGFSAPDESSQAIAEHILDFLG
FT                   HEVKKGRLPPNLLPLQSGVGNVANAVMAGLESGPFENMTAYTEVLQDGMLSLLRKGKLT
FT                   LASATALSLSPDGYDEFLRNLDFYRERIVLRPQEISNHPEVIRRLGVIAMNGLIEADIY
FT                   GNVNSTHIMGTSIMNGIGGSGDFARNSYLSFFMTPSAAKGGKISCIVPMASHVDHTEHD
FT                   VQIIVTEQGLADLRGLSPKARAKVIIENCAHPTFKPALKEYYKRALEYSPGLHTPHILD
FT                   EALTFLPNWMANKAAREAWREDAVVQADVWR"
FT   gene            complement(564104..565159)
FT                   /locus_tag="RPB_0504"
FT   CDS_pept        complement(564104..565159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0504"
FT                   /product="Acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05215"
FT                   /db_xref="GOA:Q2J2U5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U5"
FT                   /protein_id="ABD05215.1"
FT                   /translation="MTANGTDVPARMHGDRVDWVDYAKGICIIMVVMMHSVLGVEAAAG
FT                   QTSFMHYVVEFAKPFRMPDFFLLSGLFLAVVIDRDWRTYLDRKVVHFAYFYILWVTIQF
FT                   AFKAPSFAAEMGWAGVAKLYALSFIDPFGTLWFIYLLPIFFVVTKLTRRVPPLLILGIS
FT                   ALLEWLHLQTGWMVPDEFCARFFYFFAGYLFARYVFAFSDAARARPALALLGLAAWAAI
FT                   NAALVHAGFSEAPLLSLVLGLAGAGAIIATGTLLAEKRWLESLRFCGEHSIVIYLAFFL
FT                   PMAISRSLLLKFAGFLDLGVIAILVNIAGVVGALLIWWLAMKTGARFLFERPDAFWIAP
FT                   RKKAVRLQAAE"
FT   gene            565325..567937
FT                   /locus_tag="RPB_0505"
FT   CDS_pept        565325..567937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0505"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05216"
FT                   /db_xref="GOA:Q2J2U4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U4"
FT                   /protein_id="ABD05216.1"
FT                   /translation="MPLPRSFDTPLPIDDALSDLAAALAANSTAVLVAPPGAGKTTRVP
FT                   LALLDAPWLKGQKIIVLEPRRIAARASAERMARTLGERAGDTVGYRVRFGSKVSRATRI
FT                   EVVTEGIFTRQILDDPELTGIGAVLFDEFHERSLDADLGLALARDAQQGLREDLRILVM
FT                   SATIDGARVGKLLGDAPVVESLGRAFPVETRYLGRRSDAPMERQMAEAIAAALRSDSGS
FT                   VLAFLPGAAEIRRTETMLRERVQDASIEIVPLFGALDAAVQDRAIQPAPKGSRKVVLAT
FT                   SIAETSLTIEGVRIVVDCGLSRVPRYEPDIGLTRLETVRASRAAVDQRRGRAGRIEPGI
FT                   CYRLWDEPQTASLPAYTQPEILSADLTSLLLDLAQWGVSDPATLAFLDPPPAPALKEAR
FT                   ELLRELGALDADGRITDEGRSLRAMALPPRLARMIVDAARLDHGEEAAEIAAILTERGL
FT                   GGDSVDLDHRRDQFRRDRSQRATSARQMAERWASSPSPSRGGWTAEGRPGGGSHERGAR
FT                   GTPTPNPSPQGGGESRRGSGQRTAQQADGDQFLSTGVLLSFAFPDRVAKNRGNGSFVLA
FT                   NGRGAMIEQTSALARAPYLAVAELTGTAAQGRILLAAPISLAEIEQHFAEQITDADEVS
FT                   FDRAAMALRARRRRVLHAITLSEAPRALTPSAETARVLAEGLVAAGLERLPWSKSLEQW
FT                   RGRVMFLRKAEGEPWPDLSDAALAEQREQWLVPALFDKIGLKEFSAGDLSDALMNLLPW
FT                   DLRARLEREAPTHFEAPTGSRLPIDYAAEQGPTIAVRLQELFGLTTHPSVAGGKVPLVL
FT                   ELLSPAHRPVQVTRDLPGFWRGSYAAVRADLRGRYPRHPWPEDPAGAPPTRRAKPKGT"
FT   gene            568084..568593
FT                   /locus_tag="RPB_0506"
FT   CDS_pept        568084..568593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05217"
FT                   /db_xref="GOA:Q2J2U3"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U3"
FT                   /protein_id="ABD05217.1"
FT                   /translation="MRSIMIFAAALVVLGTAMAQLADRIMPAPAQASVAKATVGAAPYA
FT                   GSRSVAIPRDARGHFQTDGRIDGQRLAFMVDTGASVVALNESSAARFGLRPRPAEYTAR
FT                   VTTANGTVKAARTRIAMLDIGGLIVRDVDAMVLPDEALSENLLGLSFLSKLKRFEYANG
FT                   QMVLEQ"
FT   sig_peptide     568084..568143
FT                   /locus_tag="RPB_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.915 at
FT                   residue 20"
FT   gene            complement(568594..569463)
FT                   /locus_tag="RPB_0507"
FT   CDS_pept        complement(568594..569463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0507"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05218"
FT                   /db_xref="GOA:Q2J2U2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U2"
FT                   /protein_id="ABD05218.1"
FT                   /translation="MTPRTATLIGLSAILMWSLLAVLTVATGTIPPFQLAAMTFAIGAL
FT                   AAAAGWIVRPGAFRALKQPPLVWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLWPLL
FT                   IVLFSGLLPGEGLKPHHIAGALLGLGGTALLFTGNGAAVDPANWAGLAAAFVAAFVWAT
FT                   YSVLSRRLKAVPTDAVAGFCFVTALLAALVHGLMESTVWPDGATQWLAIAALGIGPVGA
FT                   AFYAWDIGMKRGDIRVLGAASYATPLLSTGFLILAGYARPTATLALAALLIAGGGLLAA
FT                   KDMLRGRK"
FT   sig_peptide     complement(569323..569463)
FT                   /locus_tag="RPB_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.241 at
FT                   residue 47"
FT   gene            complement(569514..570239)
FT                   /locus_tag="RPB_0508"
FT   CDS_pept        complement(569514..570239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0508"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05219"
FT                   /db_xref="GOA:Q2J2U1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U1"
FT                   /protein_id="ABD05219.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGYAVAASYAGNDSAAEKFKS
FT                   ETGIPVYKWDVSSFDACAAGVKQVEADLGPVDVLVNNAGITRDGAFHKMTLEQWNAVIN
FT                   TNLGSLFNMTRQVIEGMRARKFGRIVNISSINGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ENARGGITVNAICPGYINTEMVQAVPKDVLDKAILPLIPCNRLGEAEEIARAVVFLAGD
FT                   ESGFITGSTLSINGGQLMT"
FT   gene            complement(570434..571612)
FT                   /locus_tag="RPB_0509"
FT   CDS_pept        complement(570434..571612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0509"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05220"
FT                   /db_xref="GOA:Q2J2U0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2U0"
FT                   /protein_id="ABD05220.1"
FT                   /translation="MSDDVVIVSAARTAVGSFNGAFANTPAHELGAVAIKAALERAGIE
FT                   PARVSEVIMGQILTAAQGQNPARQASIAAGIPVESPAWGVNQLCGSGLRTVALGYQALL
FT                   NGDSDIVVAGGQESMSMAPHAQYLRGGVKMGAVEFVDTMIKDGLWDAFNGYHMGNTAEN
FT                   VAKQYQITRQQQDEFAVASQQKAEAAQKSGRFKDEIVPFTIKTRKGDIVVDSDEYPRHG
FT                   ATIEAMTKLKPAFEKDGTVTAANASGINDGAAAVVLMTAKQAAKEGKTPLARIVSWAHA
FT                   GVDPKIMGTGPIPASRAALKKAGWAIGDLDLIEANEAFAAQACAVNKDLGWDVSKVNVN
FT                   GGAIAIGHPVGASGARVLVTLLHEMQKRDAKKGLATLCIGGGMGIAMCLARD"
FT   gene            571896..572504
FT                   /locus_tag="RPB_0510"
FT   CDS_pept        571896..572504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0510"
FT                   /product="Polyhydroxyalkanoate synthesis repressor PhaR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05221"
FT                   /db_xref="GOA:Q2J2T9"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T9"
FT                   /protein_id="ABD05221.1"
FT                   /translation="MRVGAMAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLATMVKDGE
FT                   DFLVYDAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLE
FT                   QSIDSLTREQEKFRKQMTSTLSMTPFAPLEETVRRNMELFQQTFSMFVPRKPSHETDAD
FT                   ATSVEPVREADNIDDLRRQMRDMQERLDRMSLDQPKKEE"
FT   gene            complement(572512..574263)
FT                   /locus_tag="RPB_0511"
FT   CDS_pept        complement(572512..574263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0511"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05222"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T8"
FT                   /protein_id="ABD05222.1"
FT                   /translation="MSPVDPTAAQPIAPTESRGPDPAEILAALGQAAFVWELATDALVW
FT                   TGPAAGLFQDIPAGTLATGAGYASLLEPSRAIRADALLNASAAAGAHCVPYRIEYGVRA
FT                   ATSAPIIWIEESGRWHPGPDGRPARVEGIVRVNNERHARDQQLLKLSQNDPLTGELNRT
FT                   NLVAALAEAIEEASRFRNSLCFMLIGIDHLSRINDSFGFDVADEVIYTLSQRIRARLRA
FT                   GDELGRFSGNKFGVVLKACTIDDAHVAAERFLAAIRDEIVPTRSGPVSITASIGAVSSP
FT                   RHARTAEEAINRAQEALAAAKHRRCGAFSMWRPNVERDAQRRVNIRVTDEIVTALNERR
FT                   IVLAYEPVVDVATRAPAFHECLVRMRQNDGQVLLAPDIVPVAERLGLIRLVDHRVLELV
FT                   VAELAAAPQMTLSLNISPDTTMDADWWAGIESLMLAHPGVAERLIVEITETVAIQDIEE
FT                   VRGFVTRLKKFGAKIAIDDFGAGYTSFRNLRNLGVDIVKIDGAFVQNIARSADDRAFVQ
FT                   TLIDLARRLGIKTVAEWVQDDESALMLRDWGCDYIQGRLIGLASQHRPWDGPTAAETAA
FT                   VRERAAN"
FT   gene            574469..574765
FT                   /locus_tag="RPB_0512"
FT   CDS_pept        574469..574765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05223"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T7"
FT                   /protein_id="ABD05223.1"
FT                   /translation="MANIWIDQSDDGIRDFGASDAAEPELIELVPAPVMPAQPRTRYTD
FT                   RAVRPSSNFVAQLMAVERGYPQTRDVYRAEPDQATAAYRSAKAYQAGRTRRFS"
FT   gene            complement(574782..575426)
FT                   /locus_tag="RPB_0513"
FT   CDS_pept        complement(574782..575426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05224"
FT                   /db_xref="GOA:Q2J2T6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T6"
FT                   /protein_id="ABD05224.1"
FT                   /translation="MSIIGFPLLLIPIAICNIVVFLMPGVGFDVALTRVALPSGAVWTI
FT                   TAGDMLVALGALMLLFEVIKAGRARYFTDHLLSLLVLGGTVAEFVILPQFTNATVFLLA
FT                   TLMLVDFLAGLALRPRRARKVRGAPTAKRDQPQQTPVTPPPATETPAPAAPVAAQSAAT
FT                   SASISAASIAEAVLLDRPQPVTAAAGSAASPRVPSPGLQPAEDAAGAQPPR"
FT   gene            complement(575663..575845)
FT                   /locus_tag="RPB_0514"
FT   CDS_pept        complement(575663..575845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0514"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05225"
FT                   /db_xref="GOA:Q2J2T5"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2T5"
FT                   /protein_id="ABD05225.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVIKKKDA"
FT   gene            complement(575982..576665)
FT                   /locus_tag="RPB_0515"
FT   CDS_pept        complement(575982..576665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0515"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05226"
FT                   /db_xref="GOA:Q2J2T4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2T4"
FT                   /protein_id="ABD05226.1"
FT                   /translation="MRRLIRVALLTLLLLVAAPYVLTLVYGAGQPVSTLMVWRWLAGAT
FT                   VTRQWVDIERMAPALPRTVVASEDAKFCSHSGIDWDSVRDVLDDLQDGGEASRGGSTIT
FT                   QQVAKNLFLWPGRSVVRKALEFPLAMWIDLVLSKQRILELYLNIAEWGPDGQFGAEAGA
FT                   AYAFGRSAAQLTPQEAALMASILPNPRVRSAKKPGPGVRRLAATYVARARSAELQQCWR
FT                   ENSGS"
FT   sig_peptide     complement(576582..576665)
FT                   /locus_tag="RPB_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.663 at
FT                   residue 28"
FT   gene            576819..577745
FT                   /locus_tag="RPB_0516"
FT   CDS_pept        576819..577745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0516"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05227"
FT                   /db_xref="GOA:Q2J2T3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T3"
FT                   /protein_id="ABD05227.1"
FT                   /translation="MATGTSTIDFAKRLDATAEDTEALLGRLLSDDLLPDEIARPRRLM
FT                   EAIRYSTLGGGKRLRPFLAVESAAVFGVDRAGALLVGAALECIHCYSLIHDDLPAMDNS
FT                   DLRRGRPTLHKAYDDATAILAGDALLTLAFDIITRDEVHQDAKVRLDLNRVLARCAGLG
FT                   GMVGGQMLDLAGEGRFGDREPVDVARLQQMKTGALLRYGCVAGAILGQASPEHYKALDD
FT                   YGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGVDGAKQRVRDLIAR
FT                   ADEALAPFGAKGEVLRAAARFVAERKN"
FT   gene            complement(577784..578209)
FT                   /locus_tag="RPB_0517"
FT   CDS_pept        complement(577784..578209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0517"
FT                   /product="BLUF"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05228"
FT                   /db_xref="GOA:Q2J2T2"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T2"
FT                   /protein_id="ABD05228.1"
FT                   /translation="MPERHYRCVYWSRQRMEGGPEQVAAEIESILSAARRNNPHLGITG
FT                   ALAIGRGVFAQLLEGKRYAVEMVFEKIQRDERHGEVQVLAFGPADERAFPHWPMARLEP
FT                   GSDDQVRIVPIGDDTDVGATHPEARRLLDIVRALATE"
FT   gene            complement(578210..579949)
FT                   /locus_tag="RPB_0518"
FT   CDS_pept        complement(578210..579949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0518"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05229"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T1"
FT                   /protein_id="ABD05229.1"
FT                   /translation="MATFATFCGGMGSVHSITHIGTALAETSRRRPLRAVPPKQAAELA
FT                   MSAFAAIDSALAMIAPDGRIMMANPAFGRLFGDISSEDLQARLLIESWRNLEGGERVVL
FT                   FPDGRSFLIRTNILPSGYFVCASDITDQLARDARDARLVRTDRLTELGNRRLLRERLQD
FT                   LLDSSPAVRGDCALLTVDLDRFRAVNDALGRNIGDALLCLVSKRIRSAVSDVDIVTRLY
FT                   GDQFGIIQFGRAQPDSAVILAKRLCDLLSRPYMLEGQLIDVTARVGIAPLALEAADVDQ
FT                   VMKNADLALNRARQDRATGYCVFESGMDETVKARRALETDLRRALALREFALVYQPQFD
FT                   LQTRRVTGFEALLRWNSPTRGTVSPLDFIPLAEETGIINPIGEWVLRTACRDAANWPAD
FT                   ITVAVNISAVQFAHRTLATTVLSALSDSDLDPRRLELEITESVMLDARGTALGVLQRLR
FT                   GTGIRVSLDDFGTGYSSLGYLRSFPFDKIKIDQSFVRGTAEDPGNRAIVRAIASLGQNL
FT                   GMATVAEGVETAEHLERVAADGCTHVQGYLISRPISPEQVDGFLAAKSAEETECRDDPF
FT                   QVA"
FT   sig_peptide     complement(579872..579949)
FT                   /locus_tag="RPB_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.693) with cleavage site probability 0.684 at
FT                   residue 26"
FT   gene            580156..581775
FT                   /locus_tag="RPB_0519"
FT   CDS_pept        580156..581775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0519"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05230"
FT                   /db_xref="GOA:Q2J2T0"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2T0"
FT                   /protein_id="ABD05230.1"
FT                   /translation="MGPVEAKFQIFLILLAVLAATALLARRLHVAPAILWLLVGIVLAF
FT                   IPGMPAIELPPDLILLLVLPPLIYSASVAMSWREFRANLRSIGLLAIGCVIFTAGAVAV
FT                   ATHYLLGLPWAVGFLLGAIVAPPDVVAPLAIARRLGLPRRIVVVLEGEGLANDATALIL
FT                   YRFALAAIMTGMFSLPQASGAFVAILAGEIGFGIAVGWLSLRARHSARDPRIEITLSLL
FT                   TPYIAYWIPEHLGGSGVIATVACGLYISWNGPLLIPAATRLQGIFFWDLIIYLIEGLLF
FT                   LLTGFQMRAILERSKGLPVDDIVVATLLVAAIVIVARFLWVYPATYLPRLLSKRIRTRE
FT                   RRPSWRAVFVVGFTGVRGAVSLATALALPFALPDGSAFPDRDLILFVAFGVILITLVGL
FT                   GLTLPALVGVLGLTRDGRSEHIAEHEAEIAARRAALAAALQSLDALTNDRALSDEVVAL
FT                   LHARHDIRAHQLPTALDDAAYAATANARALVRELIAAERQFIHAQLRAGKITDEARRRI
FT                   ERDLDLEEASLANREFRSGGQR"
FT   sig_peptide     580156..580248
FT                   /locus_tag="RPB_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.755 at
FT                   residue 31"
FT   gene            581865..582227
FT                   /locus_tag="RPB_0520"
FT   CDS_pept        581865..582227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05231"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S9"
FT                   /protein_id="ABD05231.1"
FT                   /translation="MFPFQEVKEREVRAEPSGIRLSSADAAVVKGMIARGDRQHDIAAW
FT                   FGVNGGRIGEISNGKKFEYVAAAPPDQLPAPGPYLSGRSGQKAVAALEQAKAALEEALQ
FT                   NIEQGLADARELDDQE"
FT   gene            complement(582218..582835)
FT                   /locus_tag="RPB_0521"
FT   CDS_pept        complement(582218..582835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05232"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S8"
FT                   /protein_id="ABD05232.1"
FT                   /translation="MQNRSHAVMAQRAEASDSPDDFPTPPWATRGFMEYVIADKGPFSN
FT                   MTALEPACGAGHMAKVLKEYFGEVRSSDAYAYGYAPVRDYLDVPYEANAVDWVITNPPF
FT                   RLAEEFVHRSLIVARVGVAVLVRTVFIESSGRYRALFEKNPPTKFAQFVERVPMVRGRL
FT                   DRKASTATGYAWLVWEKDEPTTSHLMWVPPCRKRFERDTDYS"
FT   gene            complement(582955..584250)
FT                   /locus_tag="RPB_0522"
FT   CDS_pept        complement(582955..584250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0522"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05233"
FT                   /db_xref="GOA:Q2J2S7"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2S7"
FT                   /protein_id="ABD05233.1"
FT                   /translation="MNKLENPLQNDVAGPAPRHRTTQVMVGDIAVGGGAPIVVQSMTNT
FT                   DTADIDGTIKQVAALARAGSEMVRITVDREEAAAAVPHIRDGLRKLGLTTPLIGDFHYI
FT                   GHKLLAEYPACAEALDKYRINPGNVGFKAKRDTQFADIVEIAIKNNKAVRIGANWGSLD
FT                   QELLTKLMDENAASAQPRDVRAVTREAMVQSALLSAARAEEIGLPKTKMVLSAKVSAVQ
FT                   DLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPG
FT                   GDRTLEVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRVEMPSWK
FT                   TRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGESPAAPVFVDGEKFRTLRGENI
FT                   AGDFKALVIDYIEQRYGAAPKPGAAQMVPAAE"
FT   gene            complement(584355..585272)
FT                   /locus_tag="RPB_0523"
FT   CDS_pept        complement(584355..585272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0523"
FT                   /product="Protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05234"
FT                   /db_xref="GOA:Q2J2S6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S6"
FT                   /protein_id="ABD05234.1"
FT                   /translation="MSAQIGGAAARPLTAGAIALMLLCCFSWGFNQIAVKLVLPDIPPF
FT                   LQAAIRSAGAMIVILIIARARGVKLFQRDGTLKAGLLAGVLFGLEFVLIYYGLTLTTAS
FT                   RGVVFLYVAPFVVALGAYHFLGERLRAMQWAGLALSFAGVAVAIGVPQPNVDAKVLLGD
FT                   LMLVGGGALWGATTLVVKASPLQRAPAEKGLAYQVALSVPILLFAALIAGETIEQTPTP
FT                   LSLALMAYQSIWVVGLTFLLWFGLVKTYSASKLSAFTFFTPLFGVAAGYLILHEPLTPA
FT                   FGFAALLVMAGLYLVNRPGKVPAL"
FT   gene            complement(585399..585887)
FT                   /locus_tag="RPB_0524"
FT   CDS_pept        complement(585399..585887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0524"
FT                   /product="putative ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05235"
FT                   /db_xref="GOA:Q2J2S5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S5"
FT                   /protein_id="ABD05235.1"
FT                   /translation="MTALKPAFPAPGHDHDRCAAEGIEHAERICADRSQNLTPIRRQVL
FT                   RALLSSHRPLGAYEVIDELARVMPRPAPITVYRALDFLMQNGLVHRIESRNAFLACGRE
FT                   HDDASAVAFLICESCGSVGEIPATAVAQSLSEAARQTGFTPKLSVVEITGVCGHCQST"
FT   gene            complement(586052..587260)
FT                   /locus_tag="RPB_0525"
FT   CDS_pept        complement(586052..587260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0525"
FT                   /product="Beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05236"
FT                   /db_xref="GOA:Q2J2S4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S4"
FT                   /protein_id="ABD05236.1"
FT                   /translation="MADVFICDAVRTPIGRFGGSLAKVRADDLAAVPIKALMAKHPDLD
FT                   WSAVDEVFFGCANQAGEDNRNVARMATLLAGLPDSVPAQTLNRLCASGLDAVGAAGRAI
FT                   RAGEIDLAIAGGVESMTRAPFVMGKAGEAFSRQADIFDTTIGWRFINPLMKAQYGVDAM
FT                   PETGENVAEEFQISRADQDAFAIRSQQRAGAAIAAGYFAQEIAPVSAPGGKAGPIIVDK
FT                   DEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAAMIVASEAAVKKHGLTPRAK
FT                   ILGLASAAVPPRIMGIGPVPATRKLMERLGLKISDFDLIELNEAFASQGIACLRQLGVA
FT                   DDADFVNPHGGAIALGHPLGMSGTRLALTAVHGMEARGGKLALATMCVGVGQGVAMAIE
FT                   KLN"
FT   gene            complement(587348..588187)
FT                   /locus_tag="RPB_0526"
FT   CDS_pept        complement(587348..588187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0526"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05237"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S3"
FT                   /protein_id="ABD05237.1"
FT                   /translation="MTSTPRTWFITGTSSGFGRAMTEQLLARGDRVAATLRRPDALDDL
FT                   DQHYGDRLWIAQLDVTDSAAVSTVVERAFAELGRIDVVVNNAGYGLQGAAEELSDAQIR
FT                   HQIDTNVIGSIQIVRATLPHLRAQGGGRILQLSSMGGQVTFPGLSLYHASKWAIEGFIE
FT                   AVAQEVSPFKIGFTIVEPGAARTGFGSGLVNAEPLASYDDTPVGEIRRAFAAGLFPVPG
FT                   DAQKMAQAMIDSVDCTPAPLRLTLGSDAYAMVRANLVERLAALDAQKAVALSTDRDG"
FT   gene            588299..589192
FT                   /locus_tag="RPB_0527"
FT   CDS_pept        588299..589192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0527"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05238"
FT                   /db_xref="GOA:Q2J2S2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S2"
FT                   /protein_id="ABD05238.1"
FT                   /translation="MNAKPDLSDLTAFAAIAAHRSFRKAANDLGVSASTLSHIMRTLEA
FT                   NLGVRLLHRTTRSVAPTEIGERLLGRLNPVLRDFDAALQDLEAWRSRPSGTLRINAAEG
FT                   AVRLLLQTVVPAFFARHPEMALDLVTEARLVDIVAEGFDAGIRIGEAVPRDMVAVRFGG
FT                   AIRFVAVASPGYLAAHPPPRTPDDLVHHACIRFRLKSGQLFRWEFARHGQELAVDVAGP
FT                   LTLDHVELMVEAAADGLGIAYVPDRTAQPYLSRGAVVGVLDEWCPKIPGLFLYYPGHRH
FT                   VPAGLRAFIDVLRHLH"
FT   gene            589261..591996
FT                   /locus_tag="RPB_0528"
FT   CDS_pept        589261..591996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0528"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05239"
FT                   /db_xref="GOA:Q2J2S1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2S1"
FT                   /protein_id="ABD05239.1"
FT                   /translation="MHRVMTIHPDIAPPPDLPAPAEPPAKVSPMMEQYHEIKAANPGLL
FT                   LFYRMGDFYELFFEDAEIASRALGITLTKRGKHQGMDIPMCGVPVERSDDYLHRLIALG
FT                   HRVAVCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLLAIARARGSS
FT                   GTDRIGLAWIDISTGEFSVTECATGELSATLARINPNEAIVSDALYSDAELGPSLRELA
FT                   AVTPLTRDVFDSATAERRLCDYFAVATMDGLAALSRLEAAAAAACVTYVDRTQLGKRPP
FT                   LSPPSREATGATMAIDPATRANLELTRTLAGERRGSLLDAIDCTVTAAGSRLLAQRLAA
FT                   PLTDAAAIARRLDAVEVFVVAPALREQIRSALRAAPDMARALARLSLGRGGPRDLASLR
FT                   DGIVAADQGLQQLSQLTAPPQEIAAAMAALRRPSRDLCDELGRALADDLPLQKRDGGFV
FT                   RDGYEAALDETRKLRDASRLVVAAMQARYADDTGVKGLKIRHNNVLGYFVEVTAQHGDR
FT                   LMAPPLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELEIFDRLAALIETA
FT                   GEDLRAAAHAFALLDVATALAKLASDDNYVRPEVDQSLSFAIEGGRHPVVEQALKRAGE
FT                   PFIANACDLSPGPAQASGQIWLLTGPNMAGKSTFLRQNALIALLAQTGSYVPAARARIG
FT                   IVDRLFSRVGAADDLARGRSTFMVEMVETAAILNQATERALVILDEIGRGTATFDGLSI
FT                   AWAAIEHLHEQNRCRALFATHYHELTALSAKLPRLFNATVRVKEWRGEVVFLHEVLPGS
FT                   ADRSYGIQVAKLAGLPASVVARAKSVLAKLEANDRGQPKALIDDLPLFAITARAPAEPS
FT                   PPSEAEQLIAAVQALHPDELSPREALDALYALKAKLPKTT"
FT   gene            complement(592060..592980)
FT                   /locus_tag="RPB_0529"
FT   CDS_pept        complement(592060..592980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0529"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05240"
FT                   /db_xref="GOA:Q2J2S0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2S0"
FT                   /protein_id="ABD05240.1"
FT                   /translation="MTPASPAARSALRSGIISAAATGCLAFALLASPMARAQDANPVLA
FT                   KVNGAEIRQSDVTLAEEELGPSLAQMDPATKKENVLSFLIDMKIVAKAAEDKKIADRAE
FT                   FKKRLEFARNRLLMDDLLGVEGKAATTDEAMKKVYEDAAKQISGEQEVHARHILVETED
FT                   EAKAIAEELKKGADFAELAKKKSKDPGASDGGDLGFFTKDQMVPEFSAVAFALEPGKIS
FT                   DPVKSQFGWHIIKVEEKRNRKPPTFDQVKPQIEQYVTRKAQSDYVTQLRQAAKVERLDK
FT                   PAEPAASPADAAKPAEPAAKAPAKK"
FT   sig_peptide     complement(592867..592980)
FT                   /locus_tag="RPB_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            593320..596160
FT                   /locus_tag="RPB_0530"
FT   CDS_pept        593320..596160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0530"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05241"
FT                   /db_xref="GOA:Q2J2R9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2R9"
FT                   /protein_id="ABD05241.1"
FT                   /translation="MIGAFARKLFGSSNDRRIKAYQARVAAINALEPEVAALSDEALRA
FT                   RTDEFRAQLAAGKTLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLACYLNALAGKGVHVVTVNDYLASRDAGWMGQIYSFLGMSTGVIVHGLDD
FT                   GQRQKAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRGHFFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSEFYNTIDTFIPSLDKSDYDVDEKQRSVALTEAGMEKIETLLRDAGQLK
FT                   GESLYDVENVSVVHHINQALRAHTLFQRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYGKLAGMTGTAATEADEFYDIYKLEVVEI
FT                   PTNLPISRLDEDDEVYRTQAEKYAAILAEVERANKRMQPVLVGTASIEKSEVLADLLLK
FT                   NGYKQIDFGDPKGLDKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIPQETAGITDEAEKAAKVEQIKADIERFRDIVLNAEDEIEIE
FT                   PAKGSKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLDDDLMR
FT                   IFGSGKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRIDLMKEDSVVETVTDMRHTYIEDLVAKHVPEHAYAEQWDVAGLKDELHRVV
FT                   GLEIPVDEWAKEEGIADEELLARIVKVFDEHMAAKVAQWGPDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFGLFQEMSAHLREAVTAQLMRVEIIP
FT                   PDQPQELPPMEVHKMDPNTGEDEMAFANVSLAPADSVDKSARDPNRPETWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
FT   gene            complement(596465..597922)
FT                   /locus_tag="RPB_0531"
FT   CDS_pept        complement(596465..597922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0531"
FT                   /product="Protein of unknown function DUF949"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05242"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R8"
FT                   /protein_id="ABD05242.1"
FT                   /translation="MTRTPLLRALLASAAIAASAVLAGCNSDQMSLARNAKANQPVPPK
FT                   LVAAMQDKNMDLQSPILVRLFKQEAELEVWKQDRSGVYALLKTYPICRWSGDLGPKIRE
FT                   GDRQAPEGFYSISPGQMNPQSSYYLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYA
FT                   MTDEQIAEIYALGRESFFGGQRAFQLQAYPFKMTPVNFAKHRNNPNMPFWRMLKQGYDH
FT                   FEVTRQEPKVDFCEQKYVFDAAPPPGATKPLAFNASAKCPAYTVPADIADAVREKDHKD
FT                   QTKLAELISKGTPVARLRTGIDGGMHQVFASKIPDASTGLSEADDSSPVALAAFDRAPG
FT                   TIPPTVNPPRPSDNLLQKASETTAVAATTAPSTPRVASATKDDIGGLLSGLSRRVGSGE
FT                   TTASTTPPPSSPPQVVTARRQDTMPAPPRPQAAVPKPADTKQAATKPQLKPSVDTGAAK
FT                   PATTATITGAAPVVSSNNFDSRFSAFR"
FT   sig_peptide     complement(597851..597922)
FT                   /locus_tag="RPB_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.716 at
FT                   residue 24"
FT   gene            complement(598297..599259)
FT                   /locus_tag="RPB_0532"
FT   CDS_pept        complement(598297..599259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0532"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05243"
FT                   /db_xref="GOA:Q2J2R7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2R7"
FT                   /protein_id="ABD05243.1"
FT                   /translation="MSEPMRSYLDFEKPVAELDSKIDELRALAASGSDIHEEVAKIEEK
FT                   AVQALNELYATLTPWQKTQVARHPQRPHCVDYIEGLITEFTPLAGDRKFGEDEALIGGF
FT                   GRFRGESICVIGQEKGSSTETRLKHNFGMARPEGYRKAVRLMDMADRFGIPVLSLVDTA
FT                   GAYPGIGAEERGQAEAIARSTDACLSLGVPNVAVVIGEGGSGGAIAIATANKVLMLEHA
FT                   IYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILPEPKGGAHRDPAAM
FT                   IATTGDAIAAAFAELAGLDAGTVRARRRQKFLEIGRKLG"
FT   gene            complement(599413..600456)
FT                   /locus_tag="RPB_0533"
FT   CDS_pept        complement(599413..600456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0533"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05244"
FT                   /db_xref="GOA:Q2J2R6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R6"
FT                   /protein_id="ABD05244.1"
FT                   /translation="MRKPRARFSPSASVPATAAGEREAAPLRPTSYSDAGLSELFLDMI
FT                   AAEQGASANTLDAYRRDLADLSHYLGRRRKSIASADTEALRGYLADLDTRGFASTSVAR
FT                   RLSALRHLFRFLLSERIRVDDPAAILSGPKRGRGLPKVLSIADVDRLLGCARQEADAAE
FT                   GAAGLRAARLYCLLEVLYATGLRVSELVALPRTAARGDARMIVVRGKGDKERLVPLNGS
FT                   SKAAMTRYLATAAAAEKAAAGGKKTAAPASKWLFPSFGESGHLTRQHFARDLKELAARA
FT                   GLPPRLVSPHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEDRLKSLVRD
FT                   LHPLAEG"
FT   sig_peptide     complement(600400..600456)
FT                   /locus_tag="RPB_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.864) with cleavage site probability 0.556 at
FT                   residue 19"
FT   gene            complement(600474..600620)
FT                   /locus_tag="RPB_0534"
FT   CDS_pept        complement(600474..600620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05245"
FT                   /db_xref="GOA:Q2J2R5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R5"
FT                   /protein_id="ABD05245.1"
FT                   /translation="MPTLFRFLSVVAVIGGLIYGAIFALANFTAPKSRDITVVVPQDKF
FT                   LKK"
FT   sig_peptide     complement(600540..600620)
FT                   /locus_tag="RPB_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.654 at
FT                   residue 27"
FT   gene            600799..601416
FT                   /locus_tag="RPB_0535"
FT   CDS_pept        600799..601416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0535"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05246"
FT                   /db_xref="GOA:Q2J2R4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R4"
FT                   /protein_id="ABD05246.1"
FT                   /translation="MSDSAPSAAAARSQQEAEIVAALGERPVVLIGMMGAGKSTVGRRL
FT                   ALRLGLPFLDADTEIEQAAAMTIPEIFETHGEPHFRDGEARVIARLLDGGAKILATGGG
FT                   AFMREETRARIRDKAISMWLEAEADVILRRVKRRADRPLLQTADPAGTIARLIGERYPV
FT                   YRGADLTIASRDVPHEKIVDECVAALHDYLCSAPAPTLSETP"
FT   gene            601413..602561
FT                   /locus_tag="RPB_0536"
FT   CDS_pept        601413..602561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0536"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05247"
FT                   /db_xref="GOA:Q2J2R3"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R3"
FT                   /protein_id="ABD05247.1"
FT                   /translation="MTAPLNHSAPIKVEVALGDRAYDIVIGRNVLGTLGERIAKLRPGA
FT                   RTAIVTDRTVARTWLAPTEAALDAAGIAHARVVVGEGESSKTYAGLAEVSEALIAAKIE
FT                   RNDLVIALGGGVVGDLAGFAASILRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   LGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAEIVSGGP
FT                   AREHAIATSCRAKAAIVARDERENGERALLNLGHTFGHALEAATGFSDRLFHGEGVAIG
FT                   MVLAARFSAERGMMPEADAIRLQRHLADVGLPTRLQDIAGFAQEGLADADALLALMTQD
FT                   KKVKRGQLTFILMEGIGRAVIADKVEPAPVRDFLARQLARAS"
FT   gene            602558..603901
FT                   /locus_tag="RPB_0537"
FT   CDS_pept        602558..603901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05248"
FT                   /db_xref="GOA:Q2J2R2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R2"
FT                   /protein_id="ABD05248.1"
FT                   /translation="MSEREIMDWVTSGIVIACLFGSAFFSASETALTAASRANMMRLAK
FT                   QGSRNAGIVGRLLATRERMIGALLLGNNIFNIGASALATGLFTAWFGEFGVLYATAVMT
FT                   ALVVIFAEVLPKTVAINAPDRFALLVAKPMRLMVLVLGPLLTVIEALVRVLMRLLGIKV
FT                   GAHQSLLSATERLRGAVELIHHEGGVAKHDRDMFGGLLDLSELQVSDVMVHRTEMVMVN
FT                   ADLPPEELVREVLATEYTRIPLWREKPENIIGVLHAKDLLRAMRAADGDAGKIDVNKIA
FT                   LPPWFVPEMRLVSEQLKAFRSRKTHFALVVDEYGEVEGMVTLEDILEEIVGDISDEHDV
FT                   VVAGVRTQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTIAGLVIHEARSIPVRGQSFT
FT                   FHGFRFRVLRRERNRITALRIVPVLRETEAELADKKSGKIARIGGPAA"
FT   sig_peptide     602558..602653
FT                   /locus_tag="RPB_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.659) with cleavage site probability 0.284 at
FT                   residue 32"
FT   gene            complement(603920..604189)
FT                   /locus_tag="RPB_0538"
FT   CDS_pept        complement(603920..604189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0538"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05249"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R1"
FT                   /protein_id="ABD05249.1"
FT                   /translation="MGVKDSLTQKLREAFTPESLEVIDESNLHEGHAGHSGRSESHFRV
FT                   NIVSGAFAGKSRIDRHRMVNELLAAELSGGVHALALKARAPGEA"
FT   gene            604294..604941
FT                   /locus_tag="RPB_0539"
FT   CDS_pept        604294..604941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0539"
FT                   /product="Heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05250"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2R0"
FT                   /protein_id="ABD05250.1"
FT                   /translation="MAIDSSKFFDKIRVKPTKAAAAKEAAREQVIMCDAPGCANRGAHR
FT                   APKGRGLEKDYWHFCLNHVREYNQGYNFFEGMNADAVARYQKDALTGHRPTWKMGQNGA
FT                   KSRTKNPEDLAGAADPFNVINEFNGRSRWRRGPDPSAEQTKSEPRKVFNAERKALQVMG
FT                   LDSDATLEVVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRT"
FT   gene            complement(604962..605588)
FT                   /locus_tag="RPB_0540"
FT   CDS_pept        complement(604962..605588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0540"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05251"
FT                   /db_xref="GOA:Q2J2Q9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q9"
FT                   /protein_id="ABD05251.1"
FT                   /translation="MNAVLDALIAFASAHRELAYLTLFTAALLEAVPVLGTLVPGSTII
FT                   LALSALIPGGQLDLVGVLAAAAAGAALGDGAAYWIGHRQQRRILSAWPMARYPELVARA
FT                   EAFFVRFGGWAVLFARFVPPIRAFVPITAGALQMPPARFFAINIPAILLWAPAHVLPGV
FT                   VAATALEQAHGRWHHWLPVVAGVAGVVVLAGWLLWRRRRGKAQAT"
FT   gene            605872..606867
FT                   /locus_tag="RPB_0541"
FT   CDS_pept        605872..606867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0541"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05252"
FT                   /db_xref="GOA:Q2J2Q8"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q8"
FT                   /protein_id="ABD05252.1"
FT                   /translation="MTAATTKAQEITGLPDMKVSVRQVFGIDSDLEVPAFSEADPHVPD
FT                   VDSDYRFDRATTLAILAGFARNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDSHI
FT                   SRIDLVGKDSIVVRDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRVLEV
FT                   SGRLTLLDQNKVIKPHPAFRLFATANTIGLGDTSGLYHGTQQINQGQMDRWSIVTTLNY
FT                   LPHDEEVEIVLAKAKHYRNPEGRDIVNKMVRLADLTRNAFANGDLSTVMSPRTVITWSE
FT                   NAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNVAMT"
FT   gene            606952..607452
FT                   /locus_tag="RPB_0542"
FT   CDS_pept        606952..607452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0542"
FT                   /product="Protein of unknown function DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05253"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q7"
FT                   /protein_id="ABD05253.1"
FT                   /translation="MTTSSKLRPQPEPSATSSPCYEGDLYGWVQHQVALLKAGKLSEID
FT                   AGNVAEELSDVGSEQYDKLESAIRVVLLHLMKWDHQPTHRSKSWVFSIRTQRRHIVKVL
FT                   KKNPSLRPHIPEAIGDAYHDARDEAQQETGLPASVFELTCPYDWDAIQSRAVEFEDIRS
FT                   PEE"
FT   gene            607462..609357
FT                   /locus_tag="RPB_0543"
FT   CDS_pept        607462..609357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0543"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05254"
FT                   /db_xref="GOA:Q2J2Q6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q6"
FT                   /protein_id="ABD05254.1"
FT                   /translation="MTTSNTKFRTGSKEAPTEPFKRAVTSCLRAIAKTPELEVSFAAER
FT                   PGLSPGKARLPEPARKMSKRDAAIVRGHADSIALKLACHDPKVHRKLMPGNPQARGVFE
FT                   AVEQARVEALGARRMAGVAKNLTAMLDDHFHRGKFDEITDRADAPLSDALAMLVRERLT
FT                   GLAPPAAAKKLVDLWRPVLEDKIGPKLDELERFAENQAKFGDALHDLLDVLELGDDRDA
FT                   DSDEEENQDDKQEGENDQSGAEGTPESEAAQEMSADQAEATSDDLSDSAMESAQASASD
FT                   AFDDSETGEDDTPGEATRPNNRGANEPRGPEYHAFAPKFDEVVAAEDLCDHDELERLRS
FT                   YLDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGILDPARLSRVVTDPFHPLSF
FT                   MSEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRAW
FT                   KGGQSREAWLAAGKPASPGRLNDLRHIIYKSADAPWRRARRNLGLMMREGLLKENIDGE
FT                   ALDWAHKRLLGRSEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIEEIETRSPVE
FT                   LIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETADVPAPGRRRRLHS"
FT   gene            609374..610528
FT                   /locus_tag="RPB_0544"
FT   CDS_pept        609374..610528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0544"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05255"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q5"
FT                   /protein_id="ABD05255.1"
FT                   /translation="MTRPTAHSAELKVHSASKGAGALPLPSPQAGGETTRRRFLAGSLA
FT                   IGALACFPALGPRPALAQATKAELDAYSIPAAERIAVRARPIDQFDLRDRGGRRFGALQ
FT                   FRSGLILTSPFRGFGGLSALRLDPKGERFVAISDRGVWFTGRIVYDGAAMAGVADVEAA
FT                   PLLGPDRQPLTKSKWYDSEALAFDGGTAYVGYERVNQIVKFDFGRDGVRASGQPIAVPP
FT                   GLRKLPNNKGIESLVVVPKGLPLAGTLIAISERGLDAGGNVVGFLIGGKTPGPFAVRRS
FT                   DNFDVSDAVLLPSGQLLILERKFSWIEGVHIRIRRIALATLVPGATVDGPVLFNADLGH
FT                   EIDNMEGLDAHQDAAGDTVLTMVSDDNFSMLQRTLLLQFTLVDD"
FT   gene            complement(610543..613704)
FT                   /locus_tag="RPB_0545"
FT   CDS_pept        complement(610543..613704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0545"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05256"
FT                   /db_xref="GOA:Q2J2Q4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q4"
FT                   /protein_id="ABD05256.1"
FT                   /translation="MKLSTRLTLAMVALVLVTTAVLGFLNYRSIVELVMPRALLQLQTR
FT                   SQLHALLMDAYLRGTRADAVSAQASTTLRDLLANRDRAGEATPDWRRRIEDRFAAEMAG
FT                   KPNSAILRILGPDDGGRELVRVDRLGPNGTIRATPAAQLTRRGDRGYFKQGMALPPGEV
FT                   AISRIELNKTATGLEIPHVPTVRIMAPIDAGDGTRLGVLVINTNLGALFERVRNSVVVG
FT                   NLTYIVNDAGDYLLHPDRSREFGFDFGRPSRVQDDFPAFAALLDGKDTTPRVIEDRTGQ
FT                   RFGAGWGWVRLADGPTIGVIEMRPYQSLTSVQTAVRNSTLTGGAVAVLVAMLMAFPLAK
FT                   SLTRPLVRITRSVQAFARGEKLELAPGGGQEIKLLAEAFSQMTREAERKAIALAEEAEE
FT                   RSRIAGVLQNTIDNMVDPVLVADARGMVMLTNPAARDLFGTLSGVGLLNTTRSFDRYYP
FT                   DGTPLPPDQSPLLRAYRGETIVNFEFMVQPIGSDRRSYLIANGRPLRSETGENQGAVMV
FT                   YHDITQTKTAEKALRRSEQMARAIIDTALDAFVQIDALATITEWSPHAEEMFGWRRAEA
FT                   IGRNVFKLIIPPDQFEQRTEEFKQFASTLGRDSSGFRVEIESIRNNGTPIPLEVAMTAL
FT                   YRDGSFVINAFLRDLTEKIAFEEQLRQSQKMESIGQLTGGIAHDFNNMLTVITGTIDII
FT                   SDGVAEQPHLANIAKLISEAADRGAELTRLLLAFARKQPLRPDDTDVNALVAGLQSLLR
FT                   PTLGEQIEVETSLADNVWPIYVDRGQLESALVNLAVNARDAMPNGGKLTLETCNIVVDQ
FT                   EFARRLGNVEVGSYVMIAITDSGCGIPEAIRGKVFDPFFTTKDIGKGTGLGLSMVYGFI
FT                   KQSGGHITLYSEEGLGTTFRLYLPRATAEIERQAPATSEQGAIGGTETILVVEDDAMVR
FT                   SYVNAQLKSLGYTTLSVGNATAALSIGDSDTQFDLLFTDVVMPGPYNGVQLAAEMSLRR
FT                   PGLKVLFTSGYSENALIHNDRIDSDILLLSKPYRRSDLARMIRLALSPAADTVTAAGEV
FT                   DNATV"
FT   sig_peptide     complement(613633..613704)
FT                   /locus_tag="RPB_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.938 at
FT                   residue 24"
FT   gene            complement(614034..614339)
FT                   /locus_tag="RPB_0546"
FT   CDS_pept        complement(614034..614339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0546"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05257"
FT                   /db_xref="GOA:Q2J2Q3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2Q3"
FT                   /protein_id="ABD05257.1"
FT                   /translation="MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGR
FT                   PVRLRVSTNALKSVDHRGGLDAFLLKASVAELSPKAAELKRAIAKKKAAEPAAAAS"
FT   gene            614643..615533
FT                   /locus_tag="RPB_0547"
FT   CDS_pept        614643..615533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05258"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q2"
FT                   /protein_id="ABD05258.1"
FT                   /translation="MNIPVSFATRRTAIAALLRSRWSAGVLAAVLASGLAAASPAAAQG
FT                   KLDARYEATLAGIEVGKGAWVIEVTDDGYAAAANGATSGVMQAFSRGHGSGEAQGRIVN
FT                   GQFAPMNYMAITASAKKIETIRITLANGNVKESSIEPEQPPDADRIPVTDAHRRGVVDP
FT                   MTGSFLRVPGTGDLMSPESCRVSTPIFDGRMRYDLRLDYKRTEMVKAEKGYQGPVLVCG
FT                   VYFTPVSGYIPDRAAIKYLTEQRNMEVWLAPIAGTRVLVPFRMKIPTPLGNAVLQATQF
FT                   VTTATPPKSAASRTQ"
FT   sig_peptide     614643..614774
FT                   /locus_tag="RPB_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.859 at
FT                   residue 44"
FT   gene            615831..619268
FT                   /locus_tag="RPB_0548"
FT   CDS_pept        615831..619268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0548"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05259"
FT                   /db_xref="GOA:Q2J2Q1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q1"
FT                   /protein_id="ABD05259.1"
FT                   /translation="MPHSFSAPFTNAPFTNDRAPGAGVTAVLGPTNTGKTHLAIERMVA
FT                   HPSGLIGLPLRLLAREVYNKIVDRVGPDAVALVTGEEKIKPPKARFWVSTVEAMPRDLD
FT                   VSFLAVDEVQIAADLERGHVFTDRLLRRRGRDETLLLGAATMRPIIERLLPGASIVTRP
FT                   RLSQLEFAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQ
FT                   VAMFQSGDVDYLVATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLNPSEFAQIAGRAGR
FT                   ATRDGTFGTTGRCAPFEPELVNALQNHTFDTVKTLQWRNSTLDFASVAGLQVSLAETPR
FT                   HDALTRAPVAEDVRVLDHAARDAEVREMAHGAAAVERLWDVCQVPDYRKIAPAAHAELV
FT                   TTLYRFLMRKGRIPDEWFAAQVEQANRIDGGIDTLSARIAQIRTWTFVANRADWLADPE
FT                   HWQGISRDIENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHV
FT                   IGRLDGFTFAPDAAEAGSDAKALQATAQKALAGEIESRAEKLSNAPDEQFVLTSDGTVR
FT                   WTGDAVARLVGSDDVLRPRLRIIADDRLAGAPREAVQTRLDLWLKTHIEKILGPLFELG
FT                   KAEDITGIGRGIAFQLIEALGVIERAKIATEMKDLDQPSRATLRKYGVRFGAYHIYVPS
FT                   LLKPAARALASLLWAQKLDNVDMSALSGAQHLASSGRTSFPADKALDRDAYRVLGYRLC
FT                   GERAVRVDILERLADLIRPALAWREGTSGEKPAGAFDGRSFVVTQAMTSLTGSAGEDFA
FT                   SILRALGYRMEKRPAPPPQPKVAETAPAAAAADAPAAASDTGLSAEDHAILAGAIAFEP
FT                   AVTVEADIDTDTDQPAATEAAAEPVAEAAAEATPELAAPAEPATDSPVETAAAAPTTEA
FT                   SATDAPAAEAVASEETASDETAPVADVAASDAPAPEAAPTETTVDATSAPTSEVAAPAQ
FT                   PDMVEVWRPGGRSDEHRARPDRNRQRHRPQQGGQAAAPAEGEAAGEAKRDRPGGGRRGD
FT                   RKGGGDFRRDRPREGDGAPPQATAGEGRPPRERFKGRDNKFGDKFKGGGKGGRDQGASH
FT                   RQVASSAPPRERDRPIDPNSPFAKLAALKEQLTAGRKE"
FT   gene            619310..619579
FT                   /locus_tag="RPB_0549"
FT   CDS_pept        619310..619579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0549"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05260"
FT                   /db_xref="GOA:Q2J2Q0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2Q0"
FT                   /protein_id="ABD05260.1"
FT                   /translation="MERQRLDKWLWHARIVRARSTAAALVESGHVRVNGVREKSPGHGI
FT                   KTGDVVTIALDRSVRVLKVIGFAERRGDAASVTGLYADLEVPRE"
FT   gene            619654..619992
FT                   /locus_tag="RPB_0550"
FT   CDS_pept        619654..619992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0550"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05261"
FT                   /db_xref="GOA:Q2J2P9"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P9"
FT                   /protein_id="ABD05261.1"
FT                   /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCGV
FT                   CEPECPADAIKPDTEPGLEKWLELNSEYAKTWPNLTQKKDSPDDAKTFDGVEGKFEKFF
FT                   SPEPGTGD"
FT   gene            620124..621413
FT                   /locus_tag="RPB_0551"
FT   CDS_pept        620124..621413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0551"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05262"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P8"
FT                   /protein_id="ABD05262.1"
FT                   /translation="MCYIWHITNSARGFAAGKGSRQKQRTGAWRFHAQAVSQKTRKMSV
FT                   SSKGAKRGAAAGRSATNRSSMSAKDTRTVKSPASKAVAAKTTAPKATASKTAASKATVS
FT                   KTKASVSQASVSKASSSKAAAAKASAAKATAKTTTAKGSAARASAPKAAALKSSKNKRS
FT                   AMPSKTAKTAAAAPASKAAPAKSTAKPAAAKAPVAPPRAAPPKAAAKPEVKPVAVKPAA
FT                   PPKVEEPKKVVTQRQGFKASEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMT
FT                   LRVPTAKVANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAI
FT                   AEVVRDLFRSDSQPEQSYSERQLYEAALDRLSREIAVVQQVTETEAVKEVEGQLAKSPR
FT                   RGAKAEADAEGDAEGDLDGDTDDAVTDEAA"
FT   gene            complement(621810..623303)
FT                   /locus_tag="RPB_0552"
FT   CDS_pept        complement(621810..623303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0552"
FT                   /product="Peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05263"
FT                   /db_xref="GOA:Q2J2P7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P7"
FT                   /protein_id="ABD05263.1"
FT                   /translation="MIASEGRRSIWRSRRWLAVPVLAGALALAGCGDFRRFETASIPSS
FT                   TPAAKPSRPAAQSPAAEREHERILATYGGAYDDPRLEALITATVDRLVAASDRPDLTYK
FT                   VTILNSGAVNAFALPTGQLYVTRGLVALASDTSELSSVLSHEMAHVLAKHAAIREDQAR
FT                   QAALVTRVVTDMGTDPEMTALALAKTKLSMASFSRQQELEADGIGVGISARAQFDPFGA
FT                   SRFLTAMERNAALKAGRGDARSQDFLASHPATPERVRNAQNNARQYASPEQTAKGERDR
FT                   ETYLNAIDNIVYGEDPSEGFVRGRRFLHPKLGFTFQVPESFTLDNTAQAVIGIREGGSQ
FT                   AMRFDVVRVPAEQSLGDYLNSGWMENVDKSSTEELSINGFPTASVAARGDQWQFKVYAL
FT                   RFGSDVYRFIFATRQKSAESDRNSRDTVNSFRRLTLDEIQAARPLRIKVITVQPGDTVE
FT                   SLSHRMSGVDRPLDRFRVLNGLDANATVKPRDLVKIVVD"
FT   gene            complement(623324..624133)
FT                   /locus_tag="RPB_0553"
FT   CDS_pept        complement(623324..624133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0553"
FT                   /product="SNase-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05264"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P6"
FT                   /protein_id="ABD05264.1"
FT                   /translation="MAAATTTTRRRRRCVAMIRYVAIMVVALPSIGGTARAACVGLPEQ
FT                   GDGVVAAVDDGRHVRLQDGREIRLAGIEIESSRQAEATAALASLARARRVGLRGAEDVP
FT                   DRYGRQPAFVVVDDDATSLQARLLGAGEAMVGLGIADSDCRAELLAAEATARMAQRGLW
FT                   ADPTALKNAGNPGDIMARVGRFTVIEGRILSVRETGGTIYLNFGRRWTRDFAVTISRRI
FT                   LGSFEAAGISPKSLENKRIRVRGWVERRSGPQIRIREVGQIEMPGAR"
FT   sig_peptide     complement(624020..624133)
FT                   /locus_tag="RPB_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.792) with cleavage site probability 0.631 at
FT                   residue 38"
FT   gene            624346..625554
FT                   /locus_tag="RPB_0554"
FT   CDS_pept        624346..625554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0554"
FT                   /product="ureA/short-chain amide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05265"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P5"
FT                   /protein_id="ABD05265.1"
FT                   /translation="MRPIRTTLLACLSIAAISAAQAQSQPPLKLGAILDMSGLYADITG
FT                   TGSETAAKMAAEDFGGTVLGRKIEIIAADHLNKADLAASIARDMIDNQGVEAIIDVAAS
FT                   ATALAAGEIAKARNKIIMYSGPGSVRLSNEACGPYTIHYSYDTFAQANVAGLASVKQGL
FT                   DTWFFLSADYAFGQDLERDTTNVVKASGGKVLGSVKHPINTSDFSSFLLQAQSSNAKVI
FT                   GLANAGGDTINAIKQAAEFGITRKGGQKILPLLAFITDIDSIGLETAQGLLIAGAFYWD
FT                   MNDETRAFSKRFMERTKRVPTSAQAGLYSETMHYLQAVKAAGTTDAAAVMKKMKEAPIN
FT                   DFFARNGKIREDGRMVHDMYLFEVKKPSESKGRWDYYKLLATVPGDQAFQPLSASRCPL
FT                   VKN"
FT   sig_peptide     624346..624414
FT                   /locus_tag="RPB_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.904 at
FT                   residue 23"
FT   gene            625777..626565
FT                   /locus_tag="RPB_0555"
FT   CDS_pept        625777..626565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0555"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05266"
FT                   /db_xref="GOA:Q2J2P4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P4"
FT                   /protein_id="ABD05266.1"
FT                   /translation="MTDIVLQQLDRGLLTITMNRPDRRNALNQDMIRGLVEAAHRAKDD
FT                   PQVRAVLLKGGGGTFCVGGDVKSMAAAGDPPPLEQKVANLRRGMEVSRLLHQMPKPVVA
FT                   QIDGAAAGAGLSMALACDLRVAGASAKITTAFAKVGLSGDFGGTYFLTHLIGAARARDL
FT                   YLTSPVLTAPEALALGIVSRVVPDAEVESATRDLALSLAQGPSVTLGYIKTNITNAETL
FT                   SLEACFDAEALHHSRCAETADHKEAAAAFVEKRAAVFQGR"
FT   gene            626568..627332
FT                   /locus_tag="RPB_0556"
FT   CDS_pept        626568..627332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05267"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P3"
FT                   /protein_id="ABD05267.1"
FT                   /translation="MTPFLRLRQICLVADAIEPAASQLAAMMGLTVCYRDPHVGKYGLE
FT                   NLLIPVDTTLLEIVAPIQPGTAAGRFLEKTGGRGGYMAIFCCDDPDARGRHAASLGVRT
FT                   ANVIDHAPYHGVQLHPRDCRAAFIELNHTEGSDNIRGPYPPAGPDWDKAIRTDTTQALT
FT                   AVEMQSPDPADLAAHWGRILELPVRKGADGVSELQLPNATLRFVQGGSEAMMALTFKVT
FT                   DVDKVREAAKAQGVTCTADGFNLAGVNFKLTT"
FT   gene            complement(627512..628315)
FT                   /locus_tag="RPB_0557"
FT   CDS_pept        complement(627512..628315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0557"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05268"
FT                   /db_xref="GOA:Q2J2P2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P2"
FT                   /protein_id="ABD05268.1"
FT                   /translation="MTTKDIAVEVTGHVALIEIRRPPLNFFDIALIQQIADALDAIDAD
FT                   PEIRATVLAAQGKAFCAGANFGDPARQEADPQAAKGDPADSLGQIGHLYIEAVRIFRAK
FT                   KPIVAAIHGAAIGGGLGLAVSADFRVTCPEARFSANFTKLGFHPGFGLTVTLPELIGRN
FT                   NAELMFYTSRRVTGEDAVKMGLANELVPLNEVRSAALKLAREIAECAPLGLLSTRATMR
FT                   ATLADRVMEATRHELAEQTRLRSTEDFKEGVKATEERRIAHFKGR"
FT   gene            complement(628346..629506)
FT                   /locus_tag="RPB_0558"
FT   CDS_pept        complement(628346..629506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0558"
FT                   /product="Acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05269"
FT                   /db_xref="GOA:Q2J2P1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P1"
FT                   /protein_id="ABD05269.1"
FT                   /translation="MTAALRFDPIRLPPVCEELRREVRAFLAEEIAAGTFDPHKPQRED
FT                   SDAPEFSRRVGARGWLGMTWPKQYGGHERTFLERYVVTEEMRVANAPTRRFFVADRQSG
FT                   PVLLKYAPEHIKMDILPRICRGELCFAIGMSEPNSGSDLFAAKTKATRTDGGYLINGAK
FT                   IWTTSAHMADYMIAIFRTSPPTKENRRHGLTQFLVDMKSPGIKVNPIGQITGQHEFNEV
FT                   VFTDAFVPDDHLLGEIDGAWKQATSELAYERSGPERFLETSYVLIELVRALGPDPDTRG
FT                   AEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTLWEQQLPHRVRELAAF
FT                   VDADDSNHATLDELTAFATKLAPKLTIQGGTTEVLRGIIARGLGLR"
FT   gene            complement(629534..630601)
FT                   /locus_tag="RPB_0559"
FT   CDS_pept        complement(629534..630601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0559"
FT                   /product="Acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05270"
FT                   /db_xref="GOA:Q2J2P0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2P0"
FT                   /protein_id="ABD05270.1"
FT                   /translation="MTETPDTIVVETAEKIFADLADAQSINSDKTGSWKAPLWQALSDS
FT                   GLPLAWVPEDCNGSGASLAEGFAVLNAAGRAGLAVPLAETMLAGWLLAQGKIASPEGAM
FT                   TVAPVHPKDRIALAADGTLSGRARGVPFAQDARHIAVLAHSNDIAVIALVEAAACRIDH
FT                   GLGVGGDPSDAVTFDGVTPLTFAVAPQGFDQTALLLIGCVVRSLQIAGALEALLEISVA
FT                   YANQRVAFEKPIAKFQAVQHNLARLAGETSAALAAATSAADAISNATTFDDAVMLEAAA
FT                   AKIRCAEAAEKGAAIAHQVFGAIGFTSEHILHRYSLRALGWRDDFGNESHWAVALGRMV
FT                   AARGADDLWPLVASR"
FT   gene            630846..631628
FT                   /locus_tag="RPB_0560"
FT   CDS_pept        630846..631628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0560"
FT                   /product="3-oxoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05271"
FT                   /db_xref="GOA:Q2J2N9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N9"
FT                   /protein_id="ABD05271.1"
FT                   /translation="MATNGLNVIVTGSASGLGAATAKILARDGARLVINYSSSQADAET
FT                   TAEECRKLGAAEVVVVQGDVSKDDDCKRIVDAAAKWGGLDALINNAGITKHVAHHLLDQ
FT                   LSAEDFQRLYAVNTIGPYQMVRAARSLLSAGAKAAGRASAVVNVSSVAGISGVGSSIAY
FT                   AASKGALNTMTLSLSRALAPAIRVNAICPGYIDTPWFTKGRGAEEAKQVRDMVVAKVPL
FT                   KIASSPEDIAELVCFLATPKSNSMTGEMVRMDAGMHLG"
FT   sig_peptide     630846..630914
FT                   /locus_tag="RPB_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.782) with cleavage site probability 0.538 at
FT                   residue 23"
FT   gene            complement(631683..631976)
FT                   /locus_tag="RPB_0561"
FT   CDS_pept        complement(631683..631976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05272"
FT                   /db_xref="GOA:Q2J2N8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N8"
FT                   /protein_id="ABD05272.1"
FT                   /translation="MTGILWIILVGFVAGIIARFLSPGPNNPQGFLLTTVLGIAGAFLA
FT                   TAIGQMIGHYGPNQGAGFITATIGAVLVLFIWNRLVARRVISDPGNRRFLDR"
FT   gene            complement(632028..632633)
FT                   /locus_tag="RPB_0562"
FT   CDS_pept        complement(632028..632633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0562"
FT                   /product="Protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05273"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N7"
FT                   /protein_id="ABD05273.1"
FT                   /translation="MGLMDILNGMQNGPRGPADPNDKSGGMSKVTMAILALLAYKAYKH
FT                   VTAPDDQAPAGQARPTSVPSSRPPLPRDTINAGMPGGGFGGGGLGDLLKGGLGGLLAGG
FT                   AAGSILSGGLGDLLKQFQTSGLGDAAESWVGRGENKSIGPNDLANALGADQLDMLTQQT
FT                   GMSRDELLDGLSQQLPQFVDQLTPDGRLPTEDEASRWV"
FT   gene            633139..633215
FT                   /locus_tag="RPB_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            633139..633215
FT                   /locus_tag="RPB_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(633423..634421)
FT                   /locus_tag="RPB_0563"
FT   CDS_pept        complement(633423..634421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0563"
FT                   /product="Alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05274"
FT                   /db_xref="GOA:Q2J2N6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N6"
FT                   /protein_id="ABD05274.1"
FT                   /translation="MTAVNRQVLLIEKPKEKLGLEHFRMAEAAMPEPKDGEALVRVRYI
FT                   SLDAANRAWMQGATYRAAVETDSVMPGGGIAEVVSSKAPGLSPGDIVFADTGWQDYAAL
FT                   PAKHLTKLPKVEPLTHLLSVYGIAGLTAYFGLLDIGQPRAGETVVVSAAAGSVGSIVGQ
FT                   IAKLKGCRVVGIAGGKQKCDWLVNELGFDAAVDYKDGALFKALRAAAPNGIDVYFDNVG
FT                   GDILEACLAQMNLKGRIACCGAVSQYDRTPSATGPRGIPGLIVVKRLIMQGFIVMDYMD
FT                   QRDEAVAKLQGWVESGKLKVQEDVIDGLENTPAALIGLLAGENRGKRMVRV"
FT   gene            complement(634509..635825)
FT                   /locus_tag="RPB_0564"
FT   CDS_pept        complement(634509..635825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0564"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05275"
FT                   /db_xref="GOA:Q2J2N5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N5"
FT                   /protein_id="ABD05275.1"
FT                   /translation="MFDLPKYGDGICLARLAAVLDRLGIDRARLSRIAIAVCGSNGKGS
FT                   TAAFAASIGKAYGLRTGLFTSPHLLRFNERFRIDGVPIPHEALTPLLTRVTAVVADVSA
FT                   QRGEQFGAFEAQFALACLYFQQENCDLVVCEAGIGGRYDPVRLLAAGVSCVTSVDLEHT
FT                   ALLGHSLELIAADKSDACAAGGTIVYGENCRPLRDQLAEYNRSRRVDALFVRDEIGIEA
FT                   ETIVDARQRFDLRIGRAGYAALETSLLGAFQLNNAAIAATLFALWLERSAGAQNPARVE
FT                   AAIRDGLRETRWPGRLETINTAPLTVIDVGHTPDGIRQALAGLHAAHGDSGWILVLGVS
FT                   RDKAAGEIVDALAPAFDAIVCSAAHHKGAPAELIAEAARAANPHAEIHTAPAVADAVRD
FT                   ARALAARRDARIYVAGGLFLAIEFATVLRGGRAEDLRFF"
FT   gene            complement(635826..636812)
FT                   /locus_tag="RPB_0565"
FT   CDS_pept        complement(635826..636812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05276"
FT                   /db_xref="GOA:Q2J2N4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N4"
FT                   /protein_id="ABD05276.1"
FT                   /translation="MPQLQDFRRGRPGFYPDQAIYAEYACTRLGLVFRELDGGTGLLFS
FT                   VASAAKEICFGGGRCSYYPQNDATASSLATDKYLANALLQRAGVATLGGRAFFLHDRHR
FT                   ALRPPGHERSDAQDYLAALGGRAFAKPLTGSRGDFARVVDGVAAFAAYLDEVARYYDSV
FT                   LIQPVATGHEYRVFVIDGEVLYSARKRPPYVIGDGLRTLRDLLRDHDRALRDIGLSDTA
FT                   TIGAAFDKVPAAGELRAIEGRMNLSAGGAMTMADAGAAAITAATAAVRALGLRLGAVDL
FT                   FVDPDHRDDVRVIEVNSNPAIRFLETCGRDDLILSIWRHSVTATGLL"
FT   gene            637026..638657
FT                   /locus_tag="RPB_0566"
FT   CDS_pept        637026..638657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0566"
FT                   /product="Ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05277"
FT                   /db_xref="GOA:Q2J2N3"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N3"
FT                   /protein_id="ABD05277.1"
FT                   /translation="METILLPFSPRYIALTICAVLAALFAAIAIVDYDTKLFGVLLTLA
FT                   LVFGALTLLGVRDLFQKNHAVLRNYPISAHLRFLLEEIRPEMRQYFFESEKDGKPFSRD
FT                   TRALIYQRAKMVLDKRPFGTQKDVYEQGYEWMHHSVAPRPHAEERFRITIGGPDCARPY
FT                   SASVFNISAMSFGALSPNAIRALNAGAKKGGFAHDTGEGGVSPYHRENGGDLIWEIGSG
FT                   YFGCRTRDGQFDPEAFARLATDDQIKMVELKISQGAKPGHGGVLPAAKVSEEISRIRGV
FT                   AMDEDCISPPYHKAFSTPIEMLRFVAEMRRLSGGKPAGFKLCIGHPWEFLAICKAMLAT
FT                   GITPDFIVVDGKEGGTGAAPLEFMDHLGMPMRDGVSFVHNALIGVGLRDRIRIGAAGKI
FT                   ATAFDMARAMALGADWCNSGRGFMFALGCIQSLSCHTDRCPTGVTTQEPSRYRALVVPD
FT                   KIERVYNYHRATLHALAELIAAAGLDHPQDIRPIHFSQRSSSSEVVSLAQLYPTLRPGE
FT                   LLDGTDDPRFKHAWAMARAETFAAAV"
FT   sig_peptide     637026..637115
FT                   /locus_tag="RPB_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.420 at
FT                   residue 30"
FT   gene            complement(639289..641274)
FT                   /locus_tag="RPB_0567"
FT   CDS_pept        complement(639289..641274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0567"
FT                   /product="OmpA-like transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05278"
FT                   /db_xref="GOA:Q2J2N2"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N2"
FT                   /protein_id="ABD05278.1"
FT                   /translation="MIHPRRCATMRPIVTTALMLGGLVLPQAASAADALKALPSPAMDW
FT                   SGFYVGAHAGYVRGHADARLQDPTFAASQSSGSGGVTAGAQAGYNILTRAGVLFGVEAD
FT                   ISFPSYLPANAVLSEFDNATSTAQQHIDFYGTLRARLGVAAGRWLGYVTGGLAYEHERY
FT                   LTEPGAGKVLNGRIGWAAGAGLEYGFTPNWSARIEYLYSDFGNASVGLPTGARYDTAMN
FT                   LQTVRIGVNRRIDWLGSGETAPFATVADPDSDRWEIHGQTTVVGQGYPSFRAPYSGANS
FT                   LTPNAQFKSTWSSGLFANVRLWDGGELYLGPEFLQGFGLSDTVGVAGFPNGEGQKSGFA
FT                   FPHISPSRFYLRQTFGLGGEQEQLASSASQLSGKADISRLTLQVGRFSVLDAFDGNAYA
FT                   HDPRRDFMNWSIWASGAFDYAADKLGLTYGATAELNQKQWALRAGYFLMDAESNSNNFD
FT                   MRLGQRGQYVAELETRYALFGQPGKLRTLAFLNSVYAGSYRETLDNPLLNLDISQTRRG
FT                   RIKYGYALNLEQAVSDDIGVFGRWSWNDGKNEIMAFTDIDDSLSGGVSIRGLRWGRPDD
FT                   VIGIAGATNGLSRDHRDFLAAGGLGPLIGDGALNYRRENLLETYYAYAINRAWTATADY
FT                   QFIVNPAYNADRGPVSVFSARLHGEF"
FT   sig_peptide     complement(641179..641274)
FT                   /locus_tag="RPB_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            complement(641637..641897)
FT                   /locus_tag="RPB_0568"
FT   CDS_pept        complement(641637..641897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05279"
FT                   /db_xref="GOA:Q2J2N1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N1"
FT                   /protein_id="ABD05279.1"
FT                   /translation="MSLNSKFAALALTAIVAAGALATSTQAEAKGPGPAFGVAAGLFGA
FT                   AVVGSAIAAGGPYYVAGYRHCVWVPQYNYYGAYIGRVRACD"
FT   sig_peptide     complement(641808..641897)
FT                   /locus_tag="RPB_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.523 at
FT                   residue 30"
FT   gene            complement(642027..642839)
FT                   /locus_tag="RPB_0569"
FT   CDS_pept        complement(642027..642839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0569"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05280"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2N0"
FT                   /protein_id="ABD05280.1"
FT                   /translation="MTTLPPRDWTGIRWPEIGDADPARWIAVLPLAATEQHGPHLPLGT
FT                   DVIIAQAYLARVHELLPAELPATFLPLQPVGLSGEHLSFPGTLTLSTETALRLWTEIGD
FT                   SVARAGVRKLVMVTSHGGNSAAMGLVAQDLRTRHRMLAVTTGWARFGLPDGLFAADELR
FT                   HGIHGGAVETAIMLAHAPDQVRTDRIADFRPATLAMEREFRFLSAQRPAPFAWAAQDLH
FT                   RSGAIGDATAASADKGRQALDHGARAFCELLADVDRFDLEALGAAPQA"
FT   gene            642990..644114
FT                   /locus_tag="RPB_0570"
FT   CDS_pept        642990..644114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0570"
FT                   /product="perplasmic binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05281"
FT                   /db_xref="GOA:Q2J2M9"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M9"
FT                   /protein_id="ABD05281.1"
FT                   /translation="MTPAFLSRALIGAVAVALLAVPVQASPPPAPAKPAEKPAPPPPPP
FT                   KKPPPPVVQPIRKVPEGGFDKLSFGTNWVAEGEHGGFFQAVADGTYKAYGLDVTIVPGG
FT                   PNVNNRALLLAGKLDFFMTANTLQSFDAVANNVPVVAIAAVFQKDPQVFLSHPESRVEK
FT                   LEDLKRLTLFVSKEGIASYFQWLKSEYGFSEAKVKPYTSNPQPFIIDKNSAMQGYVTSE
FT                   PFVIEQKAKFKPNVLLLADDGLDGYSTLIETRRDLIDKNPEMIQRFVDASMIGWYNYLY
FT                   GDNSAGNALIKSLNPEMTDEMLAYCVDKMKQYGIVDSGDAVTNGIGAMSDARYASFFDK
FT                   MSRAGVVKRDLDFRRAYTLQFTNKGVGVDLRPNK"
FT   sig_peptide     642990..643067
FT                   /locus_tag="RPB_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            644125..644928
FT                   /locus_tag="RPB_0571"
FT   CDS_pept        644125..644928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0571"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05282"
FT                   /db_xref="GOA:Q2J2M8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M8"
FT                   /protein_id="ABD05282.1"
FT                   /translation="MAVSSSRDLDSPAAGPAIRLRAVTKTYRNGVPALGPIDLAVGRGE
FT                   FVSLLGPSGCGKSTALRLIAGLAEPSSGRIEMASQAQRGHSIGFVFQEPTLMPWTSVRG
FT                   NVGLPLKLAHAPSAEIARRVDAALARVELSDFAEAYPRELSGGMKMRASLARALVTDPD
FT                   ILLMDEPFAALDEITRFRLNDDLLALWRELGKTVLFVTHSVFESVYLAQRVVVMSPRPG
FT                   RIAADFRIDAPEPRNEDFRTSADYAAQCREVSRALAETGATKVRA"
FT   gene            644925..645749
FT                   /locus_tag="RPB_0572"
FT   CDS_pept        644925..645749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0572"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05283"
FT                   /db_xref="GOA:Q2J2M7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M7"
FT                   /protein_id="ABD05283.1"
FT                   /translation="MSESEPIELQPARLGAARLLRVLLPVVVLAAGVAAWDLVVRLNQI
FT                   PPYILPGPGLVAQTLVADWPILSASLLATLATTLQGFLAAAIGGIALALLFNQSRWVEY
FT                   SLFPYAVVLQVTPVIAIAPLLLIYLPQDTAVVACAFIVAFFPVLANTTLGLNSVDRNLA
FT                   GLFRLYGASRWQTLLRLKLPAALPYMLGGLRIAGGLSLIGAVVAEIAAGSAGAGSGLAY
FT                   RIAESGYRLNIPRMFAALLLLSAAGIVIYAALALLSHLLLRRWHESALGKEQ"
FT   gene            645749..646735
FT                   /locus_tag="RPB_0573"
FT   CDS_pept        645749..646735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0573"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05284"
FT                   /db_xref="GOA:Q2J2M6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M6"
FT                   /protein_id="ABD05284.1"
FT                   /translation="MAGETGSADAIDLLIYGPTKPVVNEGFPACYALHRCEQPADLDRL
FT                   GDDIRARIRGVAVTGLVPTQAAMLARYPKLEIVSSFGVGYDHIDSSWAAQHNVVVTNTP
FT                   DVLTEEVADTALGLLIATLREFVQADAHVRSGLWANQAYPLSKGSLRDRMVGIVGMGRI
FT                   GQAIARRLDASLVPVVYHSRKPAPGVDYKHYPDLIAMAKAVDTLIVIIPGGASTLRLIN
FT                   AEVLAALGPRGVLINVARGSVVDEPALIAALQSGTILAAGLDVFADEPNVPDELRALPN
FT                   VILLPHIGSASVVTRSAMDQLVVDNIKAWFDGKPPLTPIPETPVKGR"
FT   gene            646737..647447
FT                   /locus_tag="RPB_0574"
FT   CDS_pept        646737..647447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05285"
FT                   /db_xref="GOA:Q2J2M5"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M5"
FT                   /protein_id="ABD05285.1"
FT                   /translation="MRRCVTAAMLLLLSAAPAPAQDAAALTKAMVGQWELSTTERSRTC
FT                   VVTLKPEAAAPGIQQGAQHGMKLELEPGCAAALPFTKDIAVWTVKGLDIVRLENSAGEA
FT                   VIDFTEVESGIFEGLRANEGVYILQNLVAARSLAKSMDQMIGDWSMVRGSGRAVCGLTL
FT                   TNNEAATADNFEAFLKPRCDSLVANFGPTMWRLERGALMLIAPSGEVWRFEADDNAQWR
FT                   KTPDSADPLIMLRQ"
FT   sig_peptide     646737..646808
FT                   /locus_tag="RPB_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.844 at
FT                   residue 24"
FT   gene            647560..647802
FT                   /locus_tag="RPB_0575"
FT   CDS_pept        647560..647802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0575"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05286"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M4"
FT                   /protein_id="ABD05286.1"
FT                   /translation="MKTINLREAKATLSAVVEAAEAGEPVTITRHGKPAAVVVSVDVAR
FT                   RLYPARRGFGEFLMGFPGLPEEIERNPSPGREIDL"
FT   gene            647892..648257
FT                   /locus_tag="RPB_0576"
FT   CDS_pept        647892..648257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0576"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05287"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M3"
FT                   /protein_id="ABD05287.1"
FT                   /translation="MIAQGEAERLHLSVVTVAEIERGLRKLARAGGTARAQALSEWLRE
FT                   LIDLYGDRLLPIDAATARIAGEIEDQAIANGAHPGFADVLIAATARAHALDLLTANIKH
FT                   FRPLGISCFNPVDGLPD"
FT   gene            complement(648576..650069)
FT                   /locus_tag="RPB_0577"
FT   CDS_pept        complement(648576..650069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0577"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05288"
FT                   /db_xref="GOA:Q2J2M2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M2"
FT                   /protein_id="ABD05288.1"
FT                   /translation="MSPTAAARPSDAASSLRDRLKDPSLLREQCFIDGAWTGTAEIAVT
FT                   NPANRQELGKIPDLGAAGATAAVEAAERAFPAWAKLTAKQRSNIMRKWFELIVANREDL
FT                   ALILTSEQGKPLTEALGEVDIGAAYVEFFAEEARRVYGETIPTQRADARLIAIKQPIGV
FT                   CAAITPWNFPNSMITRKVSPALAAGCTVVLKPAEETPFSALALAVLAEKAGVPKGVFNI
FT                   VTGDAPPIGQVFCEHPAVRFVGFTGSTEVGKILYRQSAVGVKKLGLELGGNAPFIVFDD
FT                   ADIDAAVDGAMVSKYRNMGQTCVCANRLYVQDGVYDAFVEKLAAKVKAMTVGDGTEPGV
FT                   TQGPLINEAAVEKTEKHIADAVSNGAKVITGGKRHALGGTFFEPTVLADVRPDALVAHE
FT                   ETFGPLAPVFRFKDEAEVIKLANASPFGLASYFYARDLGRVWRVAEALESGMVGVNSGL
FT                   ITTEVAPFGGVKESGLGREGSHHGMDEYVEIKYVMMAGI"
FT   gene            complement(650228..650554)
FT                   /locus_tag="RPB_0578"
FT   CDS_pept        complement(650228..650554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05289"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M1"
FT                   /protein_id="ABD05289.1"
FT                   /translation="MIPTWSAWKRYPRDGRGNIEAPVSPGVYEIRNADDGSLFGFAAAD
FT                   NLAVALGQLQVQPTWLGGWFGRRSPVPMPDLEYRVCATATRADARLAAEHMINRRETWF
FT                   SRAA"
FT   gene            650887..652074
FT                   /locus_tag="RPB_0579"
FT   CDS_pept        650887..652074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0579"
FT                   /product="Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05290"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2M0"
FT                   /protein_id="ABD05290.1"
FT                   /translation="MQGGANIDQSLQQRCERGEIPGVVALAGSANEVIYQGAFGKRDLS
FT                   KPQPMTTDSVFWIASMTKAITAAAAMQLVEQGRLSLDEPIGKVLPDLAAPLVLDGFDAD
FT                   GTPRTRPAKTAITLRQLLTHTAGFCYDMWNADMVKYMERHGIPGVIGCQNAALKTPLAS
FT                   DPGTRWEYGLNIDFAGKAVEAVSGIKLDAYLRDHIFAPLGMTDTGFKIGDAQRQRLVAV
FT                   HARGEDGSLSPIPFEVAQEPEFHMGGGGLYGTAADYLKFTQMILNKGRAGGHQVLKPET
FT                   VALMSQNHIGDLNVTKLNSAIPFATNDVDLYPGMDKKWGLSFLINTETTPEGRSAGSLA
FT                   WAGLANTYYWIDPARDVCGVILMQVLPFGDGKCLDAFAGFERGVYQGLGAGQKAA"
FT   gene            652169..653899
FT                   /locus_tag="RPB_0580"
FT   CDS_pept        652169..653899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0580"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05291"
FT                   /db_xref="GOA:Q2J2L9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L9"
FT                   /protein_id="ABD05291.1"
FT                   /translation="MHGEETKDVIDKAPDKAPSYVCGVSDAPLLGITIGQALDLAAQRW
FT                   PDREALVSPSHDVRWSWREFAQRVDALAAGFLALGLERGARIGVWSMNRPEWTLTQFAA
FT                   AKAGMILVTINPAYRLSELEFALAKVGCAALVTATAFKTSAYMEMLNTLIPELAKSQPG
FT                   ALQSARLPQLRAVIQIGGPKCPGTLAFDEVATMGGDRHRQAIAQLAAELQFDDAVNIQF
FT                   TSGTTGSPKGVTLTHHNILNNGYFVGRAMKLTEQDRICIPVPLYHCFGMVMGNLASVTC
FT                   GAAMVYPGEGFDPLATLQTASSEKCTALYGVPTMFIAELDHPDFASFDLSSLRTGIMAG
FT                   APCPVEVMRRVNDQMNMREVTIAYGMTETSPVSFQSAVDDPEERRVSTVGRIHPHVEVK
FT                   VVDLEGRIVPRGVRGELCTRGYSIMLGYWDEAEKTADVLDAAGWMHTGDLAVIDDEGFC
FT                   NIVGRIKDMVIRGGENLYPREIEEFLYRHPKIQDVQIFGVADSRYGEELCAWVRVRPGE
FT                   TLTADDIRGFCQGQIAHNKIPRYVEFVDEFPMTVTGKIQKFVMREKVEAKLGLKAAKTA
FT                   "
FT   gene            complement(654151..655152)
FT                   /locus_tag="RPB_0581"
FT   CDS_pept        complement(654151..655152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0581"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05292"
FT                   /db_xref="GOA:Q2J2L8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L8"
FT                   /protein_id="ABD05292.1"
FT                   /translation="MSSAQYDVLAIGNALFDVLVRTEDDFLLRHGMAKGGMALIDEAGA
FT                   AAIYADMGMATEISGGSAANTIVGLASFGARTAYVGKIKDDQIGKLYAHDIRAAGVAFD
FT                   TRPAADGPATGCSYILVTPDGERTMNTFLGAAQDLRPSDIDEAQVAAAAITYLEGYLWD
FT                   PPQAKEAFLKASTIAHGAGRRVALTLSDAFCVDRYRGEFLDLMRSKTVDLIFANESELH
FT                   SLYQTSDFDTALKALAQDVGLGVVTRSEKGCAVVEGDSVTLVPAAQIDQLVDTTGAGDL
FT                   FAAGFLFGLVRDAGYENAGRLGALAAAEVIQHIGARPLVSLKELAQQHGLPV"
FT   gene            655394..656950
FT                   /locus_tag="RPB_0582"
FT   CDS_pept        655394..656950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0582"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05293"
FT                   /db_xref="GOA:Q2J2L7"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L7"
FT                   /protein_id="ABD05293.1"
FT                   /translation="MIRPILTVSAGTLTSRLLGFVRDALVAALLGAGAVADAFLLAFQL
FT                   VNVARRLLTEGALNAALVPAWLRVREHNGPVAAAAFAGRLLGTVALATLVLALLLGVFM
FT                   PLLIALLAPGFLGHPTLAMAVRDARLMLPYLAFAGPVAVMMGLFNANGKVGLTAFSPLL
FT                   FNILLITVTGALLLWHADETRAALILSATVGIAGLLQLGILVFNGRGERLATPLRVSFD
FT                   TATRAFFAKAIPGMIANSGPQLLIVIGAVVASGMPSAVSWLYFANRLIELPLGIVGVAM
FT                   GAVLVPELARAVRGDDRAALSDAASRGLELALGVALPATLGLIVLSGPIVRVLFEHGAF
FT                   GAADTAATAQALALLALGLPAQVLAKNWSAAFFAREDTRTPLLATLLALAVALAAALLL
FT                   GRLFGAAGVAVAIALGAWSNAALLLGRGLSRFGVTVDPVARRRVALIVLAAGVMGGLLA
FT                   LKAAFVLPLVAQASTLVQAAVLGVLIAGALIIYAALLMLFGVVRPAAALGALRRPRGLR
FT                   G"
FT   gene            657004..658056
FT                   /locus_tag="RPB_0583"
FT   CDS_pept        657004..658056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0583"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05294"
FT                   /db_xref="GOA:Q2J2L6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L6"
FT                   /protein_id="ABD05294.1"
FT                   /translation="MAITQRVFSGVQPTGNLHLGNYLGAIVNFVKLQETHNCIYCVVDL
FT                   HAITVPVTVWGGPDELRRNTREVTAAFIAAGIDPQKHIIFNQSQVAEHAELAWVFNCVA
FT                   RLGWLNRMTQFKEKAGKDRENASIGLYDYPVLMASDILVYRATHVPVGEDQKQHLELTR
FT                   DIAQKFNNDFSASIAAQGLGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRI
FT                   NLTDDADAIAQKIRKAKTDPEPLPTEEKGLEPRPEADNLVGIFAALAGKPKAQVLSEFG
FT                   GGQFSAFKSNLVDLAVEKLSPIAGEMKRLSADHGYVDSVLASGSDRARVIAAETMTAVK
FT                   DIMGMVRKKG"
FT   gene            658288..658782
FT                   /locus_tag="RPB_0584"
FT   CDS_pept        658288..658782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05295"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L5"
FT                   /protein_id="ABD05295.1"
FT                   /translation="MSSQRRSYESGHKPKCLVVVDDTAEWDRAVYYASRWAVRVGGGVV
FT                   MLRVIEIPDQNQQWLGVADVMRAEAIDIAEQALDRASGRANGVAGITPERVIREGDTIA
FT                   QIRKAIEADVDITTLVLAASDGPDGPGPIVTAMVRHLGSFPVPVVVVASSLTDDDIDAL
FT                   T"
FT   gene            658930..659496
FT                   /locus_tag="RPB_0585"
FT   CDS_pept        658930..659496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0585"
FT                   /product="Nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05296"
FT                   /db_xref="GOA:Q2J2L4"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L4"
FT                   /protein_id="ABD05296.1"
FT                   /translation="MFIQTEPTPNPATLKFIPGRVVLDSGTMEFTDRSQAARSPLAERL
FT                   FDVDGVSGVFYGSDFVTVTKDGGDWQHLKPAILGAIMEHYMSGAPILADGKTDGDAGDE
FT                   DDEFFAERDAETVEIIKDLIETRVRPAVANDGGDITFRGFKDGIVYLAMKGACSGCPSS
FT                   TATLQHGIQNLLKHFVPEVVEVRPV"
FT   gene            659647..660339
FT                   /locus_tag="RPB_0586"
FT   CDS_pept        659647..660339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0586"
FT                   /product="Peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05297"
FT                   /db_xref="GOA:Q2J2L3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L3"
FT                   /protein_id="ABD05297.1"
FT                   /translation="MLILAIDTALDACAAAVLDTGANRLLAGESQSMQRGHAEALMPLL
FT                   GRVMQSSGIGFADLDRIAVTTGPGSFTGLRVGLSAARGIALAADKPIVGLTTLSAFAAP
FT                   LVSERDDTPILSAIDARHDQVYYQLVSGNGTRLVSPRVGPIGEALETARHGAPRLVGNA
FT                   AGLLAARWPALTPPAPLIDPQPAPDIFWVAWLGAAATPEAAPARPFYLRAPDARPQADA
FT                   LARAQPAA"
FT   gene            660350..660835
FT                   /locus_tag="RPB_0587"
FT   CDS_pept        660350..660835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0587"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05298"
FT                   /db_xref="GOA:Q2J2L2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L2"
FT                   /protein_id="ABD05298.1"
FT                   /translation="MRTWLAEFWGYADAVVEPATLRDSPKLAQLHAASFHSGWSEEEFA
FT                   DLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSIAVASGYRGRGLSRELLLTHLGH
FT                   LAGHGVAKVFLEVEENNQPARRLYQRAGFEIVGRRERYYRQPDGQQLNALIMRRDLS"
FT   gene            660846..661343
FT                   /locus_tag="RPB_0588"
FT   CDS_pept        660846..661343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0588"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05299"
FT                   /db_xref="GOA:Q2J2L1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L1"
FT                   /protein_id="ABD05299.1"
FT                   /translation="MAQVLVAPSHSNDALTPMSDMKATDMKATEIEARCAATGMRMTEQ
FT                   RRVIARVLAEAVDHPDVEELYTRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRA
FT                   RYEQMRDSHHDHLINLRDGKVIEFTNEEIELLQAEIARKLGYKLVDHRLELYCVPLDDD
FT                   KA"
FT   gene            661554..662207
FT                   /locus_tag="RPB_0589"
FT   CDS_pept        661554..662207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0589"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05300"
FT                   /db_xref="GOA:Q2J2L0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2L0"
FT                   /protein_id="ABD05300.1"
FT                   /translation="MSCDLVIFDCDGVLVDSEVISCRVHAETLTRHGYPITTEQVAERF
FT                   LGRSGREARREIEAELGRAFDDALEAQLVADVLRSFAESLEPIPHINEALGALAQPVCV
FT                   ASSGTLERIAFALTRTGLHARFAPHLFSAEQVESGKPAPDLFLHAARQMGVAPARCVVI
FT                   EDSVPGILGATAAGMTVLGFVGGSHCGPGMAARLTAAGAATVFADMRQLPELIR"
FT   gene            662304..663710
FT                   /locus_tag="RPB_0590"
FT   CDS_pept        662304..663710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0590"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05301"
FT                   /db_xref="GOA:Q2J2K9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2K9"
FT                   /protein_id="ABD05301.1"
FT                   /translation="MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETASVDDADLV
FT                   ILNTCHIREKASEKVFSELGRLRLARDEASRDGRRMQIVVAGCVAQAEGDEIVRRQPAV
FT                   DVVVGPQSYHHLPRLLAQAAQTGRALETEFPIADKFGFLPQPQPEAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVAAILADVERLADHGVRELTLIGQNVNAYHGDGPDG
FT                   RPWTLGRLLQRLAAVPGIVRLRYSTSHPNDVDDDLIAAHRDLDALMPFVHLPVQSGSDR
FT                   ILAAMNRKHTAADYRRVIDRFRAVRPEIAFSSDFIVGFPGETDADFEATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAAEMPEMVPAAVMDERLERLQQVIDAQQSAFNRAAIGRTVDVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVFPPAGMAPDSLVGQILPVRVDSLERYSLLGELAATPPR
FT                   HARPLAATGA"
FT   gene            663749..664783
FT                   /locus_tag="RPB_0591"
FT   CDS_pept        663749..664783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0591"
FT                   /product="PhoH-like protein, phosphate starvation
FT                   inducible"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05302"
FT                   /db_xref="GOA:Q2J2K8"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K8"
FT                   /protein_id="ABD05302.1"
FT                   /translation="MSRRKPDRDSLTPPEAQPETQVVIAFDDNRAASALVGPYGQNLAQ
FT                   IERRLAVVVDSRGNHITIAGSREGCDAARRVLEALYAQAVAGNDLSQGDVDGAIRAVIA
FT                   QGSLFEFDAKSTAGAFEAINLRKRPVRARTAAQDSYIRALKRHELVFGVGPAGTGKTWL
FT                   AVAHAAQLFERKEVDKIILTRPAVEAGERLGFLPGDLREKVDPYLRPIYDALYDLMDSR
FT                   IVERALQTNEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGENSRMIVTG
FT                   DPSQVDLPNGQTSGLSEAVKLLAGVEGIAQVKFTAEDVIRHELVARIVAAYEGIPPKPA
FT                   GGAA"
FT   gene            664783..665370
FT                   /locus_tag="RPB_0592"
FT   CDS_pept        664783..665370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0592"
FT                   /product="Protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05303"
FT                   /db_xref="GOA:Q2J2K7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2K7"
FT                   /protein_id="ABD05303.1"
FT                   /translation="MSQFKTGSRADCIGPARGSNFGPMSHSAVPATEVVIAADCWRSEA
FT                   SAEATVLRAIEAAAAMVDADTGEAELAVMLTDDDGIRALNASYRGQDKPTNVLSFPAPQ
FT                   PDYQGAAQGSDVAPKLLGDIAIAYQTVRREADDEGKRFDHHLSHLAVHGFLHLVGYDHE
FT                   TDAEAETMEAAERRILAGLGIPDPYADQDRVS"
FT   gene            665372..666502
FT                   /locus_tag="RPB_0593"
FT   CDS_pept        665372..666502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0593"
FT                   /product="HlyC/CorC family transporter with CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05304"
FT                   /db_xref="GOA:Q2J2K6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K6"
FT                   /protein_id="ABD05304.1"
FT                   /translation="MPDGDRAQSAAQPAEQDLPRGQQLPAVVHQGEVLRPAGAAWLMRA
FT                   IRSLFGWKPGSVRDDLQVVLDTSPADDTGFSALERTMLRNILGLHERRIADVMVHRADI
FT                   VAIKQDIALGELMSLFEGAAHSRLVVYDETLDDPVGLVHIRDLVAFMTARAKVAPETVA
FT                   KRKKALPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDE
FT                   YGGTDGLVSIEDIVEQIVGEIDDEHDSAEPPSIVQQADGSFVADARTSLEDAREMIGDG
FT                   FVTGEAGEDVETLGGYLVNHVGRLPVRGEVISGPGNYEIEVLDADPRRVKRLRIGIRKE
FT                   RPVVRPRETRRREPASDQAATTPADPTHPNPSPPGD"
FT   gene            666514..668124
FT                   /locus_tag="RPB_0594"
FT   CDS_pept        666514..668124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0594"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05305"
FT                   /db_xref="GOA:Q2J2K5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K5"
FT                   /protein_id="ABD05305.1"
FT                   /translation="MTLPNLLSRAASSIILAWGWKRAAIAAIAGALSSLAMAPFNAWPI
FT                   LFVTFPIVVWLIDGSGAGKRRGLPAAAMAGWWFGFGYFVPGLYWIGYAFLVDAQTFAWL
FT                   LPVAIAGLPAYLALFSALGFALARLLWRPDAMRVLALAVGLTVGEWLRGHVLTGFPWNA
FT                   YGYALTEPLALAQSMSLVGLWGLTFVAVAVFASPAVLVDDRADTRRRWLAPVAALGVLI
FT                   AMAAYGGIRLQLNPTRMIDNVRLRIMQPDVQQDQRFNYAAKAELMQKYLTLSDRSTGPH
FT                   ATGVRDVNLLIWPESAFPFFLTREADAMAQIAELLPKGTILLTGAVRPPEMPPGRRITR
FT                   AYNSIYAIDHDGSILHAYDKLHLVPFGEFLPFQNFMEKIGFVQLTKVQGGFLPGVKRQS
FT                   IELPNAPPLLPLICYEAIFPDEIDTRGERPGWMLNLTNDGWFGVSTGPYQHLQQARMRA
FT                   VEQGLPLVRAANTGVSAVIDPVGRIVGQLGLGVEGVLDATLPRQIPPTIYARVGELPAA
FT                   VLVALSLMLVLLRRRPSPR"
FT   sig_peptide     666514..666624
FT                   /locus_tag="RPB_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.473 at
FT                   residue 37"
FT   gene            668322..668741
FT                   /locus_tag="RPB_0595"
FT   CDS_pept        668322..668741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0595"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05306"
FT                   /db_xref="GOA:Q2J2K4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K4"
FT                   /protein_id="ABD05306.1"
FT                   /translation="MSTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQISEVLQVPVSFLFEGGPSGGLANGSGFSEAPSPSYVSDFLATSEG
FT                   LALTRAFTKITDAKLRRSIVDLVEQIAAREPNESH"
FT   gene            668865..669635
FT                   /locus_tag="RPB_0596"
FT   CDS_pept        668865..669635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0596"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05307"
FT                   /db_xref="GOA:Q2J2K3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2K3"
FT                   /protein_id="ABD05307.1"
FT                   /translation="MVTIDRRVQPIAHLACNHQRAFIDMNESVHHQGSFFGRRKGHKLR
FT                   AHQADLVDKLLPHLALAIDGPAPASLVELFDPPVEAVRLEIGFGGGEHLIAEALAHPST
FT                   GFIGAEPYVNGMAKILARIEQENIRNIRLFAGDAAALMAWVPAHDLNRIDLIHPDPWPK
FT                   RRHWKRRFVQDAMVGAMARALRANGEFRFVSDIDSYNAWTLAHLLRAPDFDWTAERADD
FT                   WRKPWPNYTMTRYGRKAEREGRRAAYLRFRRRAA"
FT   gene            670170..670949
FT                   /locus_tag="RPB_0597"
FT   CDS_pept        670170..670949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0597"
FT                   /product="Protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05308"
FT                   /db_xref="GOA:Q2J2K2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2K2"
FT                   /protein_id="ABD05308.1"
FT                   /translation="MTDPIADSVAPDLLDEPRLVVEPGVAARFGAVAEPVLLAMGYRLV
FT                   RIKVSAEAGCTVQIMAERPDGTMLIEDCEAVSKALSPVLDVTDPIEKAYRLEISSPGID
FT                   RPLVRRSDFARYSGHLVKIEMAVPHQGRKRYRGLLDGVEGDAIRIQREGVKDEDPLVLL
FT                   PMHDIGDARLVLTDELIAESMRRGKQAERELKQSLGLAPPPPPHAKRSDPKKSNAPKPK
FT                   PKPPVKAAAKPKPTNTKQHRLAAGRSRRGDTDLSEGD"
FT   gene            670952..672571
FT                   /locus_tag="RPB_0598"
FT   CDS_pept        670952..672571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0598"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05309"
FT                   /db_xref="GOA:Q2J2K1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K1"
FT                   /protein_id="ABD05309.1"
FT                   /translation="MAVSANKLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDAKKGELRLSRHMLVVENVENPANQISLKAAQRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYSEFKDRIGDIVNGVVKRVEYGSVIVDLGRGE
FT                   AIVRRDEMLPRESFRNGDRVRAYIFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTETEESERRQADFENSTRVFMEALNVDEVVGQLLASEGFTSVEELALVDIRELA
FT                   SIEGFDEETATELQARASEYLDRVETEMEARRLELGVEDALKDVPGITSKILVKLGEGD
FT                   VKTVEDLAGCATDDLVGWTERKEGAEPVKFAGILDGVEGVTRDEAEDLIMQARVKAGWI
FT                   TEEELASSKGEAAIAETEAEAE"
FT   gene            672632..673459
FT                   /locus_tag="RPB_0599"
FT   CDS_pept        672632..673459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0599"
FT                   /product="Protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05310"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2K0"
FT                   /protein_id="ABD05310.1"
FT                   /translation="MLAAADDAADLDDGPRTQKSATERMCAVTRQVRPIDELIRFVVAP
FT                   TGEVVADLKRKLPGRGLWVTGSRAMVEQAVRRKVFAKGFRRDVKVAPTLAADIERLLVQ
FT                   SVCDALAIAAKARQVVSGFGKVGSALKSGEAVAMLHAADGAADGIRKLGALSRQMDGDA
FT                   TVSRDFPVITVLNSDELDLALGRSNVIHAALLAGPAGRTFLSRCQILVRYRLADDGNGT
FT                   AVIAGPPIKTPNDAADDSPADANAADDDAADEDAADEVCANAHNVERLGRLNG"
FT   gene            673452..676112
FT                   /locus_tag="RPB_0600"
FT   CDS_pept        673452..676112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0600"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05311"
FT                   /db_xref="GOA:Q2J2J9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2J9"
FT                   /protein_id="ABD05311.1"
FT                   /translation="MVDTKTPGDKTLSMPSKTLTLKPRVEQGVVRQSFSHGRSKQVVVE
FT                   KRGKRRIGGDGAPEPAAAPEVAKKPAPAPAPAAPSPRQQPRPSPQQQARSGMVLRTLTE
FT                   DERSARATALADARVREVEERRQAEIEAQRRAAQEVVDKAEREAAEARRKAEEERHRHE
FT                   EETKRKAETEAKKRFGETEPAARKPADGGRPAAGATTTAPRAPVTTTTTRPPAVAAEAG
FT                   DDDEAPRMVRRGPGGGPARPAPPPKQPAAKPGASKQRGRLTLVTALNADDVRERSIASF
FT                   RRRTQRLKGHASNEPKEKLVREVIVPEAISIQELANRMSERAVDVIRLLMKQGAMHKIN
FT                   DVIDADTAQLIAEELGHTVKRVAASDVEEGLFDVVDNSTDTEPRSPVVTVMGHVDHGKT
FT                   SLLDALRHANVVSGEAGGITQHIGAYQVTSPESGKKITFIDTPGHAAFTAMRARGAKVT
FT                   DIVVLVVAADDGVMPQTIEAINHAKAANVPIIVAINKIDKPDAKPERVRTELLQYNVQV
FT                   ESLGGDVVDVEVSAKNKTNLDKLLEMIALQAELLDLKTNEQRPAEGTVIEAKLDRGRGP
FT                   VATVLVQRGTLKVGDIIVAGAEMGRVRALISDQGDTVDSAGPSVPVEVLGFNGPPEAGD
FT                   RLAVVENEARARQVTSYRAHQKREKAASIVGMRGSLEQMMSQLKTTGRKDFPLIVKADV
FT                   QGSLEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFSAVILGFSVRANKEAAA
FT                   AAKRNGIEIRYYNIIYDLVDDIKKAMSGLLAPTLRETMLGNAQILEIFNISKVGKVAGC
FT                   RVTDGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVQSGQECGMAFENYTDMRAG
FT                   DVIECYRVETIQRSL"
FT   gene            676260..676667
FT                   /locus_tag="RPB_0601"
FT   CDS_pept        676260..676667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0601"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05312"
FT                   /db_xref="GOA:Q2J2J8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2J8"
FT                   /protein_id="ABD05312.1"
FT                   /translation="MPRNEKKTGQSASPRKLRVGELVRHAVAEILSQGGVHDPVLETHL
FT                   ITVPEVRMSPDLKLATVYVMPLGGKDEKPVLAALEQHKRFLRGEVARRVNLKYAPDLRF
FT                   RIDERFAEAERIEKLLRTPAVQKDLSGEEET"
FT   gene            676668..677144
FT                   /locus_tag="RPB_0602"
FT   CDS_pept        676668..677144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J7"
FT                   /protein_id="ABD05313.1"
FT                   /translation="MKTKIDEAALFAMNVHQRHQLWINARKIDSEEAREVVRLIEDLGL
FT                   PYSEDRSLKLDDPINQKMYQIINSKEGKAAAFEATANGRPALEGIDPLLLAALGVDYGK
FT                   HNDTTINAGYLVAQMMRSQGYQLSGRKGKLPSSCVAKTAEIYVPNSKASSLKHG"
FT   gene            677254..678309
FT                   /locus_tag="RPB_0603"
FT   CDS_pept        677254..678309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0603"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05314"
FT                   /db_xref="GOA:Q2J2J6"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J6"
FT                   /protein_id="ABD05314.1"
FT                   /translation="MQPDDASSAQLRQPRDNNDPRNNARGKDGGNKQPRRDKRDVHGWV
FT                   VLDKPIGMTSTHAVAVVKRLFSAKRAGHAGTLDPLASGGLPIAMGEATKTVPFVMDGRK
FT                   RYRFTVAWGEERDTDDTEGKVTQTSDIRPTAEAIRALLPRFTGLIEQTPPQYSAIKIAG
FT                   ERAYDMARDGEIVPLVPRPVEIHELTLVEHDDSGKSVFEAECGKGTYVRALARDIGRLL
FT                   GCYGHICALRRTLVGPFDEADMIPLEQLQALCDRAASGEGSLADALLPVETALDDIPAL
FT                   AVTRADAARLHRGQAVLLRGRDAPNTSGTVYVTVAGRLLALAELGNGELIPKRVFNLSG
FT                   LTASSARKESI"
FT   gene            678312..678581
FT                   /locus_tag="RPB_0604"
FT   CDS_pept        678312..678581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0604"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05315"
FT                   /db_xref="GOA:Q2J2J5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2J5"
FT                   /protein_id="ABD05315.1"
FT                   /translation="MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIANLTAHFKT
FT                   HTKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYKALLEKHNIRR"
FT   gene            678925..681081
FT                   /locus_tag="RPB_0605"
FT   CDS_pept        678925..681081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0605"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05316"
FT                   /db_xref="GOA:Q2J2J4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2J4"
FT                   /protein_id="ABD05316.1"
FT                   /translation="MFNKHSVEIDWGGRPLKLETGKVARQADGAVVATYGETIVLATVV
FT                   AAKTPREGVDFLPLTVDYQEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFA
FT                   DGWRNETQVIVTVLSHDMENDPDILAMVAASAALTLSGAPFKGPIGAARVGFINDEYVL
FT                   NPVLDEMPETQLELVVAGTADAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIEL
FT                   AEKAAKEPRELVVIDDSAIEKEMLGLVEQELRAAYAIPVKQERYAAVGKVKEKAIAHFF
FT                   PEGEEPKYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRSIIAEAGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYVDSLAGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIRPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPL
FT                   KRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGITSLQMDIKIAGITE
FT                   EIMKVALGQAKDGRIHILGEMSKALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGESIKAAIKWIKSIASDPEVGEIYEGTVVKVME
FT                   FGAFVNFFGAKDGLVHISQLASGRVQKTSDVVKEGDKVKVKLLGFDDRGKTRLSMRVVD
FT                   QETGEDLEAKQKAEGEAPAQATGE"
FT   gene            681358..682377
FT                   /locus_tag="RPB_0606"
FT   CDS_pept        681358..682377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05317"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J3"
FT                   /protein_id="ABD05317.1"
FT                   /translation="MRRWTAKLATVVIATLLSHGALAQRAVLIGENDTVADTDRDYTSG
FT                   FRLSFVFDNFSRDLLAGQAFDLVRPALITYGSPSGSVRQQFEWIALAQNIYTPDRDTRG
FT                   TYTPGVDRPFGGWLYTGFSVAQETGRRQLDSFELQVGAVGGNASLAQAVQSSFHSVLGQ
FT                   ASPVINGYELRNEPGILLAWDRRWKFGTAFGNGFGVDIIPSLGLTAGNVFTYGEAGAIV
FT                   RFGRALSTTWGPTVIRPGVSGANFVSPDPDAPFWGFSLFGGAQARGVARNIFLDGNTFS
FT                   SGLHVSRDAFVYDLVAGAEVFNQAGFLASLSWVRRSREYTTQTRAYSDYASLALAYRF"
FT   sig_peptide     681358..681429
FT                   /locus_tag="RPB_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            682556..683290
FT                   /locus_tag="RPB_0607"
FT   CDS_pept        682556..683290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0607"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05318"
FT                   /db_xref="GOA:Q2J2J2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J2"
FT                   /protein_id="ABD05318.1"
FT                   /translation="MSLLSRRRLIVSATGFAAAAMAAPRAAFAQAAATPAGPFTLPPLP
FT                   YPAAALEPHIDAKTMEIHHGKHHQAYVSNMNGFAKDHPKLAQMSVPDVLGKLGDVPEAI
FT                   RTGVRNNLGGHANHTMFWQIMGPNGGKPSGEVAAAIDRDLGGMDKFQADFNAAGGKQFG
FT                   SGWVFVTVGKDGKLAIEARPNQDTPLMDGKRVLLGNDVWEHAYYLNYQNRRADYLKAWW
FT                   NTVNWSKVGERYAAAKAGTLGV"
FT   sig_peptide     682556..682645
FT                   /locus_tag="RPB_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.901 at
FT                   residue 30"
FT   gene            683880..685568
FT                   /locus_tag="RPB_0608"
FT   CDS_pept        683880..685568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0608"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05319"
FT                   /db_xref="GOA:Q2J2J1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J1"
FT                   /protein_id="ABD05319.1"
FT                   /translation="MFSLFKRAGNAPSPAAILDALNRSQAIIEFNLDGVVLNANENFLA
FT                   ALGYSLDEIKGKHHSIFIDSQEAKSDAYRQFWAGLKSGRYQSGEFKRIAKGGRDIWIQA
FT                   SYNPVLNTDGEPICVVKYATDITPAKRRAMEDAGKIAAIGRAQAVIEFALDGTILDANP
FT                   GFLGAMGYTLDEIKGKHHSMFVTPQERASAAYREFWAQLNRGEYLASEYKRIGKGGREV
FT                   WILASYNPILDDTGRPFKVVKFATDVTAQKLETADLAGQIDAIGKSQAVIEFGIDGTVL
FT                   VANDNFLHALGYTLAEIKGKHHSMFVEPAERDSEAYRRFWAELAAGKYQAAEYKRIGKG
FT                   GKEVWIQASYNPILDLNGKPFKVVKYATDTTRQVLIRLGNERVRGMMESVAAGAEELNA
FT                   SVREISEAMTKSRETALSAVGEVDAADGQANRLNEAAQAMTGIVELIGHITGQINLLAL
FT                   NATIESARAGEAGRGFAVVASEVKNLANQAKQATDKIGAEIENLNGISGDVVGALGKIK
FT                   TAIQNVSEYVTSTAAAVEEQSTVTGEMSSSMQRAAAEAAAMAAGG"
FT   gene            complement(685602..686540)
FT                   /locus_tag="RPB_0609"
FT   CDS_pept        complement(685602..686540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0609"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05320"
FT                   /db_xref="GOA:Q2J2J0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2J0"
FT                   /protein_id="ABD05320.1"
FT                   /translation="MVTLRQLRYLSALARFGHFGRAAEACAVTQPALSMQIADLERTLG
FT                   VKVVERRPGEVFLTEIGREIARRGEDLLTASRDLVDFARHRAQPLTGRLTLGVIPSLAP
FT                   YLLPKLLPLLQQRYPELRLELRESQTRQLVTEVGSGALDAALLALPAGNRELDAITLFD
FT                   DEFLLAVPADDPRPETATVAVDEIDQSRLILLEDGHCLRDQALAFCATARNRAIAIGGT
FT                   STTTFGASSLTTVIQMVAGGYGVTLIPQIAAEIERRDTRVKFLRLRRPQPGRTIGLAFR
FT                   KTSPRRQDFEALGEVVREGVGGRSSMAQPAA"
FT   gene            686790..688988
FT                   /locus_tag="RPB_0610"
FT   CDS_pept        686790..688988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0610"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05321"
FT                   /db_xref="GOA:Q2J2I9"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2I9"
FT                   /protein_id="ABD05321.1"
FT                   /translation="MDAKTDDKDGGKCPFPHGGGRGRRNSDWWPEHLDISLLHRNSTLS
FT                   DPMGKGFDYAREFESLDLDAVIKDLHALMTDSQDWWPADFGHYGGLMVRMAWHSAGTYR
FT                   TTDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGNKISWADLYVLTGNVAL
FT                   ESMGFKTFGFAGGRADTWEPEELFWGPEGSWLGDERYSGERELSDPLGAVQMGLIYVNP
FT                   EGPNGNPDPVAAAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPSLIGAEPEGG
FT                   ALEDQGLGWKSSFGTGFGADAITGGPEVIWTQTPTQWSNHFFENLFGFEWELDKSPAGA
FT                   KQWKAKGAEANIPDPFDPTKKRLPTMLTTDLSLRFDPAYEKISRRFLENPDQFADAFAR
FT                   AWFKLTHRDMGPKVRYRGKLVPKEDLIWQDPIPPVDHELVGDKDIAALKAKILGSGLSV
FT                   SQLVSAAFASASTYRHSDKRGGANGARIRFAPQKDWEVNQPSDLAQVLSKLEAIQKEFN
FT                   GAQTDGKKVSLADLIVLGGCAAVEKAAKDAGTDIQVPFTPGRMDALEEQTDADSFKVLE
FT                   PRADGFRNFIGKRKQYMSPEESLVDRAQLLNLTAPEMTALLGGLRVLGGNVGHTTHGVF
FT                   TERPEKLTNDFFVNLLDMKTAWSPSATTEVVYEGRDRKTGELRWTGTRVDLIFGSHSQL
FT                   RALAEVYAQSDAQPKFARDFVAAWTKVMNADRFDIVAK"
FT   gene            complement(689471..690316)
FT                   /locus_tag="RPB_0611"
FT   CDS_pept        complement(689471..690316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0611"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05322"
FT                   /db_xref="GOA:Q2J2I8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I8"
FT                   /protein_id="ABD05322.1"
FT                   /translation="MQSLMQGKRGLIMGVANNHSLAWGIAKTLSAHGAELAFTYQGEAL
FT                   GKRVKPLAQSLNAELVLPCDVEDIASVDSVFATLNEKWGGLDFIVHAIGFSDKNELKGR
FT                   YADTTRENFSRTMVISCFSFTEIAKRAAELMPESGGTMITLTYGGATRVMPNYNVMGVA
FT                   KAALEASVRYLASDYGPRNIRINAISAGPVRTLAGAGIADARMMFNYQLRHAPLRRTVS
FT                   IEDVGGSALYLLSGLSNGVTGEVHFVDSGYNIISMPHPEALKTVDEAETAAEQRAAKGE
FT                   "
FT   gene            complement(690512..691738)
FT                   /locus_tag="RPB_0612"
FT   CDS_pept        complement(690512..691738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0612"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05323"
FT                   /db_xref="GOA:Q2J2I7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I7"
FT                   /protein_id="ABD05323.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGITRAEKHAELGFR
FT                   SQVQGLPSLNPADVVDRRAMRFLGEGAAWNHVAMEQALADSGLEEKDISNPRTGIVMGS
FT                   GGPSARTIVEAADTTRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDV
FT                   SRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMQM
FT                   ALATTGGIKIDYINPHATSTPAGDPPELQALRNVFGVGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPAFADMPIVRKRIDNAQLGAVLSNSFGFGGTNA
FT                   TLVFKRLDA"
FT   gene            complement(691805..692335)
FT                   /locus_tag="RPB_0613"
FT   CDS_pept        complement(691805..692335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0613"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05324"
FT                   /db_xref="GOA:Q2J2I6"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2I6"
FT                   /protein_id="ABD05324.1"
FT                   /translation="MQDRRSSYDYEDLLACGRGELFGAGNAQLPLPPMLMFDRITEIND
FT                   SGGEHGKGLIRAELDVNPDLWFFACHFKGDPVMPGCLGLDAMWQLVGFFLGWSGGLGPG
FT                   RALGLGELKFSGQVQPNIKKVVYNIDVKRVMRSKLWLGIADGTMAADGEIFYRAKDLKV
FT                   GLFRQDAAVQPAV"
FT   gene            692595..693083
FT                   /locus_tag="RPB_0614"
FT   CDS_pept        692595..693083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0614"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05325"
FT                   /db_xref="GOA:Q2J2I5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I5"
FT                   /protein_id="ABD05325.1"
FT                   /translation="MDIGDRATYSREDHVTSAHAVEPHLNGCPWHDVNEMLQSVGLRPT
FT                   RQRMALGWLLFSKGDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTDVGLLRQVSVDG
FT                   TKTYFDTNVSAHQHFYLENNHELIDIPDQHVALRSTPEVPDGYEIARVDVVVRLRKKS"
FT   gene            complement(693439..693963)
FT                   /locus_tag="RPB_0615"
FT   CDS_pept        complement(693439..693963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0615"
FT                   /product="Protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05326"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I4"
FT                   /protein_id="ABD05326.1"
FT                   /translation="MKLTKPIAGLLFAGAMVGVAAPSFAAKDSPLSTSGLPVPRYVSLK
FT                   SDHVNVRIGPTKDNDVAWVYTRAGLPVEITAEFENWRRVRDSEGAEGWVYHSLLSGRRT
FT                   AVITMKDKDELATLYESASTDSAVAARLQAGVVAQIKRCDAVWCRIAGQGFDGWIEKQR
FT                   LWGVYADEQVK"
FT   sig_peptide     complement(693886..693963)
FT                   /locus_tag="RPB_0615"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            694249..695250
FT                   /locus_tag="RPB_0616"
FT   CDS_pept        694249..695250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0616"
FT                   /product="Glycolate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05327"
FT                   /db_xref="GOA:Q2J2I3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I3"
FT                   /protein_id="ABD05327.1"
FT                   /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDAPMSAEQLAD
FT                   AARTADVLVPTVTDSITSEMLNQPDCKLRLIANFGNGIDNIDVAAAHARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGAALLTDGGEWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRKPVAPRIADELGATYWDSLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLVRKDAFIVNTARGEVIDEETLTRLIESGDIAGAGLDVYEHEPAVNPKL
FT                   VRLAKHGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPGML"
FT   gene            complement(695453..696250)
FT                   /locus_tag="RPB_0617"
FT   CDS_pept        complement(695453..696250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0617"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05328"
FT                   /db_xref="GOA:Q2J2I2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I2"
FT                   /protein_id="ABD05328.1"
FT                   /translation="MLSAEELERYARHIVLREVGGPGQAALRRARVLVVGAGGLGAPVL
FT                   MYLAAAGVGTLHIVDDDVVSLSNLQRQVIHATPDVGARKVDSAAARIHALNPHVQVVPH
FT                   PTHLTSANALGLIGDCDLVLDGSDNFATRYLVSDACFIAKKPLITAALGQFDGSLTTIR
FT                   AHEKNAQGEPNPTYRCLFPEAPPPGTVPACEEAGVMGALAGLLGSMMALEAIREIVGFG
FT                   EGLVGRLLMIDARAMRFETLRYARDPANPLNGDMARIVDLSAH"
FT   gene            696546..697928
FT                   /locus_tag="RPB_0618"
FT   CDS_pept        696546..697928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0618"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05329"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2I1"
FT                   /protein_id="ABD05329.1"
FT                   /translation="MRTMLAATLMIASATGLAAAQTAPPSGAVPAVKPKPVATTPVRPA
FT                   LQTPAETAQAMTPAERQAIQSDLAWTGDYNGVINGEPSERMVTAIKAFQKNHGGKQTGV
FT                   LNPQERAQLTEAARKLQGNVGWKLISDMVTGARLGIPAKLVPQQTSDANGSKWASSTGT
FT                   IQIVLARRKEAGITIAKLADQEKKEPGRKVGYSAIKPDFFVLSGTQGLKKFYMRGAFKD
FT                   SEVRILTILYDQATEGTMEPVVVAMSSAFNPFPSGALAGPPPRKKVEYSTGTIVSDDGA
FT                   ILADRDAVEACQSIVIAGQIAAHGNADLAATDKAHDLALLRIYGARGLKPLALGSGAAK
FT                   ASVDVVGIADPQNQGGGSAVSVSKAGVTPVGSNGGLALAPAPGLGFSGAPARDADGRFA
FT                   GLALLRPSVVAGATNGAVAPQAALVDAETVRKFLVSNAIKPATDAPADAKASVVRVICV
FT                   RK"
FT   sig_peptide     696546..696608
FT                   /locus_tag="RPB_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.899 at
FT                   residue 21"
FT   gene            complement(698153..699034)
FT                   /locus_tag="RPB_0619"
FT   CDS_pept        complement(698153..699034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0619"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05330"
FT                   /db_xref="GOA:Q2J2I0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2I0"
FT                   /protein_id="ABD05330.1"
FT                   /translation="MPELPEVETVRLGLQPAMEGFRIDRAMANRCDLRFPFQPDFAARL
FT                   TGQTITGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVVNGAGDATPGEFHHPRSEDRTH
FT                   DHVVFEMSSGARVIFNDPRRFGFMKIFARAAIDDEPHLKGLGPEPLGNAFDAAMLARAC
FT                   AGKQTSLKAALLDQRVVAGLGNIYVCEALWRAHLSPKRKASTLADRKGAPTDRAVRLVD
FT                   AIRAVLGDAIKAGGSSLRDHRQTSGELGYFQHSFAVYDREGERCRTPGCNGTVKRLVQN
FT                   GRSTFWCSGCQT"
FT   gene            699169..699930
FT                   /locus_tag="RPB_0620"
FT   CDS_pept        699169..699930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0620"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05331"
FT                   /db_xref="GOA:Q2J2H9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2H9"
FT                   /protein_id="ABD05331.1"
FT                   /translation="MTEPGQTTHFGYRDVPLQDKQTLVNDVFHSVASRYDLMNDLMSGG
FT                   MHRLWKDVMITTLNPPRDDQPFRLLDVAGGTGDISFRAAKASGAGFQATVCDINTDMLE
FT                   VGRQRAVERHLDGQVEFVEGNAEALQFPDKSYDAYTIAFGIRNVPRIDLALKEAHRVLK
FT                   PGSRFLCLEFSSVDVPGLAKIYDLFSFKVIPQIGRVVTGDAESYQYLVESIRKFPKPAD
FT                   FGEMMREAGFARVNWQVLSGGIVALHSGWRL"
FT   gene            699927..701501
FT                   /locus_tag="RPB_0621"
FT   CDS_pept        699927..701501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0621"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05332"
FT                   /db_xref="GOA:Q2J2H8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H8"
FT                   /protein_id="ABD05332.1"
FT                   /translation="MIAALTHVARLARAAFVFAREGVFGVVDPSLIPPAGQLPVRLARL
FT                   IERPGAKSGARLSRALTRLGPAYLKLGQFLATRPDVVGVAMARDLEALQDRLPPFAQDE
FT                   AEAVIAASLERPIAQAFVSLSPPVAAASIAQVHRGVVEVGGVHKQVAVKVLRPNVSARF
FT                   RRDLSDFFFVAEKAEMYSSEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAENTKD
FT                   DPDFRVPTVDWDRTTHNVLTMEWIDGIPLNDHKRLAEANVDTVELGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDTEGRLVAVDFGIMGRLLPKERRFLAEILLGFITRNYRRVAEVH
FT                   FEAGYVPPHHSVENFAQAIRAIGEPIHNRLAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARSFDPKLDIWKVADPVVREWIQRNLGPIGKVEGVLSGAGELGHTLS
FT                   GLPTIVSRAVTVLNQLEGMTKDGLVLAPETIAAIGRNERGRTRGRTIALWVIAATFIGV
FT                   LIALSRF"
FT   gene            701603..703060
FT                   /locus_tag="RPB_0622"
FT   CDS_pept        701603..703060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0622"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05333"
FT                   /db_xref="GOA:Q2J2H7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H7"
FT                   /protein_id="ABD05333.1"
FT                   /translation="MANLTIRKLDDALKAELRQRAAGNGRSMEDEVRVILRDAVHQRHG
FT                   FATSLPQAGGAAAEPGPGDVSPENQTAFVSDRPSTARITLIVGGGIAAYKAMDLIRRLK
FT                   ERGAEVRVVLTKAAQHFVTPLTASALSHQRCYTDLFDPQSEFDAGHIRLARDCDLIVVA
FT                   PATADLMAKIANGHADDLATAILLATNRQVLLAPAMNPLMWANAATRRNVDQLKRDGIV
FT                   LVGPNAGEMAERNEAGTGRMAEPVEIAAAAQALLAPPSPRPLLGRRVLITAGPTHEPID
FT                   PVRYIANRSSGKQGYAIAAAAAAAGAEVVLISGPVDLRAPDGVTLTRVESARDMLDAVE
FT                   AALPADIAIFAAAVADWRVASEGGQKIKKGEGGPPPLQLTENPDILATVAKLGDDRPPL
FT                   VIGFAAETENLLANARSKLARKGCDWIVANDVSAAGGVMGGDRNTVHLLTKSADTVDVE
FT                   SWPLMTKDDVATALVARIARELEVHQS"
FT   gene            703057..703515
FT                   /locus_tag="RPB_0623"
FT   CDS_pept        703057..703515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0623"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05334"
FT                   /db_xref="GOA:Q2J2H6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2H6"
FT                   /protein_id="ABD05334.1"
FT                   /translation="MSPAIAVEIKRLPHAEGLPLPAYQSAHAAGLDLCAANSADAPLSL
FT                   APGCHMLVPTGLCIALPPNYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLIN
FT                   HGKEPFTIRRGERIAQMIIAPVVRAELISVETLSETARGVGGFGSTGR"
FT   gene            703696..706209
FT                   /locus_tag="RPB_0624"
FT   CDS_pept        703696..706209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0624"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05335"
FT                   /db_xref="GOA:Q2J2H5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H5"
FT                   /protein_id="ABD05335.1"
FT                   /translation="MSDVLGSMRRTCLSCTSLVRGLAGAGLVTASSPAFAADDPLAALT
FT                   SWIIVDLNRHELVTLAMAVSVLGFSVMSAILLMRTRQRAAAQEARLRAEVQTLQAESDR
FT                   FRALLFAEPQVLISWSAGDDRPQISGDIALLLPNDAHGGQPQRVLAFGTWLPPEPALQI
FT                   DHAVDALLDKGEAFLLHLTTSTGRAIEAMGRAVGGQAILRIRELSGVRRELADMSRRFK
FT                   MLQDETDMLRGFADAAPWPIWTRRASGELNFANAAYARAADASSPADAVGRNLELLDST
FT                   DRGNLARALAEDSEFAARLPIVVAGERRYFDVRALRLKGGSAGMAVDSSEAAALGAALV
FT                   RMAEAHRRTLDQLSSGVAVFDAQRRLAFYNDSYRKLWDLDRTFLDSHPDDSSVLDRLRA
FT                   ARKLPEERDFREWKNRLHEAYRAVEADKAIWYLPDGRAISIVTTPNQEGGVTYLFDDVT
FT                   ESLDLQRRYGGLIDVQRETLDNLSEAVAVFGSNGCAQLFNPAFTRMWNLSPEALNDRPH
FT                   IETVEAWCRPLYDDDASWQALRGAITGIDDRKQVALKLERKDGTVLSCKTMPLPDGATM
FT                   LTFQDISDTENVERALRERNEALETADRIKIDFVHHVSYELRSPLTTIIGFAHLLGDPS
FT                   TGPLNDKQSEYIAYITSSTNALLAIINNILDLASIDAGAMTLNLGPIEIRRTIAAAAEG
FT                   IQDRLARDQITLDIDTDPAIGEFVGDERRVVQVLYNLLANAIGFSPNEATVKLVVRKKG
FT                   TNVVFTVTDAGPGIAPALKDKVFDLFESDSQGSRHRGPGLGLALVRSFVELHGGKVEVD
FT                   SVVGHGTSVICEFPIEPGAQRNAAE"
FT   sig_peptide     703696..703806
FT                   /locus_tag="RPB_0624"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            706206..707723
FT                   /locus_tag="RPB_0625"
FT   CDS_pept        706206..707723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05336"
FT                   /db_xref="GOA:Q2J2H4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H4"
FT                   /protein_id="ABD05336.1"
FT                   /translation="MSDPATFSVALANEAATARLMADIALLIGPGDVVTLSGDLGAGKT
FT                   AAARAMIRYLAGDDELEVPSPTFTLVQSYDLPPFPLLHADLYRVEDPSELEEIGLSPLP
FT                   DGTVALIEWPERAPGAMPPDRIDIALSHRPALGSMARAAEITGHGKAAAQVERLAALRS
FT                   FIETSGHADADRRHMPGDASTRSYARLVKDGASLILMNAPRRPDGPALYAGKSYSAAVH
FT                   LAEDIRPFVAIANGLRAQGVSAPQIHHADLDSGFLITEDFGTAGFVEGSPPVPIVERYQ
FT                   AAADMLAALHGQSLPDTLPLPHGDYAIPVFDTDAMLIEVSLMPEWYLPDRGAPPSAAQR
FT                   GEFVAMWRRLLDGIAGETRTWVLRDYHSPNLIWLDARSDIARVGVIDFQDTVLGPAAYD
FT                   VVSLLQDARVDVPEALELALLGRYIKARLAAEPGFDPAAFARLYAVMSAQRNTRLLGTF
FT                   ARLNRRDGKPQYLRHQPRIWTYLARSLAHPSLAEFRAWYQANVPAPF"
FT   gene            707835..708149
FT                   /locus_tag="RPB_0626"
FT   CDS_pept        707835..708149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05337"
FT                   /db_xref="GOA:Q2J2H3"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H3"
FT                   /protein_id="ABD05337.1"
FT                   /translation="MAGERNKDGRVVFERGIRAQMMAIDGTWRRPCMLEDVSETGAKLT
FT                   IEGSVEGLNLKEFFLLLSSTGLAYRRCELSWVNGDQIGVSFLRHDKKKKQAARSPATVA
FT                   "
FT   gene            708337..709059
FT                   /locus_tag="RPB_0627"
FT   CDS_pept        708337..709059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0627"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05338"
FT                   /db_xref="GOA:Q2J2H2"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H2"
FT                   /protein_id="ABD05338.1"
FT                   /translation="MSVQPSKAMVLAAGLGLRMRPLTDHMPKPLVSVAGKPLLDHVLDR
FT                   LADAGVAEAVVNVHYLPDQIIDHTAARKSPRVIISDERDVVLGTGGAVVKALPLLGEAP
FT                   FYHLNADTLWIDGVRPNLARLADAFDPARMDILLLMAPTAGSIGYAGKGDFAMAADGTL
FT                   SKRKENEVTPFVYAGVAIMQPAIFQDAPQGEFSLTTLFDRAAAQQRLFGLRLDGVWMHV
FT                   GTPDAVAAAERAYLASVA"
FT   gene            709131..712277
FT                   /locus_tag="RPB_0628"
FT   CDS_pept        709131..712277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0628"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05339"
FT                   /db_xref="GOA:Q2J2H1"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H1"
FT                   /protein_id="ABD05339.1"
FT                   /translation="MRVFSVPPSAPFLRTTIEALVDGRLIEGFDARAKPERLAEATLYL
FT                   PTRRAGRLARDIFLDVLGTDAVLLPRIVPLGDVDEDELAFAQAATGAADLDIPPALDGL
FT                   PRRLLLAQLIAAWAKGLRPGDPQQSPLVVGGPASTLALADDLARLIDDMATRGVDWAAL
FT                   DMLVPDAFDRYWRLTLDFLKIAGQWWPLHLRETDRIEPAARRDLLIEAEAARLAAHRGG
FT                   PVIAAGSTGSMPATARLLHAIAQLPHGAVVLPGLDTELDEAAWQMIGAVHDKQGKLISP
FT                   PSPNHPQFAMHGLLARMGLERRDVLRLGEGERHGREVLASEMMRPSSATAAWHDRLADP
FT                   AIDQLIGDGTHGLTLIEAPNSEIEALTIAVVLREARERGQSAALVTPDRALARRVVAAL
FT                   GRWKLPVDDSGGDSLMDTQAGIFARLAAETALHGCEPATLLALLKHPLLRLGRAAYGWR
FT                   SAIETLELALLRGTRPAAGTEGLAKEFARYRAELTKLNSGELSALHRAEPRARLGDEAL
FT                   DEAHALIVALRAALAPLESVGVEPIDLCAFGQRHRAVLIALSIDHDDNAVAFEGPQGSA
FT                   LLKAFDDLAEVEPLSGVMVPPHDYPELFETAFSDRIVRRPELAGAALRIYGPLEARLTQ
FT                   HDRVVLGGLVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQLLGANEVIL
FT                   SHAAKVGGAPAVASRFLHRLEAVAGKARWSDIKARGATYLDYALALDRPDQVTPIAQPA
FT                   PKPPREARPLKLSVTAIEDWLRDPYTIYAKFILGLSALDPVDMPLSAANRGSAIHEALG
FT                   DFTERFPDALPDDPAGLLREIGEKHFAPLMDHPEARALWWPRFARIAAWFGNWEQGRRA
FT                   DGRRVFAERDGSLSIPLDGGRNFVLTARADRIEHRPDGSYAILDYKTGNPPSSKQVRLG
FT                   LSPQLTLEAAILRDGGFQDIDAGASVSELMYVKLSGNSPPGRELPVKLAVGNETPQSPD
FT                   DAAIEARAKLAALVRQFDDEAQPYHALVLSMWTQRYGRYDDLARIKEWSAAGGAGEERR
FT                   "
FT   gene            712274..715759
FT                   /locus_tag="RPB_0629"
FT   CDS_pept        712274..715759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0629"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05340"
FT                   /db_xref="GOA:Q2J2H0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2H0"
FT                   /protein_id="ABD05340.1"
FT                   /translation="MSGPRSIPDQARERQILASDPSASVFVSANAGSGKTHVLVQRVIR
FT                   LLLDGVPPERILCITFTKAAAANMAERVFTTLGRWVTLDDAALTAAIKATGIKSVGPSL
FT                   LAQARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELMQRA
FT                   SLAVLLQAAAAPDSAAGRALALAMTSAADITFREVVQEACMSRDRFLGWIAQAGGVDGA
FT                   MAQLSVTLGVAAEDDCDAVERDIVDGPHLPRARWTDGATIFDGGSKTDHDQAQRLRDAL
FT                   AASDTAQLEKYLELFFTKEAKLRKSFATKKIADPMPGFAEDLKREGARLEGLLERRRAL
FT                   LMRERTRALLVIAFDVAERIRREKQERGLLDYDDLIDRTLQMLDSGASSWVHFKLDRGV
FT                   DHVLIDEAQDTSPKQWDIVAHLIAEFTAGEGAREGIKRTVFAVGDEKQSIFSFQGAVPK
FT                   EFAERRDLLQRRFHGAGLAFEKVSFNYSFRSGATILQSVDHVFRDPDIYRSIHADTSYP
FT                   LHEALTDAGPSLIDLWPLEVPDDKQEIEGWRAPFDAVSETSPEVRLADKVRAEIASLIA
FT                   SGTMTGPRDDRRRLRYGDVLVLVRRRGSAFDAVIQALKRGGIPVAGADRLKLTEHIAII
FT                   DLMNLADALLLPQDDLALAVALKSPLFGFDDDDLFRLAWRRKGSLRAALRDKAAGDAKL
FT                   TAVLHRLDTCAEQSQAETPFGFYAWLLGGDGGRARILRRLGPEANDALDEFLELALSFE
FT                   RKQPPSLQGFVAWLRAADTEIKRDMEISRDEVRVMTVHGAKGLEALVVFLVDTTSSPAD
FT                   SQRLNLIRLPGGNAQPGAPSAMVWAGRKADDPRAVEQARAAMISDTEDEYRRLLYVAMT
FT                   RAADRLIVGGCMPGNRNDVRALSWYDLISKGLENSGLAMRAVPPPDGAVKRYCRPEDEV
FT                   VETAAPDETPAAAPLILPNWLHRSAPALRAPDNLLRPSDAHDADHRRLRRGESEAQRQR
FT                   ALQRGTLVHRLLQSLPDLPADARASAAARYLARNAKDWNDEDRDALAARVLQVITATRF
FT                   AVVFAPGSRAEVPIAGRLQRHGEPVLVSGQIDRLVVTDAEVLIVDYKTNQVPPRSLAET
FT                   PPAYLRQLALYRAVLARLYPQRPVRAALLWTEAPEIMEISASALDAEQAALTVA"
FT   gene            715854..716174
FT                   /locus_tag="RPB_0630"
FT   CDS_pept        715854..716174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0630"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05341"
FT                   /db_xref="GOA:Q2J2G9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2G9"
FT                   /protein_id="ABD05341.1"
FT                   /translation="MAVGKVSDADFEAEVLKAQGPVVVDFWAEWCGPCRMIAPALDEIS
FT                   GAMGDTVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWISS
FT                   AV"
FT   gene            complement(716372..717121)
FT                   /locus_tag="RPB_0631"
FT   CDS_pept        complement(716372..717121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0631"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05342"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2G8"
FT                   /protein_id="ABD05342.1"
FT                   /translation="MRIAAIADMHSNYAALEAVLADIGRQGVDHLVCLGDMASGPLDAR
FT                   RTLDMLMALDMTVVLGNHDRYLLDRPRDEMGAWDKIALDQLDAQHLDWLRAIPATRVLD
FT                   GEVFLCHATPSNDETYWLETVNPDGAIRMSDLAAIEAGAEGIAQSLILCAHTHIPRAVR
FT                   LRDGRLIVNPGSAGCPGYRDKLPYPHLMQTGTPDASYAILDRRDGEWQVSLRLIPYDHA
FT                   AMAALARQNGMAAYADTLASGWVKPAA"
FT   gene            complement(717143..718489)
FT                   /locus_tag="RPB_0632"
FT   CDS_pept        complement(717143..718489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0632"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05343"
FT                   /db_xref="GOA:Q2J2G7"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2G7"
FT                   /protein_id="ABD05343.1"
FT                   /translation="MSAATTPKPSASVGDLRARLARLHPAQIDLTLGRIERLLAALDYP
FT                   ERRLPPVIHIAGTNGKGSTLAFLRAILEAAGLCVHAYTSPHLVRVNETIRLGRPGGGVL
FT                   VSDEELADALSHCERVNDGAPITLFEIETAAALYLFAQHPADVVLLEVGLGGRLDATNV
FT                   IAHPLACVLTPIGIDHTEFLGPTLAEIAAQKAGIIRRDAPVIVAEQPDDAMVVIEREAK
FT                   RLRAPLHARGQHWHVELEHGRLAYQDERGLMDLTAPKLFGRHQIDNAGLAIAALRAQQR
FT                   FAIDQAAYQAGLLAAEWPARMQRLTSGTLLDDAPQGCELWLDGGHNADGGRVAAAALGD
FT                   LEERVSRPLVIIAGMMANKDAGAFLANFTGLTRHLIAVPIPDRDGAMLPDRLAEAGRAL
FT                   GLRVELADDVAAALRRIAGLAYELPPRILITGSLYLAGHVLSLNGTPPN"
FT   gene            complement(718486..719454)
FT                   /locus_tag="RPB_0633"
FT   CDS_pept        complement(718486..719454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0633"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05344"
FT                   /db_xref="GOA:Q2J2G6"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2G6"
FT                   /protein_id="ABD05344.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGATARLRSVFDNETWYDVALPEVTADPLKFRDERKYVDRIKDARAKTG
FT                   AHDAVKVGYGKLEGLGVVAAVQDFDFMGGSLGMAAGEAIIRGLELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQLLREAGLPYIVVLTNPTTGGVTASYAMLGDIQLAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLRDHGMVDMVVHRHELRPTLARLCRILTKT
FT                   PLPAVEEPAVVDDDAQDIEAVATEIVATPPEPAPPPAAPQA"
FT   gene            complement(719563..720399)
FT                   /locus_tag="RPB_0634"
FT   CDS_pept        complement(719563..720399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0634"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05345"
FT                   /db_xref="GOA:Q2J2G5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2G5"
FT                   /protein_id="ABD05345.1"
FT                   /translation="MTTRIDIRFAQLKREGRPAFVTFVMAGDPDLATSLQLLKALPTAG
FT                   ADIIEIGMPFTDPMADGPAIQAAGLRALHGGTTLHKTLELVGDFRKDDATTPVVLMGYY
FT                   NPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDAELCLPAMKAGLNFIRLATPTTDEKR
FT                   LPAVLANTSGFVYYVSITGITGSASADSVAVGDAVARIKRHTDLPVCVGFGIRTPEGAR
FT                   AIAAQADGAVVGSALIDALQKTLDTDNRATQATVGAVADLVASLAAGVRGAQQAAE"
FT   gene            complement(720399..721613)
FT                   /locus_tag="RPB_0635"
FT   CDS_pept        complement(720399..721613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0635"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05346"
FT                   /db_xref="GOA:Q2J2G4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2G4"
FT                   /protein_id="ABD05346.1"
FT                   /translation="MNQILPNSFRSGPDERGHFGIFGGRFVAETLMPLILALEKAYAEA
FT                   KDDPAFRAEMDGYLKHYVGRPSPLYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLG
FT                   QIMLARRMGKPRIIAETGAGMHGVATATMCAKFGLQCVVYMGAVDVDRQQPNVLRMKAL
FT                   GAEVRPVTSGAATLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQE
FT                   VRAQIMEAEGRLPDSLIACIGGGSNAMGLFHPFLDDSSVAIYGVEAAGHGLSKLHAASI
FT                   AGGKPGVLHGNRTYLLMDTDGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVEFMSATDT
FT                   EALDAFKLCCRLEGIIPALEPAHALAKVGDLAPPLPKDHVMVLNMSGRGDKDLASVAEH
FT                   LGGQF"
FT   gene            complement(721615..722271)
FT                   /locus_tag="RPB_0636"
FT   CDS_pept        complement(721615..722271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0636"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05347"
FT                   /db_xref="GOA:Q2J2G3"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2G3"
FT                   /protein_id="ABD05347.1"
FT                   /translation="MSVVVKICGLSTRDTLEAAVAAGADMVGFVFFPASPRHVGFDLAR
FT                   ALGDQVGSRAAKVALTVDASDALLRDVVDALAPDLLQLHGKESPERVRAIRQTFGLPVM
FT                   KAVAVATADDLAALPAYAAAADRILFDARPPKDALRPGGLGVPFDWALLSGLALPVPYM
FT                   VSGGITPGNVAEALRVTRAGGIDVSSGVETAPGVKDSELIRSFIRATRASEETMT"
FT   gene            complement(722328..722744)
FT                   /locus_tag="RPB_0637"
FT   CDS_pept        complement(722328..722744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05348"
FT                   /db_xref="GOA:Q2J2G2"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2G2"
FT                   /protein_id="ABD05348.1"
FT                   /translation="MLSKASENDMQKFLTALVLIPLGLIFIVFAVANRHLVSVSFDPLD
FT                   VSDPMGTVQMPLFVLIIGVAILGVIAGGIATWFRQRHWRRAARRHQAEAIEAKTQLANL
FT                   RASIVAPTPSEPKRMLLLEQGSASGRRDKASAAL"
FT   sig_peptide     complement(722652..722744)
FT                   /locus_tag="RPB_0637"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.896) with cleavage site probability 0.824 at
FT                   residue 31"
FT   gene            complement(722757..723062)
FT                   /locus_tag="RPB_0638"
FT   CDS_pept        complement(722757..723062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0638"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05349"
FT                   /db_xref="GOA:Q2J2G1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2G1"
FT                   /protein_id="ABD05349.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRETGDTDTGA"
FT   gene            complement(723235..724200)
FT                   /locus_tag="RPB_0639"
FT   CDS_pept        complement(723235..724200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0639"
FT                   /product="signal peptide peptidase A. Serine peptidase.
FT                   MEROPS family S49"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05350"
FT                   /db_xref="GOA:Q2J2G0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2G0"
FT                   /protein_id="ABD05350.1"
FT                   /translation="MSLDSDVIVDRRRIRRKLTFWRVAAVLVAIGAVIAVGAMVSPAGP
FT                   ALTTSGSIARIKIDGLIRSNSERVEALERLEKSNSAAVIVHINSPGGTTAGSEELYTAL
FT                   MRLKAKKPMVVVVEGLAASGGYIAALASDHIIAQQSSLVGSIGVLFQYPNVSELMKTVG
FT                   VKVEEVKSSPLKAAPNGFEPTSPEARAALESLVRDSYAWFRDLVKQRRAMDDDQLGIVA
FT                   DGRVFTGRQAVGLKLIDQLGDEKTAVAWLETEKRVKSGLPVRDFKLSPQFGDLTFLRAA
FT                   ASITLDALGLGVIARQVEQSGAMHLGLDGMLALWVPGSTR"
FT   sig_peptide     complement(724078..724200)
FT                   /locus_tag="RPB_0639"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.403 at
FT                   residue 41"
FT   gene            complement(724493..726190)
FT                   /locus_tag="RPB_0640"
FT   CDS_pept        complement(724493..726190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0640"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05351"
FT                   /db_xref="GOA:Q2J2F9"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2F9"
FT                   /protein_id="ABD05351.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGIVVAIEKDMA
FT                   VIDVGLKTEGRVALREFAGPGRDSELKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQGNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKYPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKQPGEQVIDNFKKGDMVKAIVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAIVTCEVLDVKESGIDVQIVGTDFATFIKRSELARDRNDQRAERFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
FT   gene            complement(726487..727125)
FT                   /locus_tag="RPB_0641"
FT   CDS_pept        complement(726487..727125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0641"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05352"
FT                   /db_xref="GOA:Q2J2F8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2F8"
FT                   /protein_id="ABD05352.1"
FT                   /translation="MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLDG
FT                   GADLTDQAQAIAAAQGLDPGLFGDPALKSQTVGDAASVISAYPKVREVLVGFQRQFAAE
FT                   PPGAVLDGRDIGTVICPDADVKIFVVADPGVRARRRALEAQARGEPADEAVILADILRR
FT                   DERDKGRSAAPLKQAPDAVLLDNSNLDIEGGVRAAIAIVEAVRAGRRRV"
FT   gene            727298..727972
FT                   /locus_tag="RPB_0642"
FT   CDS_pept        727298..727972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0642"
FT                   /product="Protein of unknown function DUF374"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05353"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2F7"
FT                   /protein_id="ABD05353.1"
FT                   /translation="MATPAFVKRILRSDAFQWAAVIPAAAYLQLVMWTGRFDRAPFPIA
FT                   EPYILAMWHGRLNMLPMLRNGGKPMIALISGHRDGQIISKAGAVYGIQTAVGSSSKGGM
FT                   RAAREMLRLARDGHSLFVTPDGPRGPRMHINNDGILDLARLTGLPILPVAVSMQRGKLL
FT                   RSWDRLLLPGLFSKIAIRFGEPIVVDADADRAELRARLSASLTAAQQETDRLVGRVPVE
FT                   PA"
FT   gene            complement(727983..729320)
FT                   /locus_tag="RPB_0643"
FT   CDS_pept        complement(727983..729320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0643"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05354"
FT                   /db_xref="GOA:Q2J2F6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2J2F6"
FT                   /protein_id="ABD05354.1"
FT                   /translation="MSHSDHTAPLEARLSAALSGTARVPGDKSISHRALILGALAVGET
FT                   RISGLLEGEDVLNTARAMRALGAQVERTGDCAWSVHGVGVAGFAPPAAPLDFGNSGTGC
FT                   RLAMGAVAGSPIIATFDGDASLRSRPMRRIVDPLEQMGARVTQSADGGRLPLTLQGARD
FT                   PLPITYRTPVPSAQIKSAVLLAGLSAPGVTTVIEAEASRDHTELMLQHFGATVVTEPEG
FT                   PHGRKISLTGQPELRGAPVVVPADPSSAAFPMVAALIVPGSDVVLTEVMTNPLRTGLIT
FT                   TLREMGGLIEESETRGDAGEPMARFRIRGSQLRGVEVPPERAPSMIDEYLVLAVAAAFA
FT                   EGTTIMRGLHELRVKESDRLEATAAMLRVNGVTVEISGDDLIVEGKGHVPGGGLVATHM
FT                   DHRIAMSALVMGLAADKPVRVDDTAFIATSFPDFVPMMQRLGAEFG"
FT   gene            729415..729873
FT                   /locus_tag="RPB_0644"
FT   CDS_pept        729415..729873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPB_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPB_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABD05355"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q2J2F5"
FT                   /protein_id="ABD05355.1"
FT                   /translation="MATSQVKHRFSRNPKVAQVAKSDLGTKRICPVTGKKFYDLNKTPV
FT                   ISPYTGEVVPIAPVVASRSRADARSAAAPAAAEAPEAMEAEELVSLEEADAEEKTGKVK
FT                   AIVPESEDDIEIDESIEDDDDSTFIADEEEGDEDVTDIIGDVSGDEET"
FT   gene            729941..730016
FT                   /locus_tag="RPB_R0010"
FT                   /note="tRNA-Ala2"
FT