(data stored in ACNUC7421 zone)

EMBL: CP000251

ID   CP000251; SV 1; circular; genomic DNA; STD; PRO; 5013479 BP.
XX
AC   CP000251; AAHD01000000-AAHD01000097;
XX
PR   Project:PRJNA12634;
XX
DT   30-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Anaeromyxobacter dehalogenans 2CP-C, complete genome.
XX
KW   .
XX
OS   Anaeromyxobacter dehalogenans 2CP-C
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
XX
RN   [1]
RP   1-5013479
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Brettin T., Bruce D., Han C., Tapia R.,
RA   Gilna P., Kiss H., Schmutz J., Larimer F., Land M., Kyrpides N.,
RA   Anderson I., Sanford R.A., Ritalahti K.M., Thomas H.S., Kirby J.R.,
RA   Zhulin I.B., Loeffler F.E., Richardson P.;
RT   "Complete sequence of Anaeromyxobacter dehalogenans 2CP-C";
RL   Unpublished.
XX
RN   [2]
RP   1-5013479
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Brettin T., Bruce D., Han C., Tapia R.,
RA   Gilna P., Kiss H., Schmutz J., Larimer F., Land M., Kyrpides N.,
RA   Anderson I., Sanford R.A., Ritalahti K.M., Thomas H.S., Kirby J.R.,
RA   Zhulin I.B., Loeffler F.E., Richardson P.;
RT   ;
RL   Submitted (24-JAN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 161e621d29cf34b77b4db51008090566.
DR   BioSample; SAMN02598274.
DR   EnsemblGenomes-Gn; Adeh_R0001.
DR   EnsemblGenomes-Gn; Adeh_R0002.
DR   EnsemblGenomes-Gn; Adeh_R0003.
DR   EnsemblGenomes-Gn; Adeh_R0004.
DR   EnsemblGenomes-Gn; Adeh_R0005.
DR   EnsemblGenomes-Gn; Adeh_R0006.
DR   EnsemblGenomes-Gn; Adeh_R0007.
DR   EnsemblGenomes-Gn; Adeh_R0008.
DR   EnsemblGenomes-Gn; Adeh_R0009.
DR   EnsemblGenomes-Gn; Adeh_R0010.
DR   EnsemblGenomes-Gn; Adeh_R0011.
DR   EnsemblGenomes-Gn; Adeh_R0012.
DR   EnsemblGenomes-Gn; Adeh_R0013.
DR   EnsemblGenomes-Gn; Adeh_R0014.
DR   EnsemblGenomes-Gn; Adeh_R0015.
DR   EnsemblGenomes-Gn; Adeh_R0016.
DR   EnsemblGenomes-Gn; Adeh_R0017.
DR   EnsemblGenomes-Gn; Adeh_R0018.
DR   EnsemblGenomes-Gn; Adeh_R0019.
DR   EnsemblGenomes-Gn; Adeh_R0020.
DR   EnsemblGenomes-Gn; Adeh_R0021.
DR   EnsemblGenomes-Gn; Adeh_R0022.
DR   EnsemblGenomes-Gn; Adeh_R0023.
DR   EnsemblGenomes-Gn; Adeh_R0024.
DR   EnsemblGenomes-Gn; Adeh_R0025.
DR   EnsemblGenomes-Gn; Adeh_R0026.
DR   EnsemblGenomes-Gn; Adeh_R0027.
DR   EnsemblGenomes-Gn; Adeh_R0028.
DR   EnsemblGenomes-Gn; Adeh_R0029.
DR   EnsemblGenomes-Gn; Adeh_R0030.
DR   EnsemblGenomes-Gn; Adeh_R0031.
DR   EnsemblGenomes-Gn; Adeh_R0032.
DR   EnsemblGenomes-Gn; Adeh_R0033.
DR   EnsemblGenomes-Gn; Adeh_R0034.
DR   EnsemblGenomes-Gn; Adeh_R0035.
DR   EnsemblGenomes-Gn; Adeh_R0036.
DR   EnsemblGenomes-Gn; Adeh_R0037.
DR   EnsemblGenomes-Gn; Adeh_R0038.
DR   EnsemblGenomes-Gn; Adeh_R0039.
DR   EnsemblGenomes-Gn; Adeh_R0040.
DR   EnsemblGenomes-Gn; Adeh_R0041.
DR   EnsemblGenomes-Gn; Adeh_R0042.
DR   EnsemblGenomes-Gn; Adeh_R0043.
DR   EnsemblGenomes-Gn; Adeh_R0044.
DR   EnsemblGenomes-Gn; Adeh_R0045.
DR   EnsemblGenomes-Gn; Adeh_R0046.
DR   EnsemblGenomes-Gn; Adeh_R0047.
DR   EnsemblGenomes-Gn; Adeh_R0048.
DR   EnsemblGenomes-Gn; Adeh_R0049.
DR   EnsemblGenomes-Gn; Adeh_R0051.
DR   EnsemblGenomes-Gn; Adeh_R0054.
DR   EnsemblGenomes-Gn; Adeh_R0055.
DR   EnsemblGenomes-Gn; Adeh_R0056.
DR   EnsemblGenomes-Gn; Adeh_R0057.
DR   EnsemblGenomes-Gn; Adeh_R0058.
DR   EnsemblGenomes-Gn; EBG00001041322.
DR   EnsemblGenomes-Gn; EBG00001041323.
DR   EnsemblGenomes-Gn; EBG00001041324.
DR   EnsemblGenomes-Gn; EBG00001041325.
DR   EnsemblGenomes-Gn; EBG00001041326.
DR   EnsemblGenomes-Gn; EBG00001041327.
DR   EnsemblGenomes-Gn; EBG00001041328.
DR   EnsemblGenomes-Gn; EBG00001041329.
DR   EnsemblGenomes-Gn; EBG00001041330.
DR   EnsemblGenomes-Gn; EBG00001041331.
DR   EnsemblGenomes-Gn; EBG00001041332.
DR   EnsemblGenomes-Gn; EBG00001041333.
DR   EnsemblGenomes-Gn; EBG00001041334.
DR   EnsemblGenomes-Gn; EBG00001041335.
DR   EnsemblGenomes-Gn; EBG00001041336.
DR   EnsemblGenomes-Gn; EBG00001041337.
DR   EnsemblGenomes-Gn; EBG00001041338.
DR   EnsemblGenomes-Gn; EBG00001041339.
DR   EnsemblGenomes-Gn; EBG00001041340.
DR   EnsemblGenomes-Gn; EBG00001041341.
DR   EnsemblGenomes-Gn; EBG00001041342.
DR   EnsemblGenomes-Gn; EBG00001041345.
DR   EnsemblGenomes-Gn; EBG00001041347.
DR   EnsemblGenomes-Gn; EBG00001041349.
DR   EnsemblGenomes-Gn; EBG00001041353.
DR   EnsemblGenomes-Gn; EBG00001041355.
DR   EnsemblGenomes-Gn; EBG00001041356.
DR   EnsemblGenomes-Gn; EBG00001041358.
DR   EnsemblGenomes-Gn; EBG00001041359.
DR   EnsemblGenomes-Gn; EBG00001041361.
DR   EnsemblGenomes-Gn; EBG00001041362.
DR   EnsemblGenomes-Gn; EBG00001041363.
DR   EnsemblGenomes-Gn; EBG00001041364.
DR   EnsemblGenomes-Gn; EBG00001041366.
DR   EnsemblGenomes-Gn; EBG00001041367.
DR   EnsemblGenomes-Gn; EBG00001041368.
DR   EnsemblGenomes-Gn; EBG00001041369.
DR   EnsemblGenomes-Gn; EBG00001041372.
DR   EnsemblGenomes-Gn; EBG00001041375.
DR   EnsemblGenomes-Gn; EBG00001041378.
DR   EnsemblGenomes-Gn; EBG00001041382.
DR   EnsemblGenomes-Gn; EBG00001041385.
DR   EnsemblGenomes-Gn; EBG00001041388.
DR   EnsemblGenomes-Gn; EBG00001041392.
DR   EnsemblGenomes-Gn; EBG00001041393.
DR   EnsemblGenomes-Gn; EBG00001041394.
DR   EnsemblGenomes-Gn; EBG00001041395.
DR   EnsemblGenomes-Gn; EBG00001041396.
DR   EnsemblGenomes-Gn; EBG00001041399.
DR   EnsemblGenomes-Gn; EBG00001041401.
DR   EnsemblGenomes-Gn; EBG00001041403.
DR   EnsemblGenomes-Gn; EBG00001041405.
DR   EnsemblGenomes-Gn; EBG00001041406.
DR   EnsemblGenomes-Gn; EBG00001041407.
DR   EnsemblGenomes-Gn; EBG00001041409.
DR   EnsemblGenomes-Gn; EBG00001041411.
DR   EnsemblGenomes-Gn; EBG00001041413.
DR   EnsemblGenomes-Gn; EBG00001041414.
DR   EnsemblGenomes-Gn; EBG00001041415.
DR   EnsemblGenomes-Gn; EBG00001041417.
DR   EnsemblGenomes-Gn; EBG00001041418.
DR   EnsemblGenomes-Gn; EBG00001041419.
DR   EnsemblGenomes-Gn; EBG00001041420.
DR   EnsemblGenomes-Tr; Adeh_R0001-1.
DR   EnsemblGenomes-Tr; Adeh_R0002-1.
DR   EnsemblGenomes-Tr; Adeh_R0003-1.
DR   EnsemblGenomes-Tr; Adeh_R0004-1.
DR   EnsemblGenomes-Tr; Adeh_R0005-1.
DR   EnsemblGenomes-Tr; Adeh_R0006-1.
DR   EnsemblGenomes-Tr; Adeh_R0007-1.
DR   EnsemblGenomes-Tr; Adeh_R0008-1.
DR   EnsemblGenomes-Tr; Adeh_R0009-1.
DR   EnsemblGenomes-Tr; Adeh_R0010-1.
DR   EnsemblGenomes-Tr; Adeh_R0011-1.
DR   EnsemblGenomes-Tr; Adeh_R0012-1.
DR   EnsemblGenomes-Tr; Adeh_R0013-1.
DR   EnsemblGenomes-Tr; Adeh_R0014-1.
DR   EnsemblGenomes-Tr; Adeh_R0015-1.
DR   EnsemblGenomes-Tr; Adeh_R0016-1.
DR   EnsemblGenomes-Tr; Adeh_R0017-1.
DR   EnsemblGenomes-Tr; Adeh_R0018-1.
DR   EnsemblGenomes-Tr; Adeh_R0019-1.
DR   EnsemblGenomes-Tr; Adeh_R0020-1.
DR   EnsemblGenomes-Tr; Adeh_R0021-1.
DR   EnsemblGenomes-Tr; Adeh_R0022-1.
DR   EnsemblGenomes-Tr; Adeh_R0023-1.
DR   EnsemblGenomes-Tr; Adeh_R0024-1.
DR   EnsemblGenomes-Tr; Adeh_R0025-1.
DR   EnsemblGenomes-Tr; Adeh_R0026-1.
DR   EnsemblGenomes-Tr; Adeh_R0027-1.
DR   EnsemblGenomes-Tr; Adeh_R0028-1.
DR   EnsemblGenomes-Tr; Adeh_R0029-1.
DR   EnsemblGenomes-Tr; Adeh_R0030-1.
DR   EnsemblGenomes-Tr; Adeh_R0031-1.
DR   EnsemblGenomes-Tr; Adeh_R0032-1.
DR   EnsemblGenomes-Tr; Adeh_R0033-1.
DR   EnsemblGenomes-Tr; Adeh_R0034-1.
DR   EnsemblGenomes-Tr; Adeh_R0035-1.
DR   EnsemblGenomes-Tr; Adeh_R0036-1.
DR   EnsemblGenomes-Tr; Adeh_R0037-1.
DR   EnsemblGenomes-Tr; Adeh_R0038-1.
DR   EnsemblGenomes-Tr; Adeh_R0039-1.
DR   EnsemblGenomes-Tr; Adeh_R0040-1.
DR   EnsemblGenomes-Tr; Adeh_R0041-1.
DR   EnsemblGenomes-Tr; Adeh_R0042-1.
DR   EnsemblGenomes-Tr; Adeh_R0043-1.
DR   EnsemblGenomes-Tr; Adeh_R0044-1.
DR   EnsemblGenomes-Tr; Adeh_R0045-1.
DR   EnsemblGenomes-Tr; Adeh_R0046-1.
DR   EnsemblGenomes-Tr; Adeh_R0047-1.
DR   EnsemblGenomes-Tr; Adeh_R0048-1.
DR   EnsemblGenomes-Tr; Adeh_R0049-1.
DR   EnsemblGenomes-Tr; Adeh_R0051-1.
DR   EnsemblGenomes-Tr; Adeh_R0054-1.
DR   EnsemblGenomes-Tr; Adeh_R0055-1.
DR   EnsemblGenomes-Tr; Adeh_R0056-1.
DR   EnsemblGenomes-Tr; Adeh_R0057-1.
DR   EnsemblGenomes-Tr; Adeh_R0058-1.
DR   EnsemblGenomes-Tr; EBT00001643956.
DR   EnsemblGenomes-Tr; EBT00001643957.
DR   EnsemblGenomes-Tr; EBT00001643958.
DR   EnsemblGenomes-Tr; EBT00001643959.
DR   EnsemblGenomes-Tr; EBT00001643960.
DR   EnsemblGenomes-Tr; EBT00001643961.
DR   EnsemblGenomes-Tr; EBT00001643962.
DR   EnsemblGenomes-Tr; EBT00001643963.
DR   EnsemblGenomes-Tr; EBT00001643964.
DR   EnsemblGenomes-Tr; EBT00001643965.
DR   EnsemblGenomes-Tr; EBT00001643966.
DR   EnsemblGenomes-Tr; EBT00001643967.
DR   EnsemblGenomes-Tr; EBT00001643968.
DR   EnsemblGenomes-Tr; EBT00001643969.
DR   EnsemblGenomes-Tr; EBT00001643970.
DR   EnsemblGenomes-Tr; EBT00001643971.
DR   EnsemblGenomes-Tr; EBT00001643972.
DR   EnsemblGenomes-Tr; EBT00001643973.
DR   EnsemblGenomes-Tr; EBT00001643974.
DR   EnsemblGenomes-Tr; EBT00001643975.
DR   EnsemblGenomes-Tr; EBT00001643976.
DR   EnsemblGenomes-Tr; EBT00001643977.
DR   EnsemblGenomes-Tr; EBT00001643978.
DR   EnsemblGenomes-Tr; EBT00001643979.
DR   EnsemblGenomes-Tr; EBT00001643980.
DR   EnsemblGenomes-Tr; EBT00001643981.
DR   EnsemblGenomes-Tr; EBT00001643982.
DR   EnsemblGenomes-Tr; EBT00001643983.
DR   EnsemblGenomes-Tr; EBT00001643984.
DR   EnsemblGenomes-Tr; EBT00001643985.
DR   EnsemblGenomes-Tr; EBT00001643986.
DR   EnsemblGenomes-Tr; EBT00001643987.
DR   EnsemblGenomes-Tr; EBT00001643988.
DR   EnsemblGenomes-Tr; EBT00001643989.
DR   EnsemblGenomes-Tr; EBT00001643990.
DR   EnsemblGenomes-Tr; EBT00001643991.
DR   EnsemblGenomes-Tr; EBT00001643992.
DR   EnsemblGenomes-Tr; EBT00001643993.
DR   EnsemblGenomes-Tr; EBT00001643994.
DR   EnsemblGenomes-Tr; EBT00001643995.
DR   EnsemblGenomes-Tr; EBT00001643996.
DR   EnsemblGenomes-Tr; EBT00001643997.
DR   EnsemblGenomes-Tr; EBT00001643998.
DR   EnsemblGenomes-Tr; EBT00001643999.
DR   EnsemblGenomes-Tr; EBT00001644000.
DR   EnsemblGenomes-Tr; EBT00001644001.
DR   EnsemblGenomes-Tr; EBT00001644002.
DR   EnsemblGenomes-Tr; EBT00001644003.
DR   EnsemblGenomes-Tr; EBT00001644004.
DR   EnsemblGenomes-Tr; EBT00001644005.
DR   EnsemblGenomes-Tr; EBT00001644006.
DR   EnsemblGenomes-Tr; EBT00001644007.
DR   EnsemblGenomes-Tr; EBT00001644008.
DR   EnsemblGenomes-Tr; EBT00001644009.
DR   EnsemblGenomes-Tr; EBT00001644010.
DR   EnsemblGenomes-Tr; EBT00001644011.
DR   EnsemblGenomes-Tr; EBT00001644012.
DR   EnsemblGenomes-Tr; EBT00001644013.
DR   EnsemblGenomes-Tr; EBT00001644014.
DR   EnsemblGenomes-Tr; EBT00001644015.
DR   EnsemblGenomes-Tr; EBT00001644016.
DR   EnsemblGenomes-Tr; EBT00001644017.
DR   EnsemblGenomes-Tr; EBT00001644018.
DR   EuropePMC; PMC1449079; 16597981.
DR   EuropePMC; PMC1472366; 16672509.
DR   EuropePMC; PMC2330069; 18461135.
DR   EuropePMC; PMC2687297; 19346346.
DR   EuropePMC; PMC2798628; 19897758.
DR   EuropePMC; PMC3408162; 22661709.
DR   EuropePMC; PMC4319575; 25614562.
DR   EuropePMC; PMC4907195; 27084012.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000251.
DR   SILVA-SSU; CP000251.
DR   StrainInfo; 355535; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Frank Loeffler
CC   (frank.loeffler@ce.gatech.edu)
CC   Contact: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5013479
FT                   /organism="Anaeromyxobacter dehalogenans 2CP-C"
FT                   /strain="2CP-C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290397"
FT   gene            22..1395
FT                   /locus_tag="Adeh_0001"
FT   CDS_pept        22..1395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79779"
FT                   /db_xref="GOA:Q2ILV0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79779.1"
FT                   /translation="MEAPASALVETPLDDLWSRIDGFLRARCREDLYERWFEPLRPVSL
FT                   GEGRLQIGAPDKFHRDFVEDNYRGWFEEFIPELTGERLRIAFAVDDAPRPIGAPASPPP
FT                   AAVAARAAEPHLEPRDSRPNPRYAFDTFVVGASNHFAFAAAQAVAANPGRTWNPLFLHG
FT                   DSGLGKTHLLHAVAHAILEKSGGRVAIVSSERYTNDFVAALSRGTMDEFRRKYRECSAL
FT                   LVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDERLCSRFEWGMR
FT                   VQIEVPEFETRAAILQKKADVEKIDLPDDVTQLLAQHIRSNVRELEGALMRLAAFASLK
FT                   SEPITVPLARDVLSDVIPPPGYRPPIEKIQEAVAGHYGLTVAKLTSASREQKIAFPRQV
FT                   AMYLCRELAKEKFQSIAEKFNKKDHTTVIAAVDRVKGLLESDDAVRTAVAQLSAKLAP"
FT   gene            1811..2938
FT                   /locus_tag="Adeh_0002"
FT   CDS_pept        1811..2938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79780"
FT                   /db_xref="GOA:Q2ILU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79780.1"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFADVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERTVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRARFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
FT   gene            2958..4076
FT                   /locus_tag="Adeh_0003"
FT   CDS_pept        2958..4076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79781"
FT                   /db_xref="GOA:Q2ILU8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ILU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79781.1"
FT                   /translation="MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGAADAAVAGDFEGPGGVRRVAVQVAAGGRTASLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRSGTAEVEASFREPLVRAGARLLVRRRDLVAELAPRLRAAFAEISGPAAPEADLA
FT                   YRAAGGVEVGHPEAEVAARLARALETRLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTTTDRRLIEPAAGPDTAFYEVRSGVVSPLVS"
FT   gene            4264..6651
FT                   /locus_tag="Adeh_0004"
FT   CDS_pept        4264..6651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79782"
FT                   /db_xref="GOA:Q2ILU7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79782.1"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGARGLHHLVYEVVDNSVDEAMAGRAN
FT                   EINVAIHADNSVTVLDNGSGIPVGPHPTVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYRDGKVWAQRYERGTPAGKVTAIGETQRRGTRITFKPDAT
FT                   IFEVTEYSFETLSGRLRELAFLNAGLKITIEDERHGKKHEFLFKDGIREFVAFLNKSRD
FT                   VLFQPPIALRQEVETERGAALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISVRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLSAFLDENPNVAKRICGKVAEAARARIAARKARETVRRKGALDSASLPGK
FT                   LADCQSRDPKESELYLVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLGSA
FT                   EIATIITALGTGIGPEEFDVEKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPSVIER
FT                   GLVYIAQPPLFRVAKGKKESYLKDEAALDEYLLALGTDRTRLVAGETVVEGRDLARLAR
FT                   DAIAYRALLARVDRRRDSRIVDAAIQLGDLDLDLLKHHEQVKEQVQKIFEKAQKLHPEL
FT                   QVRIAKIERDEEHGCDALVYQTSMAGAPRDTRLDHDYLSGAEWGELAALHAAIAELGPG
FT                   PFRLETPEGAEEVLDVFEAVEAVKKAAGQGQTIQRYKGLGEMNPEQLWETTMDPARRTM
FT                   LQVRVDDTVEADEVFSILMGDAVEPRREFIEKHALDVQNLDI"
FT   gene            6733..7728
FT                   /locus_tag="Adeh_0005"
FT   CDS_pept        6733..7728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0005"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79783"
FT                   /db_xref="GOA:Q2ILV1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79783.1"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTRHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGMYRRILLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSCHLHADGRFARDLFTDAPGSIYHPRVQPRMLEDASIFPHME
FT                   GQKVFKHAVVRMPEVLKEAFDKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVVRGDLVGLCAFGAGFTWASALVRW"
FT   gene            7820..7893
FT                   /gene="tRNA-Gln1"
FT                   /locus_tag="Adeh_R0001"
FT   tRNA            7820..7893
FT                   /gene="tRNA-Gln1"
FT                   /locus_tag="Adeh_R0001"
FT                   /product="tRNA-Gln"
FT   gene            7938..8459
FT                   /locus_tag="Adeh_0006"
FT   CDS_pept        7938..8459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0006"
FT                   /product="Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79784"
FT                   /db_xref="GOA:Q2ILV4"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79784.1"
FT                   /translation="MAAPSHVLLIGLGNVGPKTLAEAAQALRDVYGLASKAGPSLDRPQ
FT                   YAFNKDRGQYHAPAIVRRLAALRAGAGGVPVLGVVDVDLFLPDAAYVLGDADRDAGAAV
FT                   YSVSRLGAADPALARRRIQVEAVHGVGHLLGLSHCLDFRCAMFLSRDAADSDRKGPGLC
FT                   ASCRTSLARP"
FT   gene            8483..9259
FT                   /locus_tag="Adeh_0007"
FT   CDS_pept        8483..9259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79785.1"
FT                   /translation="MSCGACCGLYNAEDLSRPSLHAELARRTRVLREVERTPAAFHAAA
FT                   AALAVGGPAPLFPSVRVCPLLGFLDEAESRVGCLAHPAANGGVDLRDCGVYDVATCDAF
FT                   LCPSHAWLSEEEAAIAAAACDDYHLYGLVITDVEFVRAALAGVAVRAGARVELRHLEHP
FT                   PFRAALRELFALKEELAPGSDGLFGAFRPGADGEPVARRIDYEALGRTGGSPHDRILTC
FT                   VGADPRSGNDLEALEAEVRRRLDACAEVFGGTRPPG"
FT   gene            complement(9256..11391)
FT                   /locus_tag="Adeh_0008"
FT   CDS_pept        complement(9256..11391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79786"
FT                   /db_xref="GOA:Q2ILV2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79786.1"
FT                   /translation="MNPALTSAMLVVAAAVFTFTMTRRVMPLLALRRDVRTDRPGERLR
FT                   ALVRYGLGQRRLVDPEERRPGLLHVVIFAAFLVLALRTVTMFGMGFSAGFHLPLLAPDS
FT                   GLGRAYGLVKDVMVLLALVAVLGFLWRRLVTRPDRVTRSTEGVVILFFIAGLMITDVLF
FT                   DGALHVLREDPLGLGDLLAGAGFQLPAPRFDWLAPAGSLGAALYHGIGASAGTVSAVGE
FT                   ASFWLHLALILVFGNVLPYGKHFHIITGLPNVFFARLPPAGALRKLDLEAEDASYGTAT
FT                   VKDLSWKEAWDVYSCTECGRCQTHCPTYVTGKPLSHKEVNRSIRHHLAEVAPALTALAR
FT                   AKDPAVREAAAGALPPISEVIPPETFWACTTCGWCETACPVLIENVPRLVDMRRQAVQV
FT                   DSVFPDEAQRVFKGIETQGNPWGIGSNKRTEWCEDLDVPRAADGGDHEWLFFVGCAGAF
FT                   DDRQKKVSRAIVRILREAKVSFAILGEEETCTGDAARRLGNEYLFQMQATALTETLNGH
FT                   GVKKILVQCPHCLNTIANELPQFGGRYEVVHHADLIARLVKDGRLAPGVAEGLGQVTFH
FT                   DPCYLARWNGVTEAPREALAAAGVQVAEMPRNRRQGFCCGAGGGRFWLEEKLGARVNQN
FT                   RVEEAAATLGKAGGVIATGCPFCLTMMKDGVNETGREETLRVLDVAEIVALGLPKRAES
FT                   APAAAPESTPAAPRGEA"
FT   sig_peptide     complement(11335..11391)
FT                   /locus_tag="Adeh_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.669 at
FT                   residue 19"
FT   gene            complement(11509..12621)
FT                   /locus_tag="Adeh_0009"
FT   CDS_pept        complement(11509..12621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79787.1"
FT                   /translation="MAAAMLALEFRRRAARRSRGARRSEEPTMKRTLAILAPLAIAASG
FT                   CVVATPVPSEPPPVAMPAPPQPLQVWYYGEHFVPDTFGGGWCYEPGAHWHDYYPDQPSA
FT                   YVLDGGYYFYRGPLVFTYWEGHPVPGGGWCYVRGPHRHDYYPPRGNDWQWRRGRGWAYR
FT                   GNWRPERPPPPAYWPSRPAPYPSRPAPAPAPAPYPGRPAPAPYPGRPAPAPAPAPAPYP
FT                   DRPYPGRPAPAPAPAPLPAPAPYPGRPVPAPAPAPAPDERGHRDDAPGHGTLPPGHGGT
FT                   PPGQAAPAYPAPGRGNDRGNVQPPGHGGTPPGRAAPAPAPAPAPRDDARGGGNGQGRRD
FT                   DKGDKGDGGKKDDRKSRQQDDLKDRRFQRL"
FT   sig_peptide     complement(12472..12621)
FT                   /locus_tag="Adeh_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.919 at
FT                   residue 50"
FT   gene            complement(12881..13549)
FT                   /locus_tag="Adeh_0010"
FT   CDS_pept        complement(12881..13549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0010"
FT                   /product="DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79788"
FT                   /db_xref="GOA:Q2ILV6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79788.1"
FT                   /translation="MSPHYRHAQPVALVLYEDPLSPWCLVAERRILAALEDVEGAFGAL
FT                   QLEPYPTRLEPRAMTKSERRALARAARKAAREPEAAAVTDDLWLSPDPPLTSIPALTAL
FT                   AAARLQGPGREAALRHAIREASLVRGLNVARTDVLLELADRAGLDLHRFAGALAAPATE
FT                   RRVREVHESAFDKGIRGAPALVIGDEWLVTGPRSVDEYRTVLQRYASARLGLAPLKTLH
FT                   "
FT   gene            complement(13670..14653)
FT                   /locus_tag="Adeh_0011"
FT   CDS_pept        complement(13670..14653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0011"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79789"
FT                   /db_xref="GOA:Q2ILV5"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79789.1"
FT                   /translation="MPPGKKTARAKRAAARPRPEGGLGVAILSRNPRLYSTRRLIEAAT
FT                   ALGHAPRVLDTLRCNMVLARDRPRIFYLGEEVLATDVHVVIPRIGASITGYGVAVVNQF
FT                   DLMGVPVLAAATPIGRSRDKLRALQLLSRFGIDIPRTVMCRYREEVPEAVQMVGGLPCI
FT                   IKLIQGSQGVGVMIANTELEVRGLLDTLWTLGQEILLQELVAESKGRDVRALVVGDRVV
FT                   AAMRRTARAGEFRSNIHRGGVAESLELGREYAETAVKAARVMGLEVAGVDMLEARTGPK
FT                   IMEVNSSPGFEGLEAATGLDIAALYVRHAVEFASARQSGYASGHLA"
FT   gene            14776..17616
FT                   /locus_tag="Adeh_0012"
FT   CDS_pept        14776..17616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0012"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79790"
FT                   /db_xref="GOA:Q2ILW2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79790.1"
FT                   /translation="MDSKYSVNLPKTDFPMKANLPQREPEILRQWEEQAIFQRLVAQNA
FT                   GRPGAKRFVLHDGPPYANGDIHIGHALNKILKDVVVKYRNLNGEVADYIPGWDCHGLPI
FT                   ELKVDKELGPKKRELDRPAIIEACRKYAQKWIEKQRESFKRLGVFGRWETPYATMSRGY
FT                   EAEIVRTFARAAEKGFLYRGKKPVYWCITDRTALAEAEVEYEQHRSPSIYVAFDLVSKL
FT                   PDPKLAGRPARLVIWTTTPWTLPANLAVAAHPEFTYVAYDLNGQVVVVAKDLLAGFLAD
FT                   VAPGELSVTDVPAPHSPPAHEAATGGGGTVLAPHLAHPERVLAHLDGSALEGLRYRHPF
FT                   LDRESQVILGDHVTLEAGTGLVHTAPGHGQEDYVVGLRYGLEVLNPVDGAGRFTERAGK
FT                   YAGKKIFEANPEIVADLAASGHLLSDPKASLEHSYPHCWRCHNPVVFRATDQWFLSLEH
FT                   ADLRKATLAEIDRVRWIPHWGRERIHNMIENRPDWCVSRQRTWGVPIPVFYCEGCNEAL
FT                   LSPPVMERVAAAFEAEGMEAWYRHPPADFTQGAACPKCGKTEFRREQDILDVWWDSGVS
FT                   WAAVIEREGLELPVDLYLEGSDQHRGWFHSSLLTSMALRGAAPYRAVLTHGFILDQHGK
FT                   AMSKSAGNGIEPSEIIKKYGADILRLWVSASDYRDDIGLGDQILAGLAEGYRKIRNTIR
FT                   YALGALDGFDPARDAVPEAELEPIDRWALARLAAWDEKVAKAYEDYEFHLAYHATMQFC
FT                   AVELSALYFDVIKDRLYTWKADGRQRRSAQTALHAIAQDLIRLLAPILSFTASEAWSYL
FT                   PGRPTESVWLAGLPRRARPADADALEARYGKLFEVRGVVQSKLEEARRAKLIGSGLEAM
FT                   VTVRAEGEQRRLLEEARAELPALFIVSKVVLAAGPLSAEVARAPGVKCERCWIYAEEVG
FT                   RDAAHPTLCAKCVGNL"
FT   gene            17616..18236
FT                   /locus_tag="Adeh_0013"
FT   CDS_pept        17616..18236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0013"
FT                   /product="signal peptidase II, Aspartic peptidase, MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79791"
FT                   /db_xref="GOA:Q2ILW1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79791.1"
FT                   /translation="MRRPVSKWALLALLFTALLAADQWTKYLAVERLTVVFERGGDETL
FT                   AERVRGFYTYRHLEPLSTEPYYVWRPVWRMNYVENPGAAWGLFRGHSQFFRNAFFTLVS
FT                   VAAVAFILHYYRKLRQDQRYLQVALGLVLAGAVGNFVDRLARRYVIDFIEWYWWNRPDI
FT                   RWPTFNVADSLIVVGVAMLVLHPGSRREAARAPARRDAAAERV"
FT   sig_peptide     17616..17678
FT                   /locus_tag="Adeh_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.889 at
FT                   residue 21"
FT   gene            18249..19154
FT                   /locus_tag="Adeh_0014"
FT   CDS_pept        18249..19154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0014"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79792"
FT                   /db_xref="GOA:Q2ILW0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79792.1"
FT                   /translation="MLPVLFRIPLPGGASLPLHTYGLLIAIGFMVGIWLAQREAVRRGQ
FT                   DPRRLADLAFWILVSALVGSRVYYMLVNPGEFFSPARFLVETPFGRIPRVLAIWQGGLV
FT                   FYGGFIGAALTAAWYLRRHRMGFLEHADTLIPSVALGHFFGRLGCFGAGCCWGDVAHGH
FT                   LPWAARFPPESLAFQSFADRPDPGQYLAPDRLATLPLHPTQLYEAFGELGLFLLLVLVV
FT                   RPRKRFHGQVLAAWLMLYAVLRTGVEAFRGDVERGVILGLGVGQWTSIAIFAAGATVWA
FT                   RARRPAPAGAGPAAAPAGGR"
FT   gene            19187..19912
FT                   /locus_tag="Adeh_0015"
FT   CDS_pept        19187..19912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79793"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79793.1"
FT                   /translation="MALPPQKPGRPAGPPPSAEEAARAARHATDELTDETAKLEEELEA
FT                   LKARYEQYFLGTERREPARWRDEVRKKVLRLKGAFTRNTGLRFRIQSLHARYLSYERLW
FT                   QRSVREREEGTYRRDLVKARRRAGEAEAAPGNAAAPAPAATPSPSVNASAPPARTPAPP
FT                   TSAPPAGGDEARMRALYDAYIAAKRQCNEDVSRLSYDVVARSVAKQVPEVMARFKAKAV
FT                   DFRVEVKDGKAILKAIPRV"
FT   gene            20149..20520
FT                   /locus_tag="Adeh_0016"
FT   CDS_pept        20149..20520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79794"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79794.1"
FT                   /translation="MRALLPSIAAVLLCAACGRSDADARRARLGAERRALEATLDHLED
FT                   RLIVNQARVRFWREMQARHESVTAVACTSQEEHAIEMARHVLPDEPARRAGRRASIDRA
FT                   RVAAAPRAPAPVPVRAAAP"
FT   sig_peptide     20149..20217
FT                   /locus_tag="Adeh_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            20677..20749
FT                   /gene="tRNA-Phe1"
FT                   /locus_tag="Adeh_R0002"
FT   tRNA            20677..20749
FT                   /gene="tRNA-Phe1"
FT                   /locus_tag="Adeh_R0002"
FT                   /product="tRNA-Phe"
FT   gene            complement(20834..21325)
FT                   /locus_tag="Adeh_0017"
FT   CDS_pept        complement(20834..21325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0017"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79795"
FT                   /db_xref="GOA:Q2ILW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79795.1"
FT                   /translation="MNPTFDVMPDPPPRALVLHPEVSVRAELGWALGARDMASISAADG
FT                   ASGLALLLEELLSLDALVVALDLPGRDARAFADLVRRAGGEQELAIVVLASDPSPSLRD
FT                   ELAALGVDEVVDPRLGPDAVADAVVAAVQGRRAGAGIRPPRSSRGFGEPERLDPFRSAA
FT                   "
FT   gene            21603..21920
FT                   /locus_tag="Adeh_0018"
FT   CDS_pept        21603..21920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79796.1"
FT                   /translation="MDAWPAEAPPALGSLAEVRQRLDALLHQVTWTQHASTWLGRCEAG
FT                   PRSAELQLTPEADGQVRFVTIRRVERALVEELCAGLGVVAVDPQEMRLYRPEARAWSDA
FT                   R"
FT   gene            complement(21965..22762)
FT                   /locus_tag="Adeh_0019"
FT   CDS_pept        complement(21965..22762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79797"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79797.1"
FT                   /translation="MSTKTVACSLAFGVLLATPGRTAGQCTSADVPAGGIFTKLDAQGL
FT                   YSDLFSLTLVNLSDAALEGAADINATMAKYSVAYAPGMVRWDCADPPFYKLCSDAELNP
FT                   NTCQDVTQGFRPAPFTVRVERNDSAIWRGGWANDCYDGKIDFTWRTSTFQVKFKRQKVY
FT                   GGALAYPHYGTWTTLLPRTGSWCAPGTFCSGVWTTPHDYEMRNITTIAANELVVSLYST
FT                   DNQNLVVVLRETHWDGAQGDAYDGKRLDWVDNDSPRVPGDCNH"
FT   sig_peptide     complement(22691..22762)
FT                   /locus_tag="Adeh_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.586 at
FT                   residue 24"
FT   gene            complement(22777..24162)
FT                   /locus_tag="Adeh_0020"
FT   CDS_pept        complement(22777..24162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79798"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79798.1"
FT                   /translation="MSRTSRLHVLMVAILLPLAATAQTNYFPYGTAGEMQTDLVTYEGI
FT                   ARTVVVRILNLTPYRIEHTEATSTAYGDQYQVGTTLADVLDRDRLTAKAFFFAPVGVPA
FT                   VIPGVPPEAYTDGYVNTVTRPYEMVFSWNERAGRVEQSRVSWVVRGVQSWVCPPPPLGG
FT                   ECTPRHDDVHLGLWVTRPLDDPGESLYAGFFGSDFVGTMTMAVAFAGVITDPFNPLNWY
FT                   GLFIAAADMADPARFEEEQVAPDDGIEMYVASYPIPAPFTRSDPSQDCYLSNNNLVENE
FT                   LTAPSPALPDPRICTPQTVSGTADDGTDAQWADAAGPGASELITTIHVLRGRRYLPHSE
FT                   GGSACAGKWGSVPIVNVTIWTRDQYLSADVAGLAHASLASRPQRDPGAAKLVAEYRKFY
FT                   EKYDRAGLLAIREVVLALAPEAREQLRAAVLTVRSGGVLDKDAHKALHMVIVAARARLT
FT                   DDE"
FT   sig_peptide     complement(24094..24162)
FT                   /locus_tag="Adeh_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            24512..25921
FT                   /locus_tag="Adeh_0021"
FT   CDS_pept        24512..25921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0021"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79799"
FT                   /db_xref="GOA:Q2ILW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79799.1"
FT                   /translation="MASPGPDLRSRRFLFGGYVVVVASFLAASLYTAEHVREIDVASDE
FT                   IARDAMPTIRCLAEARHELGQFEIEAAAFVRAPVPAPSRAAAEAALRAVGEQVGIYLAL
FT                   PLFPGERPFWEDVQRGASRLMGAANRMLGEADGGDARLAGDTYLREVVPAAKRLHEVLS
FT                   RDLDFNARNGGQLAEHIKSVRARGLWLSLSLGVLCASIALLAGLIVAGQLRRHDALVIA
FT                   HERMMEERAGELEAFAGRVAHDIMNPIASAQMAIELELRDQEAEGAPAGERLERARRSL
FT                   RRIQTLVAGLLGFARAGARPETGATAELAEVVQDVLSGAEARATDAGMTLVAEVAPATV
FT                   ACAKGVLISLVANLVENAVKYARRGGRVVVRTRANDDAVRVEVEDDGPGLPPDLGDRVF
FT                   EPYVRGGARDVPGLGLGLATVKRLAEAHGGRVGVRSEPGRGATFWFELPRASAGEAPGG
FT                   ADRTPAAHRSA"
FT   gene            complement(25906..26295)
FT                   /locus_tag="Adeh_0022"
FT   CDS_pept        complement(25906..26295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0022"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79800"
FT                   /db_xref="GOA:Q2ILW7"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79800.1"
FT                   /translation="MTALQTIRQLDYTILFARNPEHMRRFYSAVMGFPIARELGPGWVE
FT                   FRVGSNLLVLTERGGLFDDPPTPEGALSVQLAFRVAPSVVDACAEELRRLEVPIVSPPT
FT                   DQPWGHRTLFFRDPDGNVLEIYADL"
FT   gene            26331..27236
FT                   /locus_tag="Adeh_0023"
FT   CDS_pept        26331..27236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0023"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79801"
FT                   /db_xref="GOA:Q2ILW6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79801.1"
FT                   /translation="MVMPVSIAKKVPADAGGGATTLAARALGDFLRRMRSRPALAVAGA
FT                   VRRRVTGLRREEVAVAAGISITWYTWLEQGRPVRTSRRTVRALARALRLGEAEAAHLSR
FT                   LAEAVAAAAPRWRRTAQASPALRAMVDGLGDAPAYVVNGRWDVLHANAAARATLGPFDG
FT                   SPGITDNVLVRLFLDPGWRARFLDWEAVASSAVAQFRAAGGRLVAHPDWNAFVANLAAR
FT                   SPEFGRAWEAQALADPHLRRKRLAAPGGEPLELLYASFAPDGEPEDVRVVLYVPADDAA
FT                   RAALVRAMRPPGPAPRRAAR"
FT   gene            27294..28826
FT                   /locus_tag="Adeh_0024"
FT   CDS_pept        27294..28826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0024"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79802"
FT                   /db_xref="GOA:Q2ILX2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2ILX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79802.1"
FT                   /translation="MSDASAETAIRPTRAENFSEWYLEVIKAADLAESSSVRGCMVIKP
FT                   WGYALWEHVQRVLDGMFKATGHVNAYFPLFIPLSLLEKEAAHVEGFAKECAVVTHHRLE
FT                   ARDGKLVPVGELEEPLIVRPTSETIIGESFARWVQSYRDLPLLINQWANVVRWEMRTRM
FT                   FLRTAEFLWQEGHTAHATEPEAIDETMQMLGIYARFAEEWMALPVVQGEKTESERFPGA
FT                   VRTYCIEAMMQDRKALQAGTSHFLGQNFAKASGIQFQDEKGTLTHAWTTSWGLSTRMIG
FT                   AMIMTHGDDDGMVCPPRLAPQQVVIIPVIQKPEVREQVLAWCTALKRELEAQTYAGAPV
FT                   RVHLDARDLQGAKKSWEWIKKGTPVRLEVGPRDIEKGAVFMGRRDRKPREKQSVPRAEL
FT                   VAGVGALLQEIQDALLERARTMRAAHTRVIDTKDEFYAYFTPPPTRRPNDPTPIHGGFA
FT                   LAHFAGDPAVEARIKEDLGVTVRCIPLEPGEPGTCAFTGQPSPKRVVWAKSY"
FT   gene            complement(28777..29313)
FT                   /locus_tag="Adeh_0025"
FT   CDS_pept        complement(28777..29313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79803"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79803.1"
FT                   /translation="MYLSSRAATVVAAALLTACAGARRAEAPPAALTARELTIVDAQGR
FT                   PRLRLGAPLPPPKGAERRAVDAFGIQFMDSDGYEVAGLGMLEPVDIRGLCFDIKDAYEA
FT                   MCVGLVKGEPSITFRHDWKERITMGVEQGVASIVLHDAQASPRIRLEVDRDGKTRVEGV
FT                   STTSPTPPASGSAAP"
FT   sig_peptide     complement(29236..29313)
FT                   /locus_tag="Adeh_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            29510..30589
FT                   /locus_tag="Adeh_0026"
FT   CDS_pept        29510..30589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79804"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79804.1"
FT                   /translation="MERTGRGFVGAVLLACLAVATSARGAESYTVVAGGLESPRGLAFG
FT                   PGGRLYVAQAGSGGTTGKISEIRGAGTASPAIRDVVTGLVSAGDEGEFVGVDGLSALGN
FT                   GTLYAIMALSNEATGFASALGHLLQVNPAGRVRSVADVGDFDFDWTAEHVELAPDDFPD
FT                   ANPYAVLAAGGRVYVADAGANTLDLVRPDGSIQVLAYFPNPLAPDGTPVKDATPTCIAE
FT                   GPDGALYVGTLALAASLRFGPSAAVYRVDPGAALPGDLEVTLNLATPWATGLPPINGCA
FT                   FGPDGSFYASLLATGPDLANPHSDVVKIPFDDPTARELLTGGELMFPAGVAVGPDGAVY
FT                   VSNHAAFVPDGQVVRLARR"
FT   sig_peptide     29510..29587
FT                   /locus_tag="Adeh_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 26"
FT   gene            complement(30623..31612)
FT                   /locus_tag="Adeh_0027"
FT   CDS_pept        complement(30623..31612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0027"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79805"
FT                   /db_xref="GOA:Q2ILX3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79805.1"
FT                   /translation="MPRPDPSLPPELHVVFGAGQVGRRLARELLALGHSVRLARRGPPG
FT                   PALPGLRWLSGDATDPLFAGEACRGADVVYDCTNPPDYHRWDELLAPLRRGIREAAARA
FT                   GARLVALDCLYMYGRPATSPFDEDAPLAPCSHKGELRALLALELLEAHARGDLRATTGR
FT                   ASDFFGPGAGAAALLGDRLAARLRAGKPFEAFGDPDLPHAYSYVADVARGLAVLGTHDA
FT                   ALGRAWHLPVAWTGSTRGLVEAIGAALGRPARLRAVPDWLLRVGGLLDPTLGAVAEMTY
FT                   QWKVPYVPDDRRFRAAFGVGPTPAAEAVTATARAIVEGEAPARSPKAA"
FT   gene            31692..32633
FT                   /locus_tag="Adeh_0028"
FT   CDS_pept        31692..32633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0028"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79806"
FT                   /db_xref="GOA:Q2ILX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79806.1"
FT                   /translation="MQSPPPAPPPAGALDWDHARVLRALLEARSLSGAGARLGVNASTV
FT                   SRRLAALEAALGARLFDRTPDGVLPTALAESLAPHAEAMERAANALALAAQGRELAAEG
FT                   EVRLTAAPGVAEYLLAPALPRLLAAHPGVRLTIDATIGYADLTRREADLAVRGVLPASG
FT                   DLLARKLGTATGGVFGAPRQARALGTLRSLDAARWITWGEDLAHLELTRCILDHVPPER
FT                   IALRTSHMGTQMAAARAGVGLVLADRNMALACGLAEVRLSPAVRRQLPSPRAGDLWLVV
FT                   HRALREVPRIAAVWDFVLDQARRLGLTPGNPA"
FT   gene            32805..35033
FT                   /locus_tag="Adeh_0029"
FT   CDS_pept        32805..35033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0029"
FT                   /product="Fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79807"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79807.1"
FT                   /translation="MRQPVHRHSRGGLHAPRGNASSRLHPITATAVALAALLVSGCGPE
FT                   EAPASSAQAGDPAPRKIVEPAPAPLPPRFTTQALPVAGEVCVGSAAHDKHAASGIGCAA
FT                   CHPCGGALGFANPVTFPGGTTSANGTIVSDASGTTCSVGCHAPLGAEPHGVTWTAGPLQ
FT                   CVTCHTDVGAIDPATALSAHPLPDASSGTSCQSCHDTSQHLSGEVRMVDGGGGSAAVTC
FT                   TGCHSGQGQTLSGETPPLLVGWDDLASGDFHGDRPGTCRFDVLDAAGQRSLGRGAYPCP
FT                   PNQPDQPGALRITPRWWYANGTSGAFAWICTLQPVDAAGNPVGAPRTGQPCPEGTIQNS
FT                   TCSSNPAAPSCYPTTLVTRGFGGTLLAPYARGQGAIACARCHDFHASNNAFLLAAEVNG
FT                   VTIPPGSIDRAGVGAQALCTACHQGDRHEVCKACHRERWVTDGSYSWFEGAPADPAPDG
FT                   AACFFCHGHEGIQQMEVTSPAYPPNHPYSSGQPQSACTHCHDGWAPPPTEYVAPRFQAG
FT                   PTATNLTATTATVTWTSSEKATSYVEYGVGTAGHVVGDDAFVVQHSIQLTGLTPGTTYV
FT                   WRVRTSDVFRNVTHTALQSFTTPAEGALPSPDLGAVEASFEVGTYEATVPLVWFPVTAP
FT                   AGAVLQYEVQLASDAAFTYLQNGSLTGPGVPGSSVGSTGWVNGTPTTSGGRPALQVPAR
FT                   LFNIPQDWCGPYAPRMYYWRVRVRDQAGHESGWSTPGSFGAFAWDMWC"
FT   gene            complement(35104..37059)
FT                   /locus_tag="Adeh_0030"
FT   CDS_pept        complement(35104..37059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0030"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79808"
FT                   /db_xref="GOA:Q2ILX4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79808.1"
FT                   /translation="MRSASLATKLVVSIGLAFALVLGGFTAVSAAFTARTVEQQTADAL
FT                   RGRVALVRDMVGVYDASLARATADLLRVFRASYPEGIRSDPSRAAYVEGVALPGLAAGE
FT                   RMVDLDYPTVDRFTATSGAVATVFARAGGDFVRITTSVQRDDGRRAVGTFLGADHPAHR
FT                   HLLEGEPYTGKAVLFGRDFFTRYEPILQDGKVIGALFVGVDFTEGLAALRERIRAVRTG
FT                   DQGYFLVVDASGGAGRNRMIVHPTRAGEAAPDGLAPALAARGGAAEGLRIAGADAKGAA
FT                   RAELATCQVFEPWEWLVCGAVPEEELKHDGRRLGLLLSVGGAALVAVLAGLALWLVRRL
FT                   VLEPLARTARFAERVAGGDLASELEVRARDEVGALGEALNEMVRALRAVVGTLRSASDA
FT                   VAEACQALSASTAQIAEGASEQAAGAETASGATTELAARVRDVAGGAAETESLAARSAA
FT                   SAAAGGKAVRRAVEAVQEIAGRTAVIEEIAHQTNLLALNAAIEAARSGVHGRGFAVVAT
FT                   EIRRLAERSRAAAAEIGALGASTVQAARLAGEALDAVVPDIARTSELVRGMAGATEEIS
FT                   AGAHEVTGAIGQLDAAIQASASSSEELASTAARLAEEAEALRRSAAWFRTGEPERAATP
FT                   AARPQALLGAGPGRAA"
FT   sig_peptide     complement(36970..37059)
FT                   /locus_tag="Adeh_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.343 at
FT                   residue 30"
FT   gene            37329..38351
FT                   /locus_tag="Adeh_0031"
FT   CDS_pept        37329..38351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0031"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79809"
FT                   /db_xref="GOA:Q2ILY0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79809.1"
FT                   /translation="MRRSTALSLTAALAAGAWLAARRLRRRRPLAGGVALVTGGSRGLG
FT                   LVLARELGRRGMRIVLCARDEEELERARGGLAQEGIDATALPGDVTDEDGMRTLVADVE
FT                   ENLGPVDLLVNSAGIIQVGPAEAMAVEDYRHAMDVLFFGPLHAAEAVLPGMRARRRGTI
FT                   VNVTSIGAAVGIPHLAPYDAAKFAARGWSEALGAEAAKHGIDVITVVPGLMRTGSFGRA
FT                   LVKGRRYAEASLFSLLASLPLVTVSAERAARRIVRAIEHGERFVIIGLPARLLRLAHSI
FT                   MPGAIVAILGFVNRFLPTAAPGARHGIALPAELFRRGLARSILTALGERAARRYNEEPA
FT                   "
FT   sig_peptide     37329..37388
FT                   /locus_tag="Adeh_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.636 at
FT                   residue 20"
FT   gene            complement(38433..39656)
FT                   /locus_tag="Adeh_0032"
FT   CDS_pept        complement(38433..39656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0032"
FT                   /product="membrane protein"
FT                   /function="involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79810"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79810.1"
FT                   /translation="MRKTFRIAFLAVLAAPAVALASGFEVININPRDLALSSSGVAAQE
FT                   DAAATFQNPAALSKLSGLNLSLAGSMLSIRTKWTGTDAYPGKETTKFAPTPPVALYAAY
FT                   GTKLAGRGLGFGFGVATPGGGQMKWDDQWEGRGRIITVERRMLGFYLNGGYELMPWLRV
FT                   GGGAIYYEGIQYLKQGIQPFPDAYAELDTKGGGFAYQLSAEVKPLENLTLGFDYKHKGT
FT                   MHMKGDAHFQVPPSLVGPTTQDQKVEQDLTFPNRIDTGLAWRVVKPVLVTLQYSWSRFV
FT                   VYQSDVFEGETTTIEVPRDYRNGNVIRGGVEWTALPSLRLRAGLMRDWSGLRTNTLSPT
FT                   LPDSNTTGYSVGAGWNVGSNLGLNGAFFYGDRDKQTATGTTAFPGSYKTDIWIVALGFT
FT                   WRTDLGGR"
FT   sig_peptide     complement(39591..39656)
FT                   /locus_tag="Adeh_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(39670..42618)
FT                   /locus_tag="Adeh_0033"
FT   CDS_pept        complement(39670..42618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79811"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79811.1"
FT                   /translation="MPLRRYGPPLALVFVSLLACTDVKQEKPAPQLVIATFASPNIPTP
FT                   NDLVLQAVPTLPDSAQKELLQSFIDAGGFPSDQEVAITVPFRAVNWNGSAYVETTPPDL
FT                   DPATVTPSTVALLKVDGAPQAVEFEVGSATAGRLVLRKKADASGSRRFAPGRYVVAVRG
FT                   GPSGVKTTAAQGALPVNADQAIAIAAQNKDLTVHENQPPGLTPALVAQLEAVRKTLWSP
FT                   LTWSDVGGRWTASVDTSVTPAFAAVAPTFAPSEVAAIATFGIAPAAAQPLTDSGSGQIP
FT                   LPSTFLLDGTRPANDPPTRFYVRNVPAFGPAAAGLATLDGFSTTGMMLAPLSAPVAASS
FT                   VNAQTVLLFELPEGAGAPRRMRDVAAALGAGAPATAEYLTQPPALNRTVQVGGADVAVT
FT                   TAIGLQPGVAVPVPGVGIVPTPPLKEKRNYAVVITDGVKDLAGNALKRSTLANILFTFT
FT                   NPPAVDGVSQLSGVSNADATALANLRAGLEPLLANLGALTGGAVTRDNVVMAYTVQTQT
FT                   VTDVSVGLSALPYRTPTAFVGQGVAPLDLATLGFDAAAQAALFPNVGGFLTAMVPTIDA
FT                   IDPATGALNPDTTQWAPKAIPAVVAYPSDAACTTATPCVRPLVVFHHGLSGGRLQMLTV
FT                   ANSLAARGFLVAAIDAPYHGDRAYCMENSECTTDGTADGVCTPDQAKAGQGDAIPPGTC
FT                   TTGHLRGTNLSTVASGNYFISGNFFRIRDAIRQDHIDQAALVLAVARPPTPFPQPAQDP
FT                   LAAALFQRGFAVNPTEVHYEGISLGGIIGTELLATNPRFARGVLNVPGGTLVDVFTNAP
FT                   AFATSVNELFLSLGIDRSQIPTNPAVASRYLQTLILAKWILDPAEPLNYAAHVRTKLAS
FT                   PLLAAPPAGLGGTGLVHATTDVLGQLAKCDPVVPNATTVVGGVPLPYGDELLALASAPS
FT                   TLYVSASAPNNCVPHGVLNDTLLPNSIGGQVRDDAAQFLFDLSAPVSPVTLP"
FT   gene            42897..44528
FT                   /locus_tag="Adeh_0034"
FT   CDS_pept        42897..44528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0034"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79812"
FT                   /db_xref="GOA:Q2ILX7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79812.1"
FT                   /translation="MNLELLTLAVGAYAAVLAFLGWLGYRRTRSAADYLVGGREIHPVL
FT                   MALAYGSTFISTSAIVGFAGVAALMGMGLLWLTMLNILLGVFVAFVVFGRPTRRLGAAL
FT                   DAHTFPELLGRRYRSRFIQGFAGGTIALLMPLYAAAVLIGGARFLEVQLRLDYHMALFV
FT                   FAAITVGYVLFGGLKGVVYTDAFQAVLMVCGMLVLLVATYAQVGGLSAHQALTDLADQV
FT                   PPALRAQGHRGWTAMPAAGSPLWWQMVSTIVLGVGIGVLAQPQLTVRFMTVKSGRELHR
FT                   ALVPGGLFLLLMAGVAYVVGSLTNLWYFQRTGKIALAIMTDPATGKPNVDRLMPLYTQA
FT                   AMPEWFAYLFMLALLAAAMSTLSAQFHAIGTAIGRDLYEQAFRLGGGAERTVLLARAGI
FT                   LAGFAGTVLLAWNLGPGVIAIATALFFGMCAATFLPAFVSALFWARSTRAGVIAGMLAG
FT                   FGAWALWVLFVHERESAALGVVKALTGRTSLGAGTTWALVDPIVVALPIAALVTVVGSL
FT                   AGRAAPGAETGGPARTREGGLDAGLR"
FT   sig_peptide     42897..42992
FT                   /locus_tag="Adeh_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.743) with cleavage site probability 0.280 at
FT                   residue 32"
FT   gene            44718..45995
FT                   /locus_tag="Adeh_0035"
FT   CDS_pept        44718..45995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79813.1"
FT                   /translation="MRRIHLALAVLATLAALPPARAQPAPAAPPAPQAPAPAAPAPAPA
FT                   AKPPGVTVDLSGWLIANAYWSDGGLNASDLPQWATTAHSTAGMTVRQSRVRAALGLPVD
FT                   GLLGGAVLKGLVEADFMGTYVNSDASMPQVRLRHAYLTAACARGNLTLLVGQTWSLFGG
FT                   PWFAASLGHVALPRFAGAGYLYRRAPQVRLTAEAGRGRDVGVTAAVAALASSGDKATSQ
FT                   NQLVGERAGVPDAEGRLALVLRRAGKAWLEVGASGRFGQQLWKLDGLSTPREERLTGWG
FT                   VAADGRLEVPHLVVQGGTFMGEVLGGYGSVAPVVRPTKDATDATKLDAISPVRTGGFWA
FT                   QAVVTPIPVLQLLGGYGIEEPRTSDLPAGAEATTIERNQQVSGGAILALTSRWKVSLEG
FT                   TLYTTETLDGARRESTQVEVGSLYAF"
FT   sig_peptide     44718..44786
FT                   /locus_tag="Adeh_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(46127..47452)
FT                   /locus_tag="Adeh_0036"
FT   CDS_pept        complement(46127..47452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0036"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79814"
FT                   /db_xref="GOA:Q2ILY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79814.1"
FT                   /translation="MARFALENRILDPEETLDRDALAALQGRRLAETVRRARAVPHHRK
FT                   ALERAGVRDEDLRGPDDVRRLPFTVKDDLRQSYPLGLLAVPREQVVRIHGSSGTTGRPT
FT                   FVAYTRRDLDTWTGLVARFLVAGGLRPEHTVHVAFGYGLFTGGFGLHYGIERVGAAVVP
FT                   SGGGNTPRQVRLICDLSADVLISTPSYALHVGEVARAEGLKPGDLPLRYGHFGGEPWTE
FT                   EMRGEIERSLGILAFNNYGLSEVIGPGVAGECPARDGMHVQEDHFIVECLDPVTLEPVP
FT                   DGEVGELVFTSLTKEAMPVLRYRTRDLAALDRSPCPCGRTGVRMSRVRGRSDDMLIIRG
FT                   VNVFPSQVEEALLRVEGTAPHYLIEVSRPGALDEAVVKVEVRPEDFRDEMREMVGLRDR
FT                   IDREIHAVTGIRMIVELVAPNTLERSAGKARRVLDHRKVGPA"
FT   gene            complement(47456..47899)
FT                   /locus_tag="Adeh_0037"
FT   CDS_pept        complement(47456..47899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0037"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79815"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79815.1"
FT                   /translation="MKIRQLSLFLENRPGQLRVPCQVLGDAGIDILTLSLADTQQFGIL
FT                   RLIVKDHTRARQVLEQAGVVVNVTDVLAVDVPDRPGGLAEVLQGFEACGLGIEYMYAYS
FT                   VRSRGEHATLVFRLSDPDRAAALLQARGVRLVGAAELFARAGA"
FT   gene            complement(47919..49244)
FT                   /locus_tag="Adeh_0038"
FT   CDS_pept        complement(47919..49244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0038"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79816"
FT                   /db_xref="GOA:Q2ILY1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79816.1"
FT                   /translation="MTTSWNDAGSAFHPASAPDFLPRRELEQLQLARLRAVVARAYEKV
FT                   PLLRQRMEARGVFPDALHALEDLARLPFTVKADLRDTYPFGLFASPVEEIVRLHASSGT
FT                   TGKPIVVAYTAADLEVWTSVMVRAFAACGLHQGDLIQNAYGYGLFTGGLGAHYGGEALG
FT                   ATVIPISGGNTERQLMVLQDFGVTAICCTPSYMVHLIERARDAKIGFGRLKVGVFGAEP
FT                   WSESMRAHIEREAGIRAHDIYGLSEIIGPGVGIECVHRDGLHLFEDHFYPEIVDPETGA
FT                   VLPDGAEGELVLTTLSKQAMPMIRYRTRDITALDPTPCACGRTLRRIRRIGRRSDDMFI
FT                   IRGVNVFPSQVETALLQVEGTLPHYQIVLTRAKGLDEMEVQVEVTPEVFSDEIRGLQRL
FT                   QEHLATALEQVLGIRAQVTLVAPRTLQRSEGKAKRVIDRRNI"
FT   gene            complement(49257..49745)
FT                   /locus_tag="Adeh_0039"
FT   CDS_pept        complement(49257..49745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0039"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79817"
FT                   /db_xref="GOA:Q2ILY8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79817.1"
FT                   /translation="MPSRTVNVVVAGLGGQGVIKASEILADTAFRAGLDVKKAEVHGMS
FT                   QRGGSVTTDVRFGAQVLSPMVPAGEADFLLVLAPSELEVTRPLLRPGGLLIPPDAVDEA
FT                   RLPNRRSLNVALLGLLSHHLDLDEAHWLAAIHAALPERLHAVNDAAFRLGRETAAAAR"
FT   gene            complement(49738..51378)
FT                   /locus_tag="Adeh_0040"
FT   CDS_pept        complement(49738..51378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0040"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79818"
FT                   /db_xref="GOA:Q2ILY7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79818.1"
FT                   /translation="MERRLLSGDEAVAAAARDAGVRLGTGYPGTPSTEILQALDALGGR
FT                   AQWAPNEKVALEVGLGAAFGGARALVTMKHVGLNVAADPLFTAAYTGVKGGLVVVSADD
FT                   PGMASSQNEQDNRHYAVAAGLPMLEPADSQEAYDLTVAAFELSERFAIPVILRMTTRVC
FT                   HSKTLAARRADLPAPPAPAFVRDIPGRVMIPAYARPAHRRLRKKLEALQAFAEETPLNV
FT                   WVKGDRALGVITSGVTARHVAEAAPSASRLELKTVYPLPLEKIRAFAASVDRCVVVEEG
FT                   DPVFADAIRAAGIAVESKEAPYRFGELDVQRVRRILARDPSPEPELPKGRPPALCEACP
FT                   YHPVYATLRKLDCIVAGDIGCYTLGVLPPYQGIDTCVAMGASLGVGLGLRHVLPEADAR
FT                   RVVSIIGDSTFIHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTGKVSIEGLARALGVANVDVIDPVADPAGWEELLKERLAEPKLSVIIARRPCILAAAD
FT                   IRRYEKAADEKRAALACAGCAGAGEVSDA"
FT   gene            51504..52427
FT                   /locus_tag="Adeh_0041"
FT   CDS_pept        51504..52427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0041"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79819"
FT                   /db_xref="GOA:Q2ILY6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79819.1"
FT                   /translation="MIPIPTLARLTAEARTAGPLRLVVAAAASDSALAAAALARRQRIA
FT                   DAVLVGGRSEIAARLRALGEDPALFELHEAANDEDAARRAVAMVRGGEAAVLMKGRLQT
FT                   AALLEAILDRTDGLRDGRLLSDVLVADHPLSAAPRLLGVTDGGVNVAPDLGQKRAIVEN
FT                   AAALFRALGHDRPRVACLCAVETVTDAMPHTRDAAALAAMNARGELPGCVVGGPFALDN
FT                   ALSADAARAKGIDHPVAGRADLLLVPTIEVGNALGKAFTYLAHRSVAHVIVGARAPVLI
FT                   PSRVERPEDKLCSIALGVLAAARGAP"
FT   gene            52424..53530
FT                   /locus_tag="Adeh_0042"
FT   CDS_pept        52424..53530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0042"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79820"
FT                   /db_xref="GOA:Q2ILY5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79820.1"
FT                   /translation="MSASAGPHGPLVLAVNPGAGSTKLGLFRGGGLVREEKVLHPEAMA
FT                   RPAARIWDELPGRVAAAEDFLARAGVRAGDLAAVAGRGGLLPPLAAGAYLVDDALVAEL
FT                   ERAAHGEHASNLGAPMARALAAPHGCPALVVDPVSVDELAPVARVTGLAGVERTSFAHA
FT                   LNLRAVARRHAASAGRPLEALALVLAHLGTGISLCALAGGRMVDVVNPRDEGPFSGDRA
FT                   GGVPATALVDLCFAPGADARTVKRRLFGDGGLYAHLGTRDVREALARAGRGDARAALLV
FT                   DAMCYQAAKAVAAMAVALDGRVDAIVLTGGLAHLAPVVEGVRRRVAWIAPVEVHPGEDE
FT                   LRALAEGALRVLSGEEPARPYAPLAPDR"
FT   gene            complement(53503..54981)
FT                   /locus_tag="Adeh_0043"
FT   CDS_pept        complement(53503..54981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0043"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79821"
FT                   /db_xref="GOA:Q2ILZ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79821.1"
FT                   /translation="MRTWQTPLALDRADPAPLSVQIARALAARIRAGALRPGAPLPSSR
FT                   ALARTLGVHRNTVLAAYGELAAEGWIASDPARATLVSRDLPPVPRGAAGAPGPAARAGF
FT                   DLPPAPSDATWEALPPGTLELLGGTPDPRLVPVAALGSAYRRALRRREHLAYGDAAGHP
FT                   RLRAALARMLGEARGLAVDADGILVTRGAQMALSLAGRALLSPGDGVAVEALGYRPAWE
FT                   SLRLAGLRTVPVPVDARGLEVERLEALAAAGAIRAVYLTPHHQYPTTVTLAPARRLALL
FT                   DLARRARLLVLEDDYDAEFHYEGRPVPPLASADGAGVVVYVGTLSKVLAPGLRLGWLAG
FT                   PPDAIERLTAHRRFLDRQGDLAVEAAVAELFEEGEAQRHAWRTRRVYAGRREALAAELG
FT                   ARLGGALSFRTPAGGMALWCRVAPGIDPGAWAARALRAGVAVQPGRLFAHDRRARPFLR
FT                   LGFGRLDARELAEAVRRLAGALPRRGQRSGASGA"
FT   gene            55047..56114
FT                   /locus_tag="Adeh_0044"
FT   CDS_pept        55047..56114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0044"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79822"
FT                   /db_xref="GOA:Q2ILZ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79822.1"
FT                   /translation="MRRELFRAGRAEALALLRRAPTVHLATTTPEGAPVLRALDAAVLD
FT                   DGVWFHGARAGEKARCLGRPAVVAAEELVAHLPSWMADPVRACPATTLYRSVQAHGTLE
FT                   ELTDPARKAEVLSALMARWQPEGRYRPIRADDPLYAGELRGILVLGVRLGEALDGKWKL
FT                   LQNRSPEQLGAALEGLWARGAPGDVAAVEAVRAANPAAPEPAFLAAGIPGVRLHVALGE
FT                   GDAPAVEALLAGEYWWEGEPAALAGPSHLASTAWVGARDADGGLVASARAMADPRHAWI
FT                   YDVVVAPAWRGRGLGKRLLALLLDHPALRRTRFVRLVTRDAQGLYACFGFVDAAGQRRF
FT                   GTSTEMVLVRDGRGA"
FT   gene            complement(56166..56780)
FT                   /locus_tag="Adeh_0045"
FT   CDS_pept        complement(56166..56780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0045"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79823"
FT                   /db_xref="GOA:Q2ILZ0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79823.1"
FT                   /translation="MLQALLSRFGYLAVLALLAGAGLGVPIPEEATQLAAGALAHQGYL
FT                   RLPLVIAACWLGIVLGDLAFFLVARRHGDRVLRTRMVARVLTPERRGRLEGHLARHAFL
FT                   SVAVARHTSGLRLAAFALAATHGVRLRTFVLADGLSALVSVPLVVSVGYLFAHHLGTAE
FT                   RGVRRVELAVLGAVLLAVAVAAWVRRRRRVQARGDPSTGPG"
FT   sig_peptide     complement(56706..56780)
FT                   /locus_tag="Adeh_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.848) with cleavage site probability 0.664 at
FT                   residue 25"
FT   gene            complement(56823..58817)
FT                   /locus_tag="Adeh_0046"
FT   CDS_pept        complement(56823..58817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79824"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79824.1"
FT                   /translation="MLAPLALALALASPPAPPSADPGPAPAAAIATAAPGSLSPAANAA
FT                   PDPAYLAELVARARALRLAEDPGWLKLGHWRRRPLGGWKSEADGAKFFRARDGKTDPAA
FT                   ELEATLAGFLDAGPKADELDDAQCRFPARFAFLGGRLGFDLARLPPRRCPRFEDFYGKI
FT                   RPQGVTVVFSSYYLNNPASAFGHTLLRLDKAPEAIGGKHFELLDYGVDYAATVDTGNAV
FT                   LYAAKGLLGFFKGEFKYYPYYYKVREYGDYESRDLWEYDLELTQGEVALLGAHVWELGG
FT                   TWFDYWYLDENCSYHVLGALEAAAPRLDLLSHVGRAVVLPSDTVVALFRNPGLVRRVHY
FT                   RPSIRTQFEARARGLSGAELREVEALAGDPAAPLAAGTPPDGQAKVLDAAVDLLDLRHA
FT                   RELIRGLEPKAAQDRQALLERRAALGVASAPLALPVPEARRPERGHGSLRLGVGGGAAD
FT                   GQGGTVLLDARLALHDLGDPADGYPPTAQIEFLPTRLRWTPRERRVDLDDVALVRIVSL
FT                   SPVTRFDARPSWKASFGATTVRDRGCDRCVAFAGDFGGGLAAALPGGLDLAATGDLELR
FT                   ASPRLSGAGGTGWRPGIGPSALARLRLGSRAVLLADARWRWLPEAAPRTTWSWGGALRL
FT                   HLARDLSLAFEARRQPLATEAAALVLGYF"
FT   sig_peptide     complement(58755..58817)
FT                   /locus_tag="Adeh_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(58893..59390)
FT                   /locus_tag="Adeh_0047"
FT   CDS_pept        complement(58893..59390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79825"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79825.1"
FT                   /translation="MNRITLALVAALLAVPAAAADQTASAIKGTGRYGTAGCGLGSMAF
FT                   GNTPGAVQILAATTNGTFGNQTFGITTGTSNCGSGVFTAGTKNFVDANREALAKDISRG
FT                   EGEAIGALTVINACENSHAVGAALQKNFKAIFPSESASNEDVTKAILDTLHGDAALGCG
FT                   RS"
FT   sig_peptide     complement(59331..59390)
FT                   /locus_tag="Adeh_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            59616..60419
FT                   /locus_tag="Adeh_0048"
FT   CDS_pept        59616..60419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0048"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79826"
FT                   /db_xref="GOA:Q2ILZ6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79826.1"
FT                   /translation="MALKIVVTAKRVEDPESKIRVKPDGSGIVTDGVNYKINPFDEIAV
FT                   EEALRLKERHGGEVVVASIGGERSQTEIRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VVEQEKPDLVILGKQSIDDDQNQAGQYLAERLGWPQGTFASKTESLESEAEQKKEPGLV
FT                   LSADGKALTVVREVDGGVETLELGLPAVVTTDLRLNKPRFASLPGIMKAKKKPLQELAA
FT                   ASLGVDLAPQVVVKRLSEPPARKGGVKVADVEELWKKLHDEAKVL"
FT   gene            60465..61430
FT                   /locus_tag="Adeh_0049"
FT   CDS_pept        60465..61430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0049"
FT                   /product="Electron transfer flavoprotein alpha and beta
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79827"
FT                   /db_xref="GOA:Q2ILZ5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79827.1"
FT                   /translation="MSNVLIVAEQGGGQIRKATLHAISAGRAVAARTGGALHVALLGNG
FT                   VRPLADALAAHGAEVHVADAPALEHPLADAWAPVIAEIAKACGAAYVGAAATAQGKDLL
FT                   PRVAARLGAGMATEVLGFGGEGAAVTFRRPMWAGNVLAEVEIATPVKVFTVRATEFPAA
FT                   AGEGAGKGAVHEVAAAVPAGLRTRHVGFREVKSERPELTEARVVVSGGRGTKGDFKPVE
FT                   ALADALGAAVGASRAAVDAGWVPNDWQVGQTGKVVAPDLYVAAGISGAIQHLAGMKGSK
FT                   VIVAVNKDPDAPVFQVADYGLVADLFQALPALTEKVKASK"
FT   gene            61456..62460
FT                   /locus_tag="Adeh_0050"
FT   CDS_pept        61456..62460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0050"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79828"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79828.1"
FT                   /translation="MTEADLEGLGVHRIAIPVPFPQAGGPVNAYLVEDAGGGLLMFDAG
FT                   LGTPEAQAALEAGFARLGRRFDEVTRIVVSHGHVDHYGAARFVQERHGAPDLPVFGHPA
FT                   DAPKMSEQGPRWRELAPRLAAYLARQGVPPEVVELLAKQGEGGFRYARRLPEVRPIAEG
FT                   EVLRTRHLALEVVHMPGHTPGLLCLYEREKRLFFSDDHLLEKVSPNPLVELGPDGQDGF
FT                   FHPLLAYLDSLRRLRALEVDLVLPGHGPPFSGHREIIDALVGFYAKRQARMLELLRAGP
FT                   RTAHEIARALWPHARPADAFLTLSETVANLEVMESRGEVRRDRAAEPWRYLAA"
FT   gene            62515..63276
FT                   /locus_tag="Adeh_0051"
FT   CDS_pept        62515..63276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0051"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79829"
FT                   /db_xref="GOA:Q2ILZ7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79829.1"
FT                   /translation="MLELLGQADTWISLVTLSAMEIVLGIDNVVFLTILAGRLPQEQQG
FT                   KARKLGLSFALLTRLGLLFAISWVMGLTRPLFEVLGREVSGRDLILLGGGLFLIAKATH
FT                   EIHDKLEVEHAEERKAGGGAAFWAVIVQIALLDIVFSLDSVITAVGMAKHLPVMVAAMI
FT                   LAVGVMLVFADAIGGFVERHPTIKMLALSFLILIGVMLVAEGLGKHIEKGYVYFAMAFS
FT                   LGVELLNMRVRKARQAPVHLHGRFEEERAGR"
FT   gene            63293..64207
FT                   /locus_tag="Adeh_0052"
FT   CDS_pept        63293..64207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0052"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79830"
FT                   /db_xref="GOA:Q2IM00"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79830.1"
FT                   /translation="MADLALLVLTLLWGTTFALVKEALEIASPGVFLTARFGLAAVALL
FT                   AAWALRPRAPLGDGFWRHGILLGLTMLVGFVLQTVALRHTTPARSGFITGLNVLVVPVV
FT                   ARWFLGRRVRPAFWVGVAFALAGLVMLTRPFTPGAVTEEVRFGDLLTLFCAVAYGLQVT
FT                   FTSEWAPRHPLAPFVAVQVLVTLAGALVLAPLEGPRFDPAGAGHFALVVAFTGLVMTAL
FT                   AFFVMNWGQRHTTAVRAALIFSLEPAAAAVFSWLYYGEPLGPLDWAGGALMVLGVVAGE
FT                   VGGVLEARAPRRARGERASTGPG"
FT   sig_peptide     63293..63355
FT                   /locus_tag="Adeh_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.762 at
FT                   residue 21"
FT   gene            64275..65474
FT                   /locus_tag="Adeh_0053"
FT   CDS_pept        64275..65474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0053"
FT                   /product="Membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79831"
FT                   /db_xref="GOA:Q2ILZ9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79831.1"
FT                   /translation="MRRTLLPHAPVAALALVLASALTACRHAPPPAPARTADEALREVP
FT                   PSELPAFADDLDYAGLEDAIGRSETWLARLAASDPGRTFAYGRERVPLERVRATLARFR
FT                   AIVAARPPPAALRETLRREFRAFRSTGDGRGTVLFTGYYLPELRGALARGGPYQVPLHR
FT                   APDDLVVVRARDFPQVAEDVIGRVEQGRLVPYPTRADIARGALDGKGAELCFVDSALDA
FT                   FFLEIQGSGVVRLPDGTARVVTYAGKNGQRYAAVGAELVRRGALRREEVSMQSIRAWLL
FT                   AHPEEQAAVLATNPSYVFFRFADDAIGALGVPVTPDRTIAADAKVFPKGGLAFLETERP
FT                   VDASSAVMRPFSRFVLDQDAGGAIRTSGRVDLYLGSGPYAANAAGRMKQPGRLWYLLLR
FT                   "
FT   sig_peptide     64275..64385
FT                   /locus_tag="Adeh_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.397 at
FT                   residue 37"
FT   gene            complement(65530..66828)
FT                   /locus_tag="Adeh_0054"
FT   CDS_pept        complement(65530..66828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0054"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79832"
FT                   /db_xref="GOA:Q2ILZ8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79832.1"
FT                   /translation="MKRTVDVGERLPLLQSIPLSLQHLFAMFGATVLVPFLVGLDTSVT
FT                   LFTSGVGTLVYIFITKGKIPAYLGSSFAFIAALSAILGVAPGQAAPAERVAVAMGGCVA
FT                   VGVCYLVVAALIGKFGTGWIDRLLPPVVIGSVVMVIGLGLARVAVVNMAMNGGGPTYRP
FT                   EFFAVALASLAIAILAAVFLKGFLGVIPVLIGIVGGYVVALLAGQVDLSGVAAARPLAV
FT                   PPFVLPKFTWAAIITLAPISLVVITEHIGHLIVTNNVVGRDFVKDPGLHRSLAGDGVAT
FT                   VISGALGGPPNTTYGENIGVMAITRVFSVWVIGGAAVLAVLMSFLPPVGALIRSIPTQV
FT                   MGGICILLFGIIASAGIRMLVEAGIDFSQKRNLIIASVVLVIGVGGAEMHFGSVKIDAM
FT                   PLATYVGILLNLVLPRGMEGTAANGAVSEAPDV"
FT   gene            67288..68280
FT                   /locus_tag="Adeh_0055"
FT   CDS_pept        67288..68280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0055"
FT                   /product="putative mRNA 3'-end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79833"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79833.1"
FT                   /translation="MRRPPIELHRGELRITGSSLHLDATRRVECAFVSHAHGDHIGRHD
FT                   RTIATAPTLALMRHRLGEGKRRRTEHLPASYRAPFGLGELTLELFPAGHVLGSAQVRVT
FT                   RNGVSLGYSGDLCTEPTHAAERAEVMGCDVLVIESTFGHPRYVFPPKDETLAAVRRFVD
FT                   DALADGVTPVLLGYALGKAQEILKYLSDLGYACRAHPVVQAVNKVYEAHGVALPNVRPL
FT                   GPEGAGIDEVVVCPPHLARSPAMRGLRRRRTAILTGWAIDGGRFFRGVDAAFPLSDHAD
FT                   FPSLVRYARATGAGRVFTVHGHEDALAAALRKEGIRAEPLREHMQLELI"
FT   gene            68315..69334
FT                   /locus_tag="Adeh_0056"
FT   CDS_pept        68315..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0056"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79834"
FT                   /db_xref="GOA:Q2IM03"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79834.1"
FT                   /translation="MIQLTVSADAAGQRLDKLVRKALRDVPLSHVYKMFRTRKVRVNGA
FT                   RGKADQVVAEGDVVVIRGDEERLLAKAAPAAPGGAPRVTFGVLHEDADLLAVDKPAGLA
FT                   AHPGTGIEGATLVEMARGYLKTPDDLPPTEFKPSPAHRLDRDTSGVVLVAKHRKAMVRL
FT                   GETFTTGEGVHKTYLALVKGKMPREAGTIDLPLSEHEQTSKSKAMRGVNFQEALTRWKV
FT                   VSAAKEISLLAVTIETGRTHQIRRHLEAVGHPVAGDRRYGDFAFNRTARTRWGLRRMGL
FT                   HAWRLEVPHPLTGAPLRLEAPFPAELAEVLSRANLKLPASPTGAHAPGARREGPHRER"
FT   gene            69371..71929
FT                   /locus_tag="Adeh_0057"
FT   CDS_pept        69371..71929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0057"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79835"
FT                   /db_xref="GOA:Q2IM02"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79835.1"
FT                   /translation="MSEPGEPHKPPEEPSSRVVLDGLPPERPLRRRLLRWGLFAGIAAV
FT                   NAAVVAAVVGWFVFSRGLPDVPTLEQYRPPIITEMISADGQIAGEFFVERRKVVPYARI
FT                   PKRVIQAFIASEDKNFFEHGGIDLLGTLRAAVKTYVLRSRIQGASTLTQQTAKALLISA
FT                   EGFERGTERSLRRKIRELILARRLEARFTKEQILWIYLNGVYLGHHSYGVQSAAENYYR
FT                   KNVEDLTLEEAALIAGLPQAPSRYSPFSRPEAAAERRRYVLRRMAEEGMITEAERRSAE
FT                   KAEVKVFGVDDVFRETAPFYVETVRRQVVDRYGNERLLHDGLRVEMAMDLEKQRAAQAA
FT                   VLKGLVEVDQRQGYTGPVAKVAGAERTALAARLAKAWPKGTLRPGDHCVGIVDRVDDKA
FT                   GVVEVEVGETRGVLPISGMRWARRPNPVVSYADALLSRPSSALHAGDVVVLKRVERAEL
FT                   QKKEAQLGVGRPKDVPEAPVLFSLQQDPTLQGALVAVDPGTAYVTAMVGGYDFEASEFN
FT                   RAFQACRQPGSAFKPVVYSAAVEKLDYTPATILTDAPIVFRDDESSWKPQNYGEDFKGD
FT                   VTLRTALVNSMNIPAVKTAEALNAKLGPAGLGDWAKTLGITTPVKQELGSALGSSCVTP
FT                   WELTNVYALFARYGEKRPSTFVKRVLDRDGRVLEDHADYRDPWVGLDERLAGAVAEVTR
FT                   PREQVMDPRSAYILVRLMREVATVGTGARAAALGKPAAGKTGTTNDSFDTWFMGFTRDL
FT                   ATGVWLGYDVNVTPLGRYETGGHAALPIWLDFMSAALKGRAQPEFEAPSGIVEVRIDPA
FT                   SGKAVADGAGGVPEPFKQGTEPVLADAEKKQVEVQDLFMQ"
FT   gene            72094..74160
FT                   /locus_tag="Adeh_0058"
FT   CDS_pept        72094..74160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0058"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79836"
FT                   /db_xref="GOA:Q2IM01"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79836.1"
FT                   /translation="MRPKLAHLGVKRILFLSIAGALAIAGVLTSIAVNREIHVALERAA
FT                   AHRGEADARVYASALAPALAAGDPARIAARVDEDWDEESFAYVVVVREDWSIAARHLSR
FT                   NLGRSAEEVVAWHQAAGGAAQPQAPGVLAFTRPVEGAAGGARAGYVLLGLDRDPLDAQA
FT                   GRAGWYIFALLVGGGMVLAGLVYVFVSRLVLRPLDEMSAVARRVSDCDLTARSAQLGPD
FT                   ELGTLAESLNRIGENLAATLSRVQNVTGGVATVIDRISRTGSAVSSGAGTVSARVVDTS
FT                   SSMSQMISSLKGIADNVEVLAQSAEESSSSILEMAATNDEVAENIQALAASVEETTAAI
FT                   EQMTYSIKEVAKNIEDLSATTEETSSSMNEMDVSISQVESNANETARLSEQAQRDAESG
FT                   AEALSRTLLGIDKIKESSKEAASVIEALGAKIAAIGNILNVIDDVAEQTNLLALNAAIL
FT                   AAQSGEHGKGFAVVADEIKDLAERTGASTKEISELIRAVQDQSRNAIQAMDRGVRNVEE
FT                   GVRLGQETETALKKIQQSSQKSTQMVKAIARATLEQARGSKQVTMAINRIAETVQQIAS
FT                   ATAEQARGSEQIMKSAEKMKAITKHVERSAQEQARGSKQITRAIESISEMVHHLNRAQK
FT                   EQTKGSEQVMTAVVQIKQVAEAQTHSVRDLEAAIVDLASQAEVLRGEVRRFRI"
FT   sig_peptide     72094..72192
FT                   /locus_tag="Adeh_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.761 at
FT                   residue 33"
FT   gene            complement(74302..74766)
FT                   /locus_tag="Adeh_0059"
FT   CDS_pept        complement(74302..74766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0059"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79837"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79837.1"
FT                   /translation="MPRLTSPRMAYWLLKTEPGTYAWSDLVADGTTPWTGVANPQAQAN
FT                   LRAMKAGDRAIVYHSGEKRAVGIAEVVRTAYPDPTAGGELVCVDVKAVEPLPAPVPLEA
FT                   LKLEPAFEGSVLLRQGRLSVVPLAPAEWRDLAALADVIARTGGLRRKARF"
FT   gene            74838..75278
FT                   /locus_tag="Adeh_0060"
FT   CDS_pept        74838..75278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0060"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79838"
FT                   /db_xref="GOA:Q2IM07"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79838.1"
FT                   /translation="MFGLSFGEIVIIAVLALILLGPDRLPEAAKTIGKGLRQFKQATDD
FT                   LKDQIETEIYKDDRKVARPSLVPPVPNRPVPGPAGPPPAATAENVPGLEAALVDAEPAA
FT                   SAVEPAAAAAQPAAVATAPAPSPSPEPSGEGAPPPGTGGTAA"
FT   gene            75285..76097
FT                   /locus_tag="Adeh_0061"
FT   CDS_pept        75285..76097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0061"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79839"
FT                   /db_xref="GOA:Q2IM06"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79839.1"
FT                   /translation="MSETVPQLPPPPPPSPSPEPEGEVKLSFLDHLRDLRVRMVRAMLG
FT                   IAIGMGLVGGFVPQIVDHLMKPVRDALPAGRQQLVYTSAIEPMMVYIKVAMYGGVFVAA
FT                   PWVLWQLWLFIAPGLYKREKKVVFPFLFWGTLLFYLGAVFCFELVMPQAFPAMLAFAES
FT                   DTLSPMLSLSEQLSLVLAMLLGFGVVFEVPVVIAFLSMIGLVQWRTLAKYRRIAIIVNV
FT                   IAAAIITPTGDPLNLALMAVPMIVFYEVGIVLARILGKKPAPDAAPAA"
FT   gene            76392..77588
FT                   /locus_tag="Adeh_0062"
FT   CDS_pept        76392..77588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0062"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79840"
FT                   /db_xref="GOA:Q2IM05"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79840.1"
FT                   /translation="MNRAGQQDVVFLAAKRTPFGTFGGALKDLSATDLAVHAAKAAMAQ
FT                   AGAPPADYGHVVVGNVAQTSPDAIYLARHVGLRAGLPEGVPALTVNRLCGSGFEAVIEA
FT                   ARLVHTGEAELVLAGGTESMSQAPLVLRGTRFGHAFGKTPQLEDMLWSALTDTYAGMPM
FT                   ALTAEKLAETHRIGQDAVDELAVASQRRWAAADEAGRFREELAPVELPSRKGTVRFEKD
FT                   EHPRPGTTLEGLRKLPKVFKADGVIHAGAASGIADGAGMLVVASRAYAERRGLRPLGRL
FT                   VNWGHAGVDPTVMGIGPVPAVRNALARAGATLSDLDLFEVNEAFAPQYLAVEQELGLPR
FT                   DRTNVDGGAIALGHPLAASGARITMHLLYELRRRGARAGIGSACIGGGQGVAVILEPL"
FT   gene            77662..77859
FT                   /locus_tag="Adeh_0063"
FT   CDS_pept        77662..77859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79841.1"
FT                   /translation="MTSFTGVKVFSTTLARDRDAMGETITRWLAGNPELEVVSHEVRQS
FT                   SDKEFHCLTITLFYRERKKG"
FT   gene            77866..78606
FT                   /locus_tag="Adeh_0064"
FT   CDS_pept        77866..78606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0064"
FT                   /product="Rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79842"
FT                   /db_xref="GOA:Q2IM13"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79842.1"
FT                   /translation="MRSRRSPDLGSAFTFGGRIPSGLGLLLVLILVATVGSWVTRDDAW
FT                   AALVPGLVLRGQVWRLVSWAFVQSDPLTLLFGGFMLYSIGQQLAFTWSERRLVGTFLGL
FT                   AAGATAVTVIAALLWFPADRPHLGLWPVVNALLLMWAMLYPDRQVSIWGVLPLTGKTLA
FT                   LLVVFGTVLYGLAGGGLPGLGAFVPHFAALALGFALSRGGRMPTRRWKLQAREWWAERE
FT                   FRRRSKHLKVIGKDGKGEPPRWMN"
FT   gene            complement(78632..81706)
FT                   /locus_tag="Adeh_0065"
FT   CDS_pept        complement(78632..81706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79843"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79843.1"
FT                   /translation="MPDPRSALKEFRQLDRKRLSEGLTAEEERRHAELRDLVEPELQAG
FT                   PGSGFDVGAAAERLRASLEPAGLRRAPAEAPPEPPAAEAGPEPLFEDVAPDAGLADAFE
FT                   GQPFEALEVDAPEAPAWDAAEQPAAPAAAEGWDPNAQPYDPNAAQAWDPNAQPYDPNAP
FT                   QAWDPNAQPYDPNAAQAWDPNAQPYDPNAAQAWDPNAQPYDPNAPQAWDPNAQPYDPNA
FT                   PQAWDPNAQPYDPNAAQAWDPNAQPYDPNAPQAWDPNAQPYDPSAAQAWDPNAQPYDPS
FT                   AAQAWDPNAQPYDPNAPQAWDPNAPAYDADAAQPAWNPDATATFGAPEPPPPVESPRSD
FT                   AAPADEAWTTPADEPETVDLATEAMIEELEPLSADAMALEGDPSAELPAPLAGGDAAAL
FT                   PPDGWEVTAPPPPAPEGAVLGEYDEAGAAPVALSPEGLGAEPAPEPLPPGAPPELGEYD
FT                   DTSGFAAPPEEGALELATAGAEPAAEAGWAEEVALDQGFELESGGSFDAAAEATVPEWA
FT                   REAELPPWDAPPADAGDAGGLDLAGELPVEPAPEPLAVPEEMGAAGEDGEPLALEPTLD
FT                   LGAPVDPTLELAELAEPAAGAGIAAGEDPFALREPDPEPAGGRDLSALDFAAGELGEDA
FT                   DAWAAAEAPTEAPAPFTLGDVGPQAEPLAGPEPEAELPAWDAGAAPALELEPSRWGAGM
FT                   ADVERDVADAPIEAADPSALLAEAAEALPPLELDGPAAPAPDAVAEAAPDAAASLAGAL
FT                   LDAGAEPPPAIDDLLGAEVSSQDASVEPAELADLADLAELAAVPPPDADDLPTLDGEDI
FT                   LEEIPADELVPLPPDEVAGDVEPGAPPLAEAAVAAPVPEPAPGPEDAGVPAPAPAAAAS
FT                   IPAPDLEPLPVEEVSFTPPPVVEAAPPPPGGWEVPGAHRVVIHTLEGLVRRGVIEDAAL
FT                   DAPALDLVAQGPLPERIPTDKVKAIFFMLAPGEAAPAAEGKRVRVTFRDGRQVAGFSPD
FT                   YREDGPGFFMVPADTRTSTARIWIYRSAVRQVAVS"
FT   gene            81834..83780
FT                   /locus_tag="Adeh_0066"
FT   CDS_pept        81834..83780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0066"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79844"
FT                   /db_xref="GOA:Q2IM11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79844.1"
FT                   /translation="MARLPVLQGDRARRSAPPGPEAFLPMSPEHLRARGWDGLDVLLVS
FT                   GDAYVDHPSFGAAVIGRVLEAAGYKVGVVAQPDWRSTAELLRLGRPRLFVGITSGAMDS
FT                   MVNHYTAHKRRRSDDAYTPAGAAGRRPDRATTVYARLAREAFGPTTPIVLGGIEASLRR
FT                   IAHYDYWDDRILPSVLVPSGADLLVYGQGEKPILEIARRLASGEDICGLTDVPGTALAV
FT                   PDLAMAMLEGRDREVLELPPYEEIVLDKRRFAEFSRLYHLEHNEANARILVQRHGRGPA
FT                   LRHVVVNPPMRPPSTEELDRIAELPYVREAHPAYGGAHIPALEQIRWSVQILRGCAAGC
FT                   AFCCITEHQGRDIASRSEASVLREIATLASKESFRGTVTDVGGATANMWRMECTSEEAH
FT                   AACRRASCVYPSVCQFFSVDHGPLVDLYEKARKVPGVKHVFVGSGVRYDLAQADEKNGA
FT                   RYLEALVANHVSGQLKVAPEHVCEPVLKVMKKPGVESFERFRKDFERYTRKAGKEQYLV
FT                   PYFISSHPGASLEEAADLMEYLQANRWKPQQVQDFMPTPMTLASDIFWSGYHPMTGKPV
FT                   HVTRDMEEKRMQKALLRWGDPANRPLVEKALRKIGRLKPGERLGPGMRPARRGGGRSRP
FT                   GARGGPGPGRGPR"
FT   gene            83841..84452
FT                   /locus_tag="Adeh_0067"
FT   CDS_pept        83841..84452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79845"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79845.1"
FT                   /translation="MPQTRPILAAALLSLGIAQAARAADPAPAPAKPAATPAPAAKPSP
FT                   TAMDLARTLATQETWKRGMDGLTQSVVGQFRGHPGSELSMPKDFQAKARTEIEALLPYE
FT                   ELVNIHARQLSAAYGEAEMKDLLAFYKSPLGQKTLKAMPEVQEKVAVETQQRIEPKLPQ
FT                   VMQKLAKDVKPPAGGAKAPSNPHGAAPAKAAPAKPAQPKK"
FT   sig_peptide     83841..83912
FT                   /locus_tag="Adeh_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            84535..85278
FT                   /locus_tag="Adeh_0068"
FT   CDS_pept        84535..85278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0068"
FT                   /product="Lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79846"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79846.1"
FT                   /translation="MTPPPPLRAGRLVRPAVALAVFLAAGAAPRAAPAPLVYVALGDST
FT                   AAGQGGGPGGGYPPRLARRLEGAGLAVKLVNLGVPGATAADLRRDQLPRALEAGPGLVT
FT                   VGIGINDLVQGRPLRDFARDLEVVADFLRHTRAVVVISSLPDLGDSPSAEGAPAALLRR
FT                   LDQYNAAIARVAERHGFLVADAFGETRRTVKRLGPAAVFAGDGFHPSAAGYDAWAEALW
FT                   GPVERALGARLQGRRPPAPAAAGRP"
FT   sig_peptide     84535..84630
FT                   /locus_tag="Adeh_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.943 at
FT                   residue 32"
FT   gene            85312..86685
FT                   /locus_tag="Adeh_0069"
FT   CDS_pept        85312..86685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0069"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79847"
FT                   /db_xref="GOA:Q2IM15"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79847.1"
FT                   /translation="MEDRERQERHRRLWEADHRHLWHPFTQMKDWLREEPLIVDAAEGV
FT                   YLVDTLGNRYLDGVSSLWCNVHGHRVPELDAAVRAQLDRVAHSTLLGLASTASIECAEE
FT                   LVRHLPPGLTRVFFSDAGATAVEIAIKMAFQHHQLRGDERRTEFVALHGGYHGDTIGSV
FT                   SVGGIDLFHRIFKPLLFEVHHAPQPYCYRCPLGKALPGCGMACADEVERIVEAREGRVA
FT                   ALVIEPLVQGADGMITQPPGYLRRMREVCDRHGALLVCDEVATGWGRTGTTFAVEQEGV
FT                   RPDILTMAKGLTGGYLPLAATVTTEQVFESFLGEHAEKRTFFHGHTYAGNPLACAAATA
FT                   SMTLFRERGVGAAVPGKAAALARALAPAARLAHVGEVRQRGLMVGIELVRDRATREEYA
FT                   YELRAGDRVTREARKLGAILRPLGNVVVLMPPLAMTEAELTRLAGITLAAIEAATARL"
FT   gene            86685..87356
FT                   /locus_tag="Adeh_0070"
FT   CDS_pept        86685..87356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0070"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79848"
FT                   /db_xref="GOA:Q2IM14"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79848.1"
FT                   /translation="MRGLFVTGTDTGVGKTEVACALVRAARAAGLDAVGMKPAQSGHVA
FT                   GEPSDAERLREASGGVEPLEAICPYTFAAPLAPAAAARAEGREVSLARVVEAARALAAR
FT                   HAAVVVEGAGGLLVPLTARETHADLAAALGLPVLVVARAGLGTVNHTALTVEALERRGL
FT                   PIAGIVLNRTGPEDDPSVPLNAAEIARLTHREPLALLPWEPDIARRARALGSVLAAKIQ
FT                   F"
FT   gene            87409..87681
FT                   /locus_tag="Adeh_0071"
FT   CDS_pept        87409..87681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79849"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79849.1"
FT                   /translation="MPNVVDLTLVSRARRALHAVLEERGLGFFLAAGSRTPRLDPRRIA
FT                   WVVEVARRQVSLRARRDPDALSRTRRVLRRELIRRLTEAMLQAGL"
FT   gene            complement(87888..88160)
FT                   /locus_tag="Adeh_0072"
FT   CDS_pept        complement(87888..88160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79850"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79850.1"
FT                   /translation="MADEKQPAPIDFYTFVLSLGSSAFVHLGDAPHPETGEIAQANLLL
FT                   AKQTIDILSMLAEKTKGNLTDEEARFLENLLTDLRLRYVGKSSGR"
FT   gene            complement(88180..89604)
FT                   /locus_tag="Adeh_0073"
FT   CDS_pept        complement(88180..89604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0073"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79851"
FT                   /db_xref="GOA:Q2IM19"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79851.1"
FT                   /translation="MVRSRRSSSRSAVRGAGRALALAAALAAGVAAPAAARPPAALPRA
FT                   DERASANRRTPVVIAVEKVRGAVVNVSAEELVRIRVPSQPRGGTMGDLLFGDLFERPRY
FT                   RKGYATTSLGSGVIVSPDGYVLTNNHVVERGARFRVGLLDGRELMAKVVGTDPSSDLAV
FT                   LKLDTREKLPYVTTGRSDDLLIGETVIAIGNPFGLAHTVTTGVVSAVHRNFKAGERTMF
FT                   DFIQTDASINPGNSGGPLLDIDGRLVGVNTAILGDRSAGIGFAIPIDRARRIAEDLIAH
FT                   GEVREGYLGISVDDLPRKDGSVDGGSGGVRVTGVDPGSPGERAGVRSGDRVEAVDGTPP
FT                   GSAAELLFRLRDLPIGRAARLDLSRRGARVQATVTAVELTPQRAAELVQQRVGLRVSEE
FT                   RVSGGTLVVVRSVAGRSPAAQAGLQPGDLVREVNSAEVSSVAGFQRAAARARRGGRLVL
FT                   LVQRGYAAERIAFDFD"
FT   sig_peptide     complement(89494..89604)
FT                   /locus_tag="Adeh_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 37"
FT   gene            complement(89573..89812)
FT                   /locus_tag="Adeh_0074"
FT   CDS_pept        complement(89573..89812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79852.1"
FT                   /translation="MADPFENKLVDKRVVQRYLRKGKVDEKEYEKLQKALPDLADQAMP
FT                   IEASMSGVEEPDDLDDDEPEEDVGGGEVPPQQQP"
FT   gene            89895..90563
FT                   /locus_tag="Adeh_0075"
FT   CDS_pept        89895..90563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0075"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79853"
FT                   /db_xref="GOA:Q2IM25"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79853.1"
FT                   /translation="MPVSEASVSAGRRARLGGLYVIVGGADPVAQARAAIGGGARAIQV
FT                   RMKDAPAGAVLEATRRILALATGRALVLVNDRADLALLAGADGVHLGDDDLPVPEARRL
FT                   LGPDLLVGRTTRTLEEARAALAEGADHVGYGPIFASRSKALPVPPRGLAALAEVARALP
FT                   APVVAIGGIGLDDVAAVARAGAACAAVIEAVLGAADPEAAAARMQAAFEAGRAARGATP
FT                   "
FT   gene            90560..91270
FT                   /locus_tag="Adeh_0076"
FT   CDS_pept        90560..91270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0076"
FT                   /product="peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79854"
FT                   /db_xref="GOA:Q2IM24"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79854.1"
FT                   /translation="MSPRPRIGITLDADATGRRYELPRGYVEAVLDAGGLPILLPHAVD
FT                   VAGAYLSLLDGLVVSGGDFDLPPELYGEARRPGCGPSRPERTRFEKDLLEAALAARLPV
FT                   LGVCGGMQLLDVVRGGTLWQDLPGEAGLRGHEQPAPKDVPSHEVTIAPGTQLAALAGAG
FT                   PLMVNSTHHQAVREPGPGVLVSARAPDGVVEAIELPDLPFALGVQWHPEATRDDPRHAA
FT                   IYRGLVDAARSLRR"
FT   gene            91267..92010
FT                   /locus_tag="Adeh_0077"
FT   CDS_pept        91267..92010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0077"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79855"
FT                   /db_xref="GOA:Q2IM23"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79855.1"
FT                   /translation="MIPRVLVVAGLDPSGGAGLTADLEALAAVGARGWAVATALTAQGP
FT                   RGARGVSPTAEAFLRAQIDALLEGRERPRAVKTGMLGTAGLARALAARLGEPPLARVPV
FT                   VVDPVLVASSGAPLLDAGGAAPGEALAALLARARLVTPNLPELAALTGVEVADDAAAVR
FT                   AARMLPARAVLVKGGHRAGAPVDLLVEGRRVTRFTGRRRAGTARGTGCRLASAIAGLLA
FT                   GGASLEEAVRGGKRVVGRYLDLAAR"
FT   gene            92462..93172
FT                   /locus_tag="Adeh_0078"
FT   CDS_pept        92462..93172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79856"
FT                   /db_xref="GOA:Q2IM22"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79856.1"
FT                   /translation="MMRGARQLRFRLSPPRSHGGRRPGAGRKPSGARAGVSHHGRPSVT
FT                   ASSPVHVTLRVLPHVWNLRSQRALRVVEAAFEAATAARSTFRVVHFALEGNHLHLIAEA
FT                   DGSRALSSGMQGLCIRLAKGLNRMMGRRGKVFADRYHARVLGTPTEVRTALAYVLLNHR
FT                   SHLARMGKPLGRGGVDRFSSGGWFDGWRGGGAGAAVREAARSITAAPRSWLLSTGWRRR
FT                   GLLSCDEVPRALGG"
FT   gene            complement(93195..94616)
FT                   /locus_tag="Adeh_0079"
FT   CDS_pept        complement(93195..94616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0079"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79857"
FT                   /db_xref="GOA:Q2IM21"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79857.1"
FT                   /translation="MAESDPARRVAEAGVSPLRSARDLPHSLEAEQAVLGAILVEETAF
FT                   DQVAALLRAGDFYLLAHQHVYGACEELARESKTLDPILVQQRLDAKGLLGSAVPQELPL
FT                   TLARAIGTASNVGHYARTVQDLARLRVMMLTAQRLVERGYEAGANVQHFLDAAQQEVFG
FT                   AAQGSNVDTLKKISEPVLRALENLEAVQKRVQAGLSPITGVPTGIQTLDRNTLGLQPGT
FT                   LTVLAARPSVGKTAFALNIATHAATKAQRKVAFFSLEMPSDQLALRMLASEGKLDWRKL
FT                   SQGQLSRHDWDKLATQADRIGAANLWLDDNFVLTPVELRSKCRKLKRENGGLDLVMIDY
FT                   LQLMHAPSDRSNQSREQEIATISRSLKSLAKELECPIVALSQLNRSVEKRKGEPPMLSD
FT                   LRESGAIEQDADIVMFLHRAEEDNKDVQQGTAAGDTLPVQLIVAKQRQGPTCTIDLVFF
FT                   KTTTYFAEMDRRPQQ"
FT   gene            94780..95667
FT                   /locus_tag="Adeh_0080"
FT   CDS_pept        94780..95667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79858"
FT                   /db_xref="GOA:Q2IM26"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79858.1"
FT                   /translation="MGVASGAPPSRGRGTTTPMRSLRLLALTSIVALSGCAALNQLAAS
FT                   AFEKPKLTFRSATLQSLDLEGATLGFQFDLENPNGFGLTLARLGYGVEVEGTRIAAGDM
FT                   PGGLKIPAAGKAPVTFPVRVRFKDVPGIVSLLGRQQDSIRYKLGGTVGVSTPVGVVDLP
FT                   ISHEDSLKLPRLPGFTLEGLSVRSVSLSDLALDVKLRVKNPNAFAIPSGTLDSAVSLAG
FT                   SQVGRIDGRALAAVPAQGSTVLTIPLKVDLVRAGRAASELMRGAPVDVGMRGTADLGGL
FT                   PVPLDVGGRVPVAR"
FT   sig_peptide     94780..94911
FT                   /locus_tag="Adeh_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.553 at
FT                   residue 44"
FT   gene            95756..98960
FT                   /pseudo
FT                   /locus_tag="Adeh_0081"
FT   gene            complement(99116..99790)
FT                   /locus_tag="Adeh_0082"
FT   CDS_pept        complement(99116..99790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0082"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79859"
FT                   /db_xref="GOA:Q2IM29"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79859.1"
FT                   /translation="MIAAAWIAVTAALYAAARALHRRFPRPWLTPLLVVPGALAAVLLA
FT                   ARVPYPGYMRGGRLLVDLLGPATVAFALPLHRHAGLLRRHAAELCAGILAGCAVAVGSS
FT                   FLLARALGLGRPLALSLAPRSITTPFAMQVAGDLGGVPALAAVFVILTAVVGLVVGQLL
FT                   LRWLPLRSAVARGALFGMGAHAAGTAQAMELGRVEGAVAGVVMIVAGLGVLVATPLLRL
FT                   AL"
FT   gene            complement(99787..100197)
FT                   /locus_tag="Adeh_0083"
FT   CDS_pept        complement(99787..100197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0083"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79860"
FT                   /db_xref="GOA:Q2IM28"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79860.1"
FT                   /translation="MPPAVPHASPPPATARSLLALPLQLLALGGFWGAGALAARALRLP
FT                   LPGGVVGMLLLLGALRLGLVRAGWLERGADWLFRHMLLFFIPAAVGAIQYPELLGGEGA
FT                   RALAVVAVSTVLVMAVTGATVEWLARRREEAP"
FT   gene            100280..101215
FT                   /locus_tag="Adeh_0084"
FT   CDS_pept        100280..101215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0084"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79861"
FT                   /db_xref="GOA:Q2IM27"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79861.1"
FT                   /translation="MDLRGLGAFVEVVRQGGFTRAAAALHVTQPAVSKAVRALEDEIGV
FT                   PLLERGARRTVPTEAGRAVLARAEGVLAAVRAIEDEVADLGALRRGRARVGLPPMVSGA
FT                   FFPPVLAAYRQRYPGIRLELREEGAREVEALVASGALDVGVTVLPTDEARFEALPFVHD
FT                   VLAAVLHPRSPLARRPRLALADLAATPFLLYRPDFALRGRILDACRAAGFSPQVASETG
FT                   QWDFMAAMAAADVGVALLPRTICRRLDPAQVAVVPLAEPAIGWNLGLVWRREGTLSAAA
FT                   RAFVETAREVLLPGRRPAYPAARSRPRTRK"
FT   gene            complement(101176..104628)
FT                   /locus_tag="Adeh_0085"
FT   CDS_pept        complement(101176..104628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0085"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79862"
FT                   /db_xref="GOA:Q2IM33"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79862.1"
FT                   /translation="MTFREALERRPLVFDGAMGTQIQRHQLTAAEFGGKEGANDLLTLT
FT                   RPDLIEEIHARYFAVGCDVVETNTFGSSRLKLDEYGLGHRTYEVNCRAAILARRAAERF
FT                   STPDHPRFVAGSIGPTGMLPSSSDPALGNITSDALERIFFEQAKGLVEGGVDALIIETQ
FT                   QDMLELRAAVLACDAVRREALRDVFVIAQPTLIDANGRMLLGTDVGSAVATLERLPVDA
FT                   VGLNCSTGPDEMRASVKALAERCSHWVSVLPNAGMPENEDGRAVYKLSPDDLARALAGF
FT                   VAEYGVDIVGGCCGTTPEHLRKVVEALRGLSAPRRRRPAPAAELSSAMKAVPLAMEPRP
FT                   LVVGERLNSQGSRKVKELLLADDYAGLVQIARGQVEAGAHVLDVCVALNERDDEAAQMR
FT                   TLAKLLAQSVDAPLMIDSTEPDVIEGALKVYPGRCIVNSVNLEKSGERVRRVLPLVRRY
FT                   GAAVVAMTIDEKGMAQTAERKAEVARRIVAVAKDHGIPPDSLVFDALTFTLATGGEEYR
FT                   RSAVETLEGIRRIKAENPGVLTTLGVSNVSFGLAKSAREVVNSVFLYHAVQAGLDLAIV
FT                   NPKDILPYPAIDAAERALAEDLVFDRRPDALARLIAHFGAKGAPEKAAVDPLAGAAGKG
FT                   AEERIHLQILHRRPEGIEALIDEALTRRSAVDVLNQVLLPAMKDVGDRFGAGELILPFV
FT                   LQSAEVMKKAVAHLEQFLEKKAGATKGNVVLATVYGDVHDIGKNLVKTILSNNGFTVHD
FT                   LGKQVPVTTVLDKALQVNADAIGLSALLVSTSKQMPFCVEELHRRNLSFPVIIGGAAIN
FT                   RRFGYRTHFAQDGTPYAGGVFYAKDAFEGLEVVEALVDPARREALKREVLQKAVAEKER
FT                   PADKPMAPAPARRTGAVAPAARIPTPPFWGPRVVPSGSVALADVWPHLDLAELFKLQWG
FT                   VKAKGAEYERLVREEFGPKLEELKAEAQAQGWLVPKVVYGYFPCHAEGNDLVVLDPTHR
FT                   KAEVARLALPRQPDDRNLCLADYFREERGADVCALQVVTVGDQATHLAEQAQERGDYTR
FT                   ALFLHGLAVETAEALAEYWHRQVRAELGLADGQGKRYSPGYPSWPELSDQRQVWKLLDP
FT                   VRTIGVSLTDACQMVPEQSTSAIVLHHPDAIYFLVRGLERAAG"
FT   gene            104804..105874
FT                   /locus_tag="Adeh_0086"
FT   CDS_pept        104804..105874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0086"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79863"
FT                   /db_xref="GOA:Q2IM32"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79863.1"
FT                   /translation="MIHEARYWEPAAGGKVRCTLCPRDCRIGEGQAGFCFVRRNERGRL
FT                   VTSAWGRSTGFAVDPIEKKPLAHFHPGARVLSFGTAGCNLGCRFCQNWDISKARLDELR
FT                   SEVDWTPDRVVALAREAGCPGIAFTYNDPIIWAEYAIDVADAAHAAGLFTVLVTNGYVS
FT                   PEARRDLFSRADAANVDLKAFTEEFYRRQTFAHLAPVLETLEWLARETSVWTEVTTLLI
FT                   PGLNDGDAELHELAGWIRDHMGREVPLHFSAFHPAYKLIDRPRTPPATLTRAREIARAE
FT                   GLRHVYTGNVHDPEGDTTYCPGCGAKVIERDWFAVTAVRMRGGACAACGTRIAGRFGDE
FT                   AIRLDDGVPMPLGVPV"
FT   gene            complement(105914..106273)
FT                   /locus_tag="Adeh_0087"
FT   CDS_pept        complement(105914..106273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79864.1"
FT                   /translation="MRRLLLVPLALTFALAGCSGPCQDLGDRLCKCVGVGTTRDACERS
FT                   VKEQLQNHNPSKDVEHLCDQRLKTCRAPDGAQFCEWINTACGKASCGLSSDEPATACEP
FT                   AAAAALDGEPVQSEP"
FT   sig_peptide     complement(106202..106273)
FT                   /locus_tag="Adeh_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.378 at
FT                   residue 24"
FT   gene            106372..107058
FT                   /locus_tag="Adeh_0088"
FT   CDS_pept        106372..107058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0088"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79865"
FT                   /db_xref="GOA:Q2IM30"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79865.1"
FT                   /translation="MTPSLALALPLALTLAASAPVTPPAPAEAGRAAAARTLEDPRALA
FT                   RKVQAFYERTRDLEARFRQTYVYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAPKTVAVK
FT                   GSRLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGAGALLLRPKEA
FT                   DPRVESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPRDVRRI
FT                   AAPKAQ"
FT   sig_peptide     106372..106461
FT                   /locus_tag="Adeh_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.756 at
FT                   residue 30"
FT   gene            107075..108550
FT                   /locus_tag="Adeh_0089"
FT   CDS_pept        107075..108550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0089"
FT                   /product="protein of unknown function DUF853, NPT hydrolase
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79866.1"
FT                   /translation="MPDPILVAKAPRAGGAFTDLALLPRLANRHGLVAGATGTGKTVTL
FT                   RVLAEGFSRLGVPVFLADVKGDLSGLARPGGEAPKLVERAEQLGVALALEACPVAFLDV
FT                   YGEAGHPLRTTISEMGPLLLARVLGLNDVQAGVLNVAFRVADEGGLLLLDLKDLRAMLE
FT                   HVSENAAALRARYGNVSPTSVGAIQRALLALESQGGDRLFGEPALALEDLLRTDLSGRG
FT                   QVTILHAEKLIRAPTLYATLLLWLLSELFEQLPEVGDPEKPRLVFFFDEAHLLFDDAPD
FT                   ELRQKVEQVVRLVRSKGVGVYFVTQNPLDVPDAVLGQLGNRVQHALRAFTPRDQKAVRA
FT                   AAETFRANPGVDVERAITELGVGEALVSFLDEKGTPHPVERAWVLPPRSRLAPLTAEER
FT                   AQVMASSPLRGRYDAPVDRESAYERLQRRAEAVTAGPPSPAGRPAAAPRTVGSEAASAL
FT                   GKMAQSAMRAAGTQLGREIMRGILGSMFGGRRR"
FT   gene            108646..110064
FT                   /locus_tag="Adeh_0090"
FT   CDS_pept        108646..110064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0090"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79867"
FT                   /db_xref="GOA:Q2IM36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79867.1"
FT                   /translation="MLDVADAALRAAVADAVREARRRSAEAVAWMRVALRAAILLVYLP
FT                   GWHGTAAWHAAALRVSAAYLAVAVGVLVLLRRRWRWEAVALAAAAVDLAFVAVGSWRVV
FT                   ALAGGDLALAIAAGAGNGMMLMVILFAAVALPPAPAAALSVIAIANQMALAAHSGVSWR
FT                   LVLLVGLILSAAAIVAIRNTLRATALGARLAAESYTASLCRAHGEALARANAEALAQRD
FT                   EVITAHRQARDLVRLMVHDLKNPLAALLQYLRLAEVELRGQPDAAQVREDLAQAEGEGQ
FT                   RLAEMIGDLLAISRLETGPARLAADPVAIEDLLQAVARSCAAHARERGVTISVRGGDDL
FT                   VVRLDRDLSRRLLENLVANALRHCRTGDRIELAGEADGEGVRLAVRNSGPPVPPAIRAH
FT                   LFEKFAPGEAREWTSAGLGLYLCRLVAEAHGGGVALVDTPGWTVSFEARLAPARTGGEA
FT                   APRAAAVAPERRPG"
FT   gene            110074..110931
FT                   /locus_tag="Adeh_0091"
FT   CDS_pept        110074..110931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0091"
FT                   /product="protein of unknown function DUF1684"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79868"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79868.1"
FT                   /translation="MPGNLAPLSFVLLTLVLAACKSRPPADPAFAAEWKGWHDRREERL
FT                   RMPTGWLALTGLHWLEPGENRIPGLPGTFTLEGGRVTLAAARSDGYVLGGAPLERRALA
FT                   PDSAGEPDRVQLGASVTLAVIERSGRFAVRVWDAAAPARTGFRGIDAYPPDPRWRIEAR
FT                   WEAYPAPREVEVPSVIGVATRELAPGRARFTVDGREVALEPTVEEDGGLFFVFKDATAR
FT                   DATYGAGRFLSAEAPRDGKVVLDFNRAVNPPCAFSAFATCPLPTPENVLPVRIEAGEKR
FT                   YGEH"
FT   gene            111181..111621
FT                   /locus_tag="Adeh_0092"
FT   CDS_pept        111181..111621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0092"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79869"
FT                   /db_xref="GOA:Q2IM34"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79869.1"
FT                   /translation="MGMEWTARLAVGIDDIDAQHQELFRRVNGLVTAMGERRGREELAE
FT                   VVAFLRAYVDVHFAAEARLMARSRYPGRAFHAAEHAHFRAQVEELAARIAAEGPESHHA
FT                   VKLAGILCEWLRQHVLLTDRQLADHVRAEDLLDDGWRGGGEG"
FT   gene            complement(111634..113085)
FT                   /locus_tag="Adeh_0093"
FT   CDS_pept        complement(111634..113085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0093"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79870"
FT                   /db_xref="GOA:Q2IM41"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79870.1"
FT                   /translation="MPRAPRSVRSRVPMATRVYMHTLGCPKNRVDSEVMLGTLAEAGYR
FT                   LVQDPAKAEVIVVNTCGFIESAKEESVEAIVELADQKREGRCRKLVVTGCLVQRHAEEL
FT                   ARELPEVDHFLGTGAYQDVARIVSDAQAKRLVVPDPDFVHSAATPRVNSLPSHTAYLKI
FT                   AEGCDNACAFCIIPKLRGGQRSRPIDDLVAEAAALAAQGTVELSLVAQDLTAYGQDLPG
FT                   KVRLHHLLPELAKVDGLRWIRLHYAYPRDVPDALVAAMADEPKIVKYLDMPLQHSSDRL
FT                   LRAMKRGRDSVFLRDLLARLRARIPGLALRTALIVGLPGETEADFEDLLRFVEEQRFER
FT                   LGVFEYSPEEGTPAAEMADQVPDALKRERRDRIMAVQQGISRAHQQAMIGRRLEVLVEG
FT                   RAEETEHLLAGRHAQQAPEIDGLTYVNDGVAYPGEIVTVEITDAAEYDLVGRVVARDPS
FT                   RAARPLPAAPRPPPPRRKGGLNVLG"
FT   gene            complement(113130..113618)
FT                   /locus_tag="Adeh_0094"
FT   CDS_pept        complement(113130..113618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0094"
FT                   /product="protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79871"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79871.1"
FT                   /translation="MPSFDVVSEVDLMEVENAFNQARKEIAQRFDFKGTHTELERDKEQ
FT                   NVLIRAGSEGRAEAALQVLMEKLAKRGVALESLDPQKLEPASGGHVRQLVKLKRGLKVE
FT                   DARKIVAKVKESGIKVQAAIQGEAVRVTGKKRDDLQAAIHAIRAAGFPIPLQFQNFRE"
FT   gene            complement(113662..115314)
FT                   /locus_tag="Adeh_0095"
FT   CDS_pept        complement(113662..115314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0095"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79872"
FT                   /db_xref="GOA:Q2IM39"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79872.1"
FT                   /translation="MAAPVRIVPLGGLGEIGMNCMAVECDGRIAVVDCGVLFPNENLGV
FT                   DLIAPDLSWLRERREQVGAVFLTHGHEDHLGALPFLLREIPVPVYGTRFTLALLRPRLE
FT                   EAGVRADLREVRPGDVRPAGEASPIAAEFLAVTHSIPDACGLALSTPQGTLLHSGDFKI
FT                   DPAPVRGPGMDLDRIEALGRKGVRLLLSDSTNAEREGTSLSESEVGPALEQAFERARGR
FT                   VFVACFASNVHRLQQIVDAARAFGRRVAFLGRSMEANARLAQELGYLELPAWMPVSPEE
FT                   ARTLPPRELCVLTTGTQGEPRSALARLARGEHPDLAVAPGDLVVLSSRFIPGNEIAIGQ
FT                   VVNELCRRGAEVAYEGLAPLHVSGHAQADEQRRLIRLARPAHFVPIHGEYRHLSRHAAH
FT                   AAAEGVAGRDVLVDGQVLELADAGVRVLEAPVATGRVYTDRDALLGADMGALVVRDRRL
FT                   LAETGLCIAVLAIERTTGAVVRGPELFARGVAGFEGAEEELRGEVLAALAELSPQARTD
FT                   PAEVQEAVRLAVRRFFRRTTGKKPPVLPVVLEL"
FT   gene            115411..116538
FT                   /locus_tag="Adeh_0096"
FT   CDS_pept        115411..116538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79873.1"
FT                   /translation="MAAARRILALPLALALAALPAQADGPAGGAAPAPSPEASPPEDAA
FT                   PRAPGPEVVRLRFAWPAPLDAQVTCRRTRVRTGAPPSVFTARYRQRAAAAGAGEAGLAI
FT                   STRGTTWEGDLPWAPAVARQALHASEQLVQRIGPDGAFAALEGAEALRPALRSLVDGAG
FT                   VQGAQAERAVARAEAGARGEAEELWNLSVGFWIDADLVLGQEYVMPSESELPLLPGVRG
FT                   PASVEFAVRRRVPCAAAERAARCVEIVLHATPEPAALARHAAALRARLAEGAEAPVPVP
FT                   AAHGRDGGELQAESTLVLVTDPATLVPRRVAWTRAVRLASAEDGAPALEHVDRVEYDYR
FT                   YPGKAPAAPPALRRRHAPGAPLEPAPVPAPVPVGI"
FT   sig_peptide     115411..115482
FT                   /locus_tag="Adeh_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            116697..119090
FT                   /locus_tag="Adeh_0097"
FT   CDS_pept        116697..119090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0097"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79874"
FT                   /db_xref="GOA:Q2IM45"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79874.1"
FT                   /translation="MGYLPAPVAEDLLQDLNDAQREAVLHDDGPLLVLAGAGSGKTRVI
FT                   VHRIARLVRDRGVVPWHVLAVTFTNKAAGEMRERLERLLGPLARELWVQTFHAFGARFL
FT                   RREAARAGLPPSFAIYDDDDQLRLVKRILAEVGLDEAEGLTPRRVLSQIDRWKNQALRA
FT                   AEVKVAGLDPDAARSKEVYHRYEQALSRAGAVDFGDLLLRPVRLLEEDAALRARWAGRF
FT                   RYLLVDEFQDTNPVQYRLLQLLTGPRRNVCVVGDDDQAIYRWRGADVSNILGFDGDFPG
FT                   AKVVKLEQNYRSTRTILDAAHAVISRARRRREKRLWTESGAGAPLALLVGEDEGAEAER
FT                   IARAVAAERGRGTSGDEIAVLYRTNAQSRPLEAAMRAARIPYVIVRGTSFYERAEVRDA
FT                   AAYLRLALSPASDLDLERVVNRPPRGIGEKTVERLRAHAAARGVPLVEAVAERDAVAEL
FT                   KPAARRALAEFHDLVTGLAADVPALDAGVAVQEVLKRSGMLSRLEEEHTDEAVERAENL
FT                   AELVAAAREFDESIAGEPPPGDPDEVRPPPLARFLEQIALLGEADAATPEGRVALMTLH
FT                   AAKGLEFEAVFLAGMEDGTLPYERPWADQTASERDESLDEERRLCYVGMTRAKRRLTLS
FT                   LARRRIGYGESGPSYRNMEPSRFLRDLPPELFGDAVAREVRAREAAQAAAVARPPTIRR
FT                   LPGALEGEPHIELDGDDLPRAPASAPRARPAAPRGEPTVDYSFDQRGDAGAAAFSRGER
FT                   VAHASLGEGVVLACEAGGADAKATVRFASVGDKRVLARFLRRAF"
FT   gene            119187..120317
FT                   /locus_tag="Adeh_0098"
FT   CDS_pept        119187..120317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0098"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79875"
FT                   /db_xref="GOA:Q2IM44"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79875.1"
FT                   /translation="MAQAAPTTLPQVTEALVRDLPKTDLHCHLDGSVRLATVLALAEQQ
FT                   GVRLPADTPEGLAKAIHMGEVCASLEDYLTAFDVTLAVLQTEEALYRTAYELALDAAAE
FT                   NVRYLEVRYSPVLHTRKGLKPTTIVDAVLAGLRAARRETGIESNVIICGIRHIDPTTSV
FT                   RLAELAVAYKGKGVVGFDLAGAEEGHPARRHRDAVQLILDNNVNVTIHAGEAFGPESIA
FT                   QAVHWCGAHRIGHGVRLRENGDLLNYLNDHRIPLEMCPSSNVQTGSVQGFASHPLKFYF
FT                   DFGLRVSVNTDNRLITDTTVTKELLVAHREMGFTLEDLCTVLVQGFKSAFLPFRDKQEL
FT                   LRRVNLEIAQVLARHGAPAPAAGDGAARADAGARAP"
FT   gene            120314..120799
FT                   /locus_tag="Adeh_0099"
FT   CDS_pept        120314..120799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0099"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79876"
FT                   /db_xref="GOA:Q2IM43"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79876.1"
FT                   /translation="MSARLRYRSPVGVLTVEASDEGVFGLSFGDRGPSHPGPSARARGH
FT                   LDAAARALDDYFAGRPPSLPPLVLQGSPFQKRVWEALLAIPWGDTRTYGEVAEALGAAG
FT                   GARAVGGANHENPVAILVPCHRVVQARGRLGGYGGGVEVKRWLLAHEAAHGPALRPA"
FT   gene            120947..122188
FT                   /locus_tag="Adeh_0100"
FT   CDS_pept        120947..122188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0100"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79877"
FT                   /db_xref="GOA:Q2IM42"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79877.1"
FT                   /translation="MAKLLAMILAGGEGRRLDPLTRDRAKPAVPFGGRYRIVDFVLSNM
FT                   ANSGILKMKVVVQYKSESLNTHVQRAWRLTSLLNQYVELVPAQMRVGPKWFEGSADAIY
FT                   QNLNIITDEEPDFTFVFGADHVYRMDARQMLAFHQDRKADLTVAAVPIPVGEASEFGII
FT                   EVDAEGRMVGFVEKPTSDPKTMPGDPTRCLASMGNYLFTTEALVQEIVRDAGDPASAHD
FT                   FGKSIVASMYQRKRVYVYDFARNVVPGQTERERGYWRDVGSIDAYFQANMDLVAVDPVF
FT                   SLYNDEWPIFTVQYNYPPAKFVFNNERDNRIGRATDSLISEGCIISGAHVHHSILSPKV
FT                   RVNSYATVEESIVFENVNIGRHCRIRRAIIDKHVDIPAHTTIGFDHEKDRKHFHVTESG
FT                   IVIIPKGMRIEAGR"
FT   gene            complement(122288..122674)
FT                   /locus_tag="Adeh_0101"
FT   CDS_pept        complement(122288..122674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0101"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79878"
FT                   /db_xref="GOA:Q2IM46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79878.1"
FT                   /translation="MAPEPSPLRILVAEDDPAVARLYTAYAQSRGHTVLVAHDGAEAFS
FT                   AAADQGPDLILLDVAMPKVDGRDALRRLKADPRTQGIPVLVISAHGSDQNLRELMLGLG
FT                   AWDVMEKPVDLQIAFNKAERLARR"
FT   gene            122813..124189
FT                   /locus_tag="Adeh_0102"
FT   CDS_pept        122813..124189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0102"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79879"
FT                   /db_xref="GOA:Q2IM49"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79879.1"
FT                   /translation="MIASPLLVAALLTAAPAAAAPPPGDAPEIPYTMFTLGNGLTVILH
FT                   EDHTAPLVGVHVQYDVGSKDERPGRTGFAHLFEHLMFQGSAHLPKGEADRLVDAAGGEA
FT                   NGGTSPDSTVYWEQVPSGALEQMLFIEADRMGWMFPTLTQEKLDNQRDVVRNERRQSYE
FT                   MQPYGLVFEKLLANLWDPQFPYHWQTIGTHEDLEAATLADVKQFFERWYGPENAVLAIA
FT                   GDIDPARTRALVEKWFGPIPGKARPAHQAPAPKPLTAEQRVSMDDRVQLPRLYLAWQTP
FT                   RVFAPGDAALDVLSSVLSDGKSARLVKRLVMDEQIAQGVSAGQMSQALASMYLVVATPK
FT                   PGIPLERLEREIDEELARIAREPPSAEEVQRAKNKIEAGAVFGLEPVGGFGGRAASLAG
FT                   YYVRTGDPGYLAKDLARYRAVTPADVSEAARRFLRKDARVVLTVHPRPAAAGAAAGSAR
FT                   "
FT   sig_peptide     122813..122872
FT                   /locus_tag="Adeh_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            124186..125745
FT                   /locus_tag="Adeh_0103"
FT   CDS_pept        124186..125745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0103"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79880"
FT                   /db_xref="GOA:Q2IM48"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79880.1"
FT                   /translation="MTRSLRLLPVLLAAALGCAGSRPAPAPAAPPAAPPQAAAAPAGAD
FT                   RSQLPALGAAPELHLPQQRHFALANGLRVRLVEHRRLPIVALNLVVRAGAVNDPARLPG
FT                   LASFTASMLTEGGTRTRTATRLSDEVGFLGASLGAGAGQDAASLSGSSLSRHLPKLLDL
FT                   FADVAMNPAFRAKDFARVQDQRKVTLLQQRDQPATIAGKAFLKAYWGEGHPYGHYVLGD
FT                   EASVAATRPADLAGFHARFWRPANAELVVVGDVSEAELRPLLERTLGRWPAGTAAAAPR
FT                   APAPAAPHVTLLLDKPDAPQTLVMLGMPGLARASPDYVAATVAFQVLGGGMSSRLFRTL
FT                   REEKGYTYGMGAGADARRLGGVSIVHGNVKAEVTGAALGDLLGEIRKLREQPVGDAELA
FT                   DARNALVRSLPADFATVGGIAGRVAELVIHGLPDDYWNGYADAVRNVGSADVQRIAERY
FT                   LDPARATLVLVGTPAAVRPQLEGLAIGKVEVRPVPGATPVRAPPRSPRVRTQRAPATSP
FT                   AP"
FT   sig_peptide     124186..124305
FT                   /locus_tag="Adeh_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.500 at
FT                   residue 40"
FT   gene            125813..126742
FT                   /locus_tag="Adeh_0104"
FT   CDS_pept        125813..126742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79881"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79881.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAHGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHGALKQMLSAARVSGTFWPAEKLLDRTRRKARAEWAASRD
FT                   KSYWREASRITGLVEHEYGEPVSDADWKRLFEQVVDGGLRGFYASEALEAIRATPRDRW
FT                   LSVDELDAWDFEGTKIWVAVDFAYRDAEGRVQILDWKTGRERTVDHTQLGIYSLYAQRK
FT                   WGAAPDAVVGGLVYLAAPEDGGAGRVSVAVDPAALATCQDQMRGSIAAMRAALADPARN
FT                   VAVEDAFPRPDDRVACRRCPFRRPCGRL"
FT   gene            complement(126739..127146)
FT                   /locus_tag="Adeh_0105"
FT   CDS_pept        complement(126739..127146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0105"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79882"
FT                   /db_xref="GOA:Q2IM53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79882.1"
FT                   /translation="MRGVADGALPARLRAAWGSLPPLYHLWAMSAGGERYLVAERGGRV
FT                   AGYAAWRGAELTAVFVRPSAGGRGVGAALVAAVERRARRDGVRALRVLAAAPAIGFYAR
FT                   LGFRPGRAARAPLPGGLGLPARWMRKPLATG"
FT   gene            complement(127233..128612)
FT                   /locus_tag="Adeh_0106"
FT   CDS_pept        complement(127233..128612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0106"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79883"
FT                   /db_xref="GOA:Q2IM52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79883.1"
FT                   /translation="MASAKKPSLMVIDDLDSARQMMKRTLARSYDVYDFPSVAEAVPAV
FT                   ERADFDCIVTDLRMPGIDGIEGLRRFQAKVPEIPVILVTAFATVETAVEAMKAGAFDYL
FT                   KKPFEPEELELVVARAVEHARVKKENARLRSALAGQFSVHGIVGKSQSMKDLVSMLERI
FT                   APSDVPILIEGESGTGKDLLARAAHALSSRAQGPYVALNMSAIPENLAESELFGHEKGA
FT                   FTGADQPRAGFFAEAEGGTLFLDEIGLLPPALQPKLLRVLQDGEFIPVGSRKARKANVR
FT                   VVAATNEDLQRRVKEGKFREDLWFRLRVVPLRLPPLRERREDIPLLVEHLVQKHALRLS
FT                   RPPLQPDADAMRALLDHAWPGNIRELEHAIERGLLLARGEAITLADLPPELTPPADAAG
FT                   GADEGRYRRARDAWEKRFLEDVLREAGGQVARAAELSGLHRSTFYEKLARHGLADKDAK
FT                   P"
FT   gene            complement(128615..130108)
FT                   /locus_tag="Adeh_0107"
FT   CDS_pept        complement(128615..130108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0107"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79884"
FT                   /db_xref="GOA:Q2IM51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79884.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWRELVRGQELLLREGVAL
FT                   ASTTATGASHWVREGGVDPGGPEALPALLERLVSSAPLDRAWIVDSAGKVLACVSRTGE
FT                   PCPDGVPPTEFQAADWPLQTLSRLVRPEGIVASAPIVRAGAVVGAVRVDFTHEEVVGAA
FT                   RDLAWGAAAVAAFWIALGHLLAAIFIRQVTQPLVSLASAAESLAEERGVRLEEPEDREL
FT                   VDLVRAFNHMSARLDERRAENQRLIAELEERVAQKTREVLRADRLATLGGIAAGFAHEL
FT                   GNSLNVIRGYAAVTSRELPDDSPHRSDVEAIRREVTRAAGLIERFLVFARARTVHPLVQ
FT                   PVEPILREAVEVLGPAAAHAKVERAVEVEPGLPELLADAELLRQAFLNLGVNAVQAMQD
FT                   RGGKLTVRALREPGGLVVEFQDTGPGIDPDAAAHVFEPFFTTKATGTGLGLAIVRQAAE
FT                   AHGGTVEVAGAPGAGATFRVHLPAAEAGAAADAAAGGAG"
FT   sig_peptide     complement(130034..130108)
FT                   /locus_tag="Adeh_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(130105..131034)
FT                   /locus_tag="Adeh_0108"
FT   CDS_pept        complement(130105..131034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79885"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79885.1"
FT                   /translation="MRLSRNAKTVLAGLAALALVGLVAGFLRFKEFVDEDPRLCATCHR
FT                   ASPEFALWMGGTHRSVSCQRCHHSTPEQGLAMLRAFLAGQKPKGKHAEVEVGACAECHF
FT                   SHDPRWPQVGNSRGHRIHYQERGIACVRCHAASMHGFEPVAKKCEECHPKHAVGVEKMA
FT                   ALHCFACHEFLGSEQGLRPTRRDCMRCHTAQGIHAPMNEHGADHGAPMEMSCSACHRPH
FT                   RPEGQTLAACAECHGDDKMAKGGLHTHRGHRACLECHKPHTWTAEQADCLRCHPSGKAH
FT                   AEGTACTTCHAFVGAPLPSFPTEDGGVR"
FT   sig_peptide     complement(130963..131034)
FT                   /locus_tag="Adeh_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.277 at
FT                   residue 24"
FT   gene            complement(131152..132867)
FT                   /locus_tag="Adeh_0109"
FT   CDS_pept        complement(131152..132867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79886"
FT                   /db_xref="GOA:Q2IM56"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79886.1"
FT                   /translation="MHTRTTPMRATLLAIALLLSTAARAEEAKPAPKLPADAESCLMCH
FT                   DKGGGAPEVDFKAFPGSVHGQAEVGCTDCHAGYKEGPHEGELPALSAAEQATVARLAKG
FT                   AWGEGEAKHGVTAPRAYLACQSCHTTEAEAFAKSVHGKWLAQDTKAPGATCASCHGSPH
FT                   ALPAKLAEYAPKDGKRVPVPADRREMTKRCEACHGNEAFAEAAGLDPEAVITYHDSIHG
FT                   RLTRVGNAAAPTCVSCHAAAPDAGGTHAILSKTDPASTVSAANKKQACARCHAGATDTF
FT                   AGLVAHKPLHETGGSVIPHLVHVAFSWLTTLTLLFFAFHVLVDFVYELRSRLAKKAGHG
FT                   PSADAVRSVIRFDIHQRIQHWFMLSGVILLGITGWPLRGAGDAEAATYSRAFMKVFGGA
FT                   EGAATWHRVGAVLIIISAAYHLFYLTFLASKKRLPLSMLPVPKDALDMRDNILFMMGVK
FT                   KERPKFDRYMYLEKFDYWAVFWGIVMMVGTGFIFWFPVWFASWAPGWLITAAQIIHGEE
FT                   ATLAILFLFTVHFYNVHLKPSIFPMNWAWLNGRISVEAMKHEHPLEYDRLKDDL"
FT   sig_peptide     complement(132790..132867)
FT                   /locus_tag="Adeh_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(133102..133410)
FT                   /locus_tag="Adeh_0110"
FT   CDS_pept        complement(133102..133410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79887"
FT                   /db_xref="GOA:Q2IM55"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79887.1"
FT                   /translation="MAQNKLPSLIGAGIGLALFLAVALLPALLYGGYAGLLLAGGIVGT
FT                   PVQPTLLVRGLIVFGMGLGVVGVASLFAVAGAAAGAAVGAILTIAGRRPVAQEQSGR"
FT   sig_peptide     complement(133291..133410)
FT                   /locus_tag="Adeh_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.531 at
FT                   residue 40"
FT   gene            complement(133612..135357)
FT                   /locus_tag="Adeh_0111"
FT   CDS_pept        complement(133612..135357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0111"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79888"
FT                   /db_xref="GOA:Q2IM54"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79888.1"
FT                   /translation="MLAPTLAPLLALALAARADLTTTAEKTGFRETGRYDEAVRLCRGL
FT                   AAAHPARARCLTFGETPEGRPLVALVASAGGGLDARAARAARRPVVLLQGGIHAAEIDG
FT                   KDAGFMVLRDLLASRDGGPLAKVTALFVPVLNADGHERFGPNHRPNQRGPEASGWRTTA
FT                   QNLNLNRDYVAAQAPETQAVLRLMDAWDPIALGDLHVTDGAQFQHDLAVMVEPRQGYSP
FT                   AMREEGAALSAALVERLAAAGHLPLDFYPSLREDGDPASGFAPYPAPIRFGHGYWAARN
FT                   RFGILLETHSWRPYAHRVKATAHFVRALLDLAAERGGRWRAAADRADREGAAAGGREVE
FT                   LGWAPGSRTRPLAFQGYAYVREDSPVLGKKVPRYDETRPEVWNVPVVDELVVTARARVP
FT                   MGGWIVPAAHAGWMAGKLRLHGIAFERMASRRAAAQVEAFRATAVETKAQSFEGRHQTT
FT                   LAGAWAPEARDLAPGWLWVPSAQPLAPLAAMLLDPAGPDAFVAWGAFATAFEKKEYIED
FT                   YVLDPWARALLAKDPAVKAEFERRLADPAFAKDPAARLEFFHRRHPAHDEAYRLYPVLR
FT                   AARRP"
FT   sig_peptide     complement(135301..135357)
FT                   /locus_tag="Adeh_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.979 at
FT                   residue 19"
FT   gene            complement(135428..136462)
FT                   /locus_tag="Adeh_0112"
FT   CDS_pept        complement(135428..136462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0112"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79889"
FT                   /db_xref="GOA:Q2IM60"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79889.1"
FT                   /translation="MLNFVHNILSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQADG
FT                   RGSRRVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKHFIQTAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPVNGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(136594..137628)
FT                   /locus_tag="Adeh_0113"
FT   CDS_pept        complement(136594..137628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0113"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79890"
FT                   /db_xref="GOA:Q2IM59"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79890.1"
FT                   /translation="MLDWLHNMMSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQQES
FT                   RSGRKVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQAAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPVNGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(137679..139703)
FT                   /locus_tag="Adeh_0114"
FT   CDS_pept        complement(137679..139703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0114"
FT                   /product="peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79891"
FT                   /db_xref="GOA:Q2IM58"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79891.1"
FT                   /translation="MLTAALVALALASVPRPFTVDDLLALERAGDAAISPDGASVAYTV
FT                   ATSAPGGEKLVSALHLVPAAGGAARRLTFGEERVSSPAFSPDGRRIAFLSNRKGGTQAW
FT                   VLDLQGGEARRVTDLPGGVSELRFTPDGAALVVASDVDPACGADAACNRKADAAAEVRP
FT                   HLADRLLFRHWDEWRERVRTHLVRVPLDGGAAVDLTPGDRDAPPVQRGSGDDLAFSPDG
FT                   KTLYYVAVSDPVEATSTNGDVYAVPLAGGTPRRVTIAPGWDGAPRPSPDGKRLAWLAQP
FT                   RAGYEADRYHVMVAAADGSGARDLTAGFDRSAADLVWARGGKALRFTAESEGVHALYEV
FT                   DLAGKVTELYRGRNLARVSWSRDGARLAALVDGLAAPPEVAVLEPGGRGAQPRPLTALG
FT                   AKGLAGIALGEVRPLSATGKDGQALHGWMVLPPGHRDGERHPAVVLVHGGPQGAWNDAW
FT                   SFRWNPMLYAARGWTVVLPNPRGSTGFGQGYTDAVRANWGGTPYDDIMRLTDAAVATGA
FT                   ADGGRMCAAGASYGGYMVNWINGQTDRFRCLVAHAGNFDLRMAYYDTEELWFPEWELGR
FT                   PWETPEAFERWSPSAFVKQWRTPTLISHGEKDFRVTVTQGFAAFTALQRRGIPSRLMVF
FT                   PDEGHWVLKPRNAKVFHDEVLGWIGRWLDSPAPQASAPR"
FT   sig_peptide     complement(139644..139703)
FT                   /locus_tag="Adeh_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.734) with cleavage site probability 0.732 at
FT                   residue 20"
FT   gene            139800..141566
FT                   /locus_tag="Adeh_0115"
FT   CDS_pept        139800..141566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0115"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79892"
FT                   /db_xref="GOA:Q2IM57"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79892.1"
FT                   /translation="MPGPLAIPDLRAPCPGCGHLAEPAGGPLNFCPRCGLDLRETARRA
FT                   PPPDPLVGRVIADRYRLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAAER
FT                   FRAEARIVSRLSHPHTIAVFDFGELPERGFYLAMEYVPGQDLARALREGGAFSEARAVG
FT                   VAQQVLGSLAEAHEAGVVHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGATTG
FT                   AGAVVGTPSCLAPEQARGGPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHLHD
FT                   PPPPLRQVAPGVSPRLAEVVHRALRKDPAERFPSADAMRAALAGPGHPARPSRRPALPR
FT                   AAGELELASREDFRDGLEQGALERQVGVLRPQRLVTPAGAALVAAVALAAGAAWRWDDL
FT                   YAALADRAPGIAARVPAALRPAAAAWVEREPNDGAAEATPLPLLPRADGVPAAEVRGAV
FT                   GAPRRPDEGDLDVYRLAVPDGAGRRVLRARWHAAGAAPDQGIPGLAVTLSLNRAPAGAE
FT                   RAPLVAAAGEGGPGAAEALSAEVEPGTYWLSVRERHAAGAAPAGRPDAPYALEVELAPP
FT                   APGEAATRAPQK"
FT   gene            complement(141618..142067)
FT                   /locus_tag="Adeh_0116"
FT   CDS_pept        complement(141618..142067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0116"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79893"
FT                   /db_xref="GOA:Q2IM65"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79893.1"
FT                   /translation="MKLILREDVENLGKGGDLVDVKPGYGRNYLLPRGLAVSANPKNVK
FT                   ELEHQKAVAAAKAAKLKASAQAVAKRLSETPVTLKRKVGEQDKLYGSVTALDVAEALAA
FT                   RGVQLDRRSIVLDEPIKTLGEFEVPVKLHSEVAGKVKVTVEAEAE"
FT   gene            complement(142080..142487)
FT                   /locus_tag="Adeh_0117"
FT   CDS_pept        complement(142080..142487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0117"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79894"
FT                   /db_xref="GOA:Q2IM64"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79894.1"
FT                   /translation="MARPDMGGPKMGGGFGGPRSGGFGGGGGGGGFGGGGFGGGRGGDR
FT                   GDRGDRDDRGGDEGGGRRGFGRRKVCRFCADKTLKVDYKDQGQMKYFLTERGKIIPRRI
FT                   SGNCAKHQREVATAIKRGRMLAILPYTVGQM"
FT   gene            complement(142491..142937)
FT                   /locus_tag="Adeh_0118"
FT   CDS_pept        complement(142491..142937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0118"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79895"
FT                   /db_xref="GOA:Q2IM63"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79895.1"
FT                   /translation="MAETKQLVREYETIYLLKSETPDEQVDEIKERLRGVVSRQGGKVI
FT                   RFTNQGKRKTAFPVAKNAKALYMHCLYIGKPGLVTELERNLKMIDVVTKFQSVKLADGV
FT                   DFDARQVEADVKIQAVDDEQKPREERPEGGEEPFEAEAPEGQEE"
FT   gene            complement(143043..143621)
FT                   /locus_tag="Adeh_0119"
FT   CDS_pept        complement(143043..143621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0119"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79896"
FT                   /db_xref="GOA:Q2IM62"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79896.1"
FT                   /translation="MKLVVGLGNPGEEYARTRHNVGFVVADRLAQLAGASFTAKKFAAE
FT                   LAEARLGPERVWILKPQTYMNHSGEAVGAALRFWKLGLDDLVVVHDDLELEPFRVQLKV
FT                   GGGHGGHNGVKSVNAHVGSPEYARVRVGVGRPPPRMDPADYVLGKFAKGEDAELDLCVE
FT                   QAVEATRLAVELGAAKAMNQVNRRSRAAE"
FT   gene            complement(143631..144353)
FT                   /locus_tag="Adeh_0120"
FT   CDS_pept        complement(143631..144353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0120"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79897"
FT                   /db_xref="GOA:Q2IM61"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79897.1"
FT                   /translation="MAENVLSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALD
FT                   PATLLKAIETPHKFNTLLELQVEGASKHVLFKDYTVDPVTRKLLHADFLEVSMDQPVKV
FT                   NVPVVTVGRAAGVAEGGILSVAAHAIVVEALPNKIPVRIEVDVTELKIGRSLHVSELKA
FT                   PEGCKFKFQTDYVVVFVAVPEKEEVAAPVAAAVPGAAPAEGAAPAAGAAAPAAGAAPAA
FT                   GAAPAKGGEAKGGDKGKK"
FT   gene            complement(144627..145592)
FT                   /locus_tag="Adeh_0121"
FT   CDS_pept        complement(144627..145592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0121"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79898"
FT                   /db_xref="GOA:Q2IM69"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79898.1"
FT                   /translation="MASNGHYPDYRVFCGNANRPLAEAIAKELGRPLARATVGRFSDGE
FT                   IQVEIGENVRGLDTFIIQSTSPDANTNLMELLIMIDALKRASAGSINAVLPYYGYARQD
FT                   RKVAPRVPITAKLIADLIEAAGATRVVSMDMHAGQIQGFFNVPFDHLYAAPVLLEHMRK
FT                   RFDGLTQDLVIVSPDAGGVERARAYSKRLGAGLGIVDKRRTKPNVAEIMNVIGDVNGKV
FT                   AVLLDDMIDTAGTLTQAANALVDKGATRVFAYATHAVLSGPAVDRIMKSPIEEVVVTDS
FT                   IQLAPPAASCPKIRTLSVAGLLAEAIRRIHSADSLSSLFV"
FT   gene            complement(145742..146047)
FT                   /locus_tag="Adeh_0122"
FT   CDS_pept        complement(145742..146047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0122"
FT                   /product="SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79899"
FT                   /db_xref="GOA:Q2IM68"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79899.1"
FT                   /translation="MEITEVRVFPVNEEKLKAYVTITLDHCFVIRDLKVIHGNTGLFIA
FT                   MPAKRRKDGTFKDIAHPLNSDTREKMERTILAEYDRELKKGAAAPARATGTDPHED"
FT   gene            complement(145987..146928)
FT                   /locus_tag="Adeh_0123"
FT   CDS_pept        complement(145987..146928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0123"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79900"
FT                   /db_xref="GOA:Q2IM67"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79900.1"
FT                   /translation="MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRV
FT                   SARRGPVRCTVPGRPELHGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGS
FT                   SDAAAVLRCLARAFRVRDRAALAALALEIGSDVPFFLGPGPAWAAGRGERLSPADVPPL
FT                   DLVLVYPADPSLAIRAGDAYRWLDEARAGGPQAPRRLGRPGRWRPSLLGNDLQAPCVAR
FT                   KPALQALLGLLVGAGATAAIMSGSGPTVFGVFPGRGAARGAALAIQGRAKGGAAGVQVL
FT                   LARTVRRHPRVSPWRSPRSASSPSTRRSSRPT"
FT   gene            147078..147431
FT                   /locus_tag="Adeh_0124"
FT   CDS_pept        147078..147431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79901.1"
FT                   /translation="MNSTFARAAACAALLAAAGCRSAFAPEPVLKLSSAPAAEHPATVV
FT                   QAAELRSGPDGLAKVLGTVAAGTTVTASDKPIRGFLRVRTADGKSGYVPQAAVSATAAA
FT                   SAPAPAPAGAVAP"
FT   sig_peptide     147078..147149
FT                   /locus_tag="Adeh_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.913 at
FT                   residue 24"
FT   gene            147596..147943
FT                   /locus_tag="Adeh_0125"
FT   CDS_pept        147596..147943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79902"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79902.1"
FT                   /translation="MTRTAILPLAALAAVLALAPACKGDDAKEQVVKVTVTKNGYEPWR
FT                   IEARAGRPLTLVMTRVTDETCATEIVIPDLGMNVPLPLNETVMVRLVPQKTGELRFSCG
FT                   MKMFQGVIDVK"
FT   sig_peptide     147596..147670
FT                   /locus_tag="Adeh_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.709 at
FT                   residue 25"
FT   gene            147954..148868
FT                   /locus_tag="Adeh_0126"
FT   CDS_pept        147954..148868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0126"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79903"
FT                   /db_xref="GOA:Q2IM73"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79903.1"
FT                   /translation="MRRRRASRRRLPAAGARKFGRRLPGRPALCSRPVRDLSYDHVPYR
FT                   MSEIEHRYGENVHIVANPFLLGALATLCSKETRQPAINRLVRLLYEDLIRTVMNHEFPR
FT                   RRVAVPTRMIDSSPQAIFEGEVVDRQVRAVTVNIARAGAVPSQLVYDLLNETLEPSLVR
FT                   QDHIIMSRMLGENEEVVGAGIGGMKIGGDVDDAFLLFPDPMGATGSSLATAIETYKKKV
FT                   PGKARRIVNIHLIVTPEYLRNMTKAHPDVRIYAIRLDRGLSPPDVLATVPGTRWDEERG
FT                   LDDHQYIVPGGGGFGEIMNNAYV"
FT   gene            148861..149388
FT                   /locus_tag="Adeh_0127"
FT   CDS_pept        148861..149388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0127"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79904"
FT                   /db_xref="GOA:Q2IM72"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79904.1"
FT                   /translation="MSSSRAGLDVLISEADLRARVEQMGADVTRDYAGKNLVVIGVLKG
FT                   SFIFLADLVRAIDLPLSVDFIGISSYQGTRTTGVVQITSDLTRPIDGKDVLLVEDIIDT
FT                   GLTMRYLLENLSTRKPASVRIAALLEKPARAQVKIPIDYRGFVIGDEFVVGYGLDWDGK
FT                   MRNLPFIGVPRK"
FT   gene            149407..150213
FT                   /locus_tag="Adeh_0128"
FT   CDS_pept        149407..150213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79905"
FT                   /db_xref="GOA:Q2IM71"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79905.1"
FT                   /translation="MADETTRARAGSGAKALLAWVAILGLAGVVAWLASERNARTWYLV
FT                   PDEGRLVVMKGLMLPVGRQAFATDDPALAAAYAPLVPPPGKPLPAERAFEERSLLDQGL
FT                   FDLLAGWAREEVATGDPARLERGLGYLGRAERLAGISPAQRDELGAIRAESGYHEARRL
FT                   LERAAAELRDAAEKLRVTAGSRSSRAMDAQLLLKQLEPAVDATLGAIRTAARAEPAAAE
FT                   QGAGTPPAAGEPAPAAAPAPDHAPAAPPAAAPAGPAAQLPPSGEGR"
FT   gene            150285..153128
FT                   /locus_tag="Adeh_0129"
FT   CDS_pept        150285..153128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0129"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79906"
FT                   /db_xref="GOA:Q2IM70"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79906.1"
FT                   /translation="MASFHARNGTGELLARYAFVEPLLEGRRILEIGAAAATEGATAGF
FT                   LAERGAAEVVSIEEDGAALGAAARGPHAPYVQFRAARPEDLPAGAFDVVLLADGAALAA
FT                   DPGRAAALARLLAPGGRLVTAVDAGGPGLADLAGEPRGAAPPGYEAFVGALVGRFPQVE
FT                   VAAQSATLGWVFGMGGGSGEEPELSMDGSLAGTAETAAYVAVCGDAPCGLSGFTLVALP
FT                   AGPLLEEGAAGAASAAVRALAADALRERAEALAARDLALGERDEAAEERERLRAELDAA
FT                   VAAGVDAARARDRVLAEAAADRDRAARAEQAAAAAADARDAALAAREALARELDAIRAG
FT                   VDDLRRSREAVEAEVDRLRAGAELGDARARELEAMLDAERGGAADARAELERAEVVIAE
FT                   RTHELAEARAALATQAGAVAQADEARARADAALAERREAAAEAEAALQAARSEAQAAKA
FT                   ALEAALERASVGEARLPELEEALEARAHEAAEAEAALREARDRIAALEAEAERGREALA
FT                   EARAAEEVARLDAGSARAEAGRALVDAEAAREEAGRLAGELRSAEAARAQAAAEAEPLR
FT                   AEADAARARAERLAGEAEAARAVLVERERADAARDAELREAAEARAEALAAGAGEVEQL
FT                   TAALAGAAAAAGEAAAVREALEARVAELEARLESEAERAHLVEARAAEALARLEGLEEA
FT                   GAAHEAEQGAAVRTAEARAEQAEAAARAAEARAAAAEARPATPARDAGLEAELAAARSA
FT                   ADVAGAQAAELEAELQAVRWEKDEIEQRLQSLTASGALGGAGELSRLRDELAARAGEGA
FT                   LLRKEIQRLEAQVAELTARPLAAPAPAEEAEAVRRAAARAAELEDRLAEALRRAADAEA
FT                   AAEAARAAPAPLPAAAPGEALKRAAQEKDAIAAQVAERDQKIARLQREVADKTERLGRL
FT                   AKEMGELKARGFGKIFR"
FT   gene            153142..153669
FT                   /locus_tag="Adeh_0130"
FT   CDS_pept        153142..153669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79907"
FT                   /db_xref="GOA:Q2IM78"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79907.1"
FT                   /translation="MTEPRRYERIDVELPCRLYIPGERGLKFEAHCTSRNLGLGGVFLS
FT                   SSFLLREGLELFVELGLPGGPLAIRARVAHTVPGDDPELEAGFGVEFLDVDAAGRETLL
FT                   RYFTPLRYHEFYRAFAGEFPHLRERVPVADVALLLNLWEEWKVRGEGGPAFTASGAPPA
FT                   PARAGAARRARR"
FT   gene            153857..156037
FT                   /locus_tag="Adeh_0131"
FT   CDS_pept        153857..156037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0131"
FT                   /product="glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79908"
FT                   /db_xref="GOA:Q2IM77"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79908.1"
FT                   /translation="MTPVRLALLWHMHQPPYREPETGAYLMPWVRLHATRAYHDMAWML
FT                   ERHPGVRCTVNFTPVLLEQLEDYAQGTAQDRLLELSARPPADLGPEDRQQILRSFFMVG
FT                   WETNVKPMPRYWELLQKRGRELRGVDLARLAQSFDDQELQDLQALFNLAWMGFGAQADE
FT                   PAVRALREKGRGYTRADVDAVLEVQRRIAAGVVPRWRALQDRGQVELSTTPYYHPILPL
FT                   LCDTDAAHRALPGIPLPPRFAHPEDARWHVREAIASHARRFGRPPAGMWPAEGSVSPEA
FT                   LEILATEGVGWAASDEGVLLQSLPAAAPRLRSVYRPWRVAAGAGRELRMLFRDRALSDV
FT                   IGFTYARVPAAEAVADFSAHVRAVADAWARDGQPGAPTVGVFLDGENAWEHYPSSGHDF
FT                   LDRLYDALERSDRVETVTMSEATAAPGGPPIARIHTGSWIEASFRIWIGHREDCEAWTA
FT                   LGRVREALAQAEEKGELPAERLARARRHLYAAEASDWYWWYGEDFTTEQAAEFDALFRA
FT                   HVNRAALLCGVDPPPESQAPIKRAGAPAPGGLEAKPLREPVMLLTPALDGRETTYFEWQ
FT                   GAGLYRPGQHRGSMYGGAQAFHVLRFGFDLAALYLRLDPAESPARAAEVATHVRVSVRS
FT                   RDGQRWVDFPLEPDGAPRPGAWRGKALGRLAFAQVAELELPFAGLGLSPGDRIDLAVHA
FT                   LRGEVEVERLPRYGYLTLTVPDQDFERIHWRV"
FT   gene            156086..156955
FT                   /locus_tag="Adeh_0132"
FT   CDS_pept        156086..156955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0132"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79909"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79909.1"
FT                   /translation="MADDPTRVRTPEERAAAAAGHCLVFVAGDGALGLRVPLDGEVVLG
FT                   RDPSCAVSLPAGDVSRRHARVVPDGEGHLVLDLGSTNGTWVNGREVAVHRLAPGDRVQV
FT                   GPFVARYLRAGDAEESELAALADLALRDPLTGLPNRRAFEESLRREVARARRGGARLAV
FT                   AVLDVDRFKDVNDRHGHAAGDVALAEVARRAAAALRAGDLLARIGGEELAAILPGADVA
FT                   AAAEVAERVRRAVGTEPVQAGGQALRVTVSLGCAELAPGDADGADVFARADGHLYRAKN
FT                   AGRDRVAW"
FT   gene            157089..158285
FT                   /locus_tag="Adeh_0133"
FT   CDS_pept        157089..158285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0133"
FT                   /product="major facilitator superfamily MFS_1 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79910"
FT                   /db_xref="GOA:Q2IM75"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79910.1"
FT                   /translation="MKNRSALAILFVIVFIDLLGFGMVIPVMALYAERLGAPDAQIGWL
FT                   MTGYSAMQFVFTPIWGRLSDRHGRRPLLLVSIVMTAVGFLGYALAPSFAWLLVSRLFAG
FT                   AATANIAIAQAYIADVTPPEGRARGMGLIGAAFGLGFVLGPAIGGLLSAISLSAPGYAA
FT                   AALAAVNGVAAFFVLPEPAAHVQAERRPHLEALLGGVSRPGIRRLILIYFIAILAFSGM
FT                   EATFALLAVHRYGLDQRQVSYVFALIGVVATVVQGGLIGPLSRRFGERALLVAGLLLQA
FT                   AALAALPYAGSVAGLLVATVPLAFGSSLTTPSLTSLISRSARAEDQGGTLGIGQSAAAL
FT                   GRIAGPISATHAYSQLWFAAPYLGGATLMLAGAAVGSTLRRPPRHEPVEPGAAPAEEG"
FT   sig_peptide     157089..157178
FT                   /locus_tag="Adeh_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.540 at
FT                   residue 30"
FT   gene            158294..159295
FT                   /locus_tag="Adeh_0134"
FT   CDS_pept        158294..159295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0134"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79911"
FT                   /db_xref="GOA:Q2IM82"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79911.1"
FT                   /translation="MPDLRRDPIVGRWVIIATERARRPSDMQRAAPAPQGGLCPFDPGN
FT                   EGMTPREVYVAGRAPSAPPNAPGWKVRVVPNRFPALKIEGELDRQAEGIYDRMNGIGAH
FT                   EVIVETPDHGRSMEDLSAAELTEVLFAFKARILDLRNDLRFKYILLFKNHGHLAGASLE
FT                   HAHSQLIALPVVPRQVIEEIEGARRHHDLKERCIFCDIVGQERKERARLVLENDEFVVF
FT                   APWAPRSPFETWIMPKRHQSNYEAEPKERLALCAEALGSTLRRLGGALGKPAYNFMVHS
FT                   NPLRDAQSPSYHWHIEVMPALTQVAGFEWGSGFHINPVPPEEAAEFLRKMPG"
FT   gene            159324..160751
FT                   /locus_tag="Adeh_0135"
FT   CDS_pept        159324..160751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0135"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79912"
FT                   /db_xref="GOA:Q2IM81"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79912.1"
FT                   /translation="MQILFVASEVAPWSKTGGLGDVAGALPRALAERGNEVVVVTPRHG
FT                   SIDPRAAGLQPVRTSLHVRGEPVALWVKRGPAPVYFVEHPHLFGSRRGLYGDGGRDHPD
FT                   NAERFAFLTRAALALPGALGLRPRILHLNDWQCGLGPWLLRHEHARDPALAGARTVFTI
FT                   HNLAYQGLFPKQVLPALGLPWEVFRWEAMEFFDQLSFMKAGLAFADALTTVSPTYAREI
FT                   LTPEGGASLDALLRHRARDLHGILNGIDVHAWDPARDPHLPAHFTPGELAGKAACKAAL
FT                   QREVGLPVRRDAPLAGLVTRLAEQKGIDLVAAALPALLARDVQVVLLGSGDPAYEEAFA
FT                   RAAREHPDRVAARIGFDEGLAHRIEAGADLFLMPSRFEPCGLNQMYSLRYGTVPVVRSV
FT                   GGLADTVEDFDGFARGTGFRFAEYTPQALLTATRRALDVFRDRRAWRGLVERGMAEDNS
FT                   WERSAARYEALYRTLAP"
FT   gene            160802..161143
FT                   /locus_tag="Adeh_0136"
FT   CDS_pept        160802..161143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79913"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79913.1"
FT                   /translation="MATAPHDDPEPTARPTEQIPRERLEDDDERLVPSANVGGAAPTPL
FT                   GADSGGDLPGPEDDLASMSEPEPPEPPEVGAVHVRRAAAGEEGEEAEEGEAGEEEEGRP
FT                   RPGAPRTRH"
FT   gene            complement(161162..162403)
FT                   /locus_tag="Adeh_0137"
FT   CDS_pept        complement(161162..162403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79914"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79914.1"
FT                   /translation="MSLPLRRAAVLLLAAACTPSTAPAPAPAAPPANHVARGTITPARY
FT                   VPPPARGARVRPEACLPGEPFAAPSALAEEAVAALDAGARERALACADEALRLSPRMVP
FT                   ALTARGAALAALDRLDEARLAFARALAVDPDEPEALLGAAELHVRRLGSARDALEAGLE
FT                   YAVRGVRSATRPPRKDKDLAARLELVAGMAENDLGRSHLALAHLERALAVRPKDPDALY
FT                   ERGVALFELCRFGDARRAFERALAIAPDDPWAIHQLGLVAERTGEGRRAAALLARARSL
FT                   APDDFKDELAVDAGAFRAEVEAAVAALPAAEREALKLAPVEIQDLPDTEDLTAVEPPLS
FT                   PSILGLYRGPPADEACTEADGPRCRSIVFYRKNLLRFARDRAELTEQVRVTLLHELGHL
FT                   HGESDDELRDRGLE"
FT   sig_peptide     complement(162338..162403)
FT                   /locus_tag="Adeh_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.873 at
FT                   residue 22"
FT   gene            complement(162569..163489)
FT                   /locus_tag="Adeh_0138"
FT   CDS_pept        complement(162569..163489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79915"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79915.1"
FT                   /translation="MRGAPDIREVQDHLFDRLARGQLLLLVGAGASRWAGLPSWREAVA
FT                   ALARDLVPVLRERLPDAPARFSPPGPDDPVALETLLRVPEAHRALCGEARLVERLAALF
FT                   DTSGIDPAGLPLHRLLVRLAGFVPALYTTNFDDLLERTFAWAGRACQVVAAPDDLQRWR
FT                   LDPAGGRFVSRFPVYKLHGTLDRPATLVVSETDFQRRASLAAHAIDLRFCSDAVGRELL
FT                   LVGYGFNDPNLRWIWTKLRDLEVLPVAWFLELGTSTDLDLATFELDRIARVDLRASDPV
FT                   HPPELLAFLGALADRCEAALAPLPR"
FT   gene            complement(163548..164678)
FT                   /locus_tag="Adeh_0139"
FT   CDS_pept        complement(163548..164678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0139"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79916"
FT                   /db_xref="GOA:Q2IM87"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79916.1"
FT                   /translation="MKTDVVVVGAGLQGASVALRLAQAGKQVVVLERAVPGAEASYAAG
FT                   GILSPGVEALEPGPFYALCAASLARYPAFAREVEAASGMWVGLRGGGTLEIAVDDPEAR
FT                   LLAGRAEKLHKAGLPVEVLDDAEVRRLEPGVSPEARGALYFADEASVDPRLLGRAVYVA
FT                   AARAGARFVTGKVERIVHEGGRAVGVDHAAGRIEADAVVLAAGSWSMQVEGNGLPPGAV
FT                   RPVRGQIALLDTRPPLLSRVVFSANGYVVPRADGRILCGSTMEEVGHEKAVTAGGLRRV
FT                   LDIALEIAPALAGAPVVETWSNFRPASPDGSPILGAGTVPGLHYATGHTRNGILLAPIT
FT                   ADAVAAAVLGTPPPVDLAPFSPARLGAGRPQAAGRK"
FT   gene            complement(164749..165375)
FT                   /locus_tag="Adeh_0140"
FT   CDS_pept        complement(164749..165375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79917"
FT                   /db_xref="GOA:Q2IM86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79917.1"
FT                   /translation="MDGSVATRRIGPPRAGIAERIWDAARAEFSKRGYHGARVQGIARG
FT                   ASCNVALIYRHWASKRALYLDILRAVWLSAANELSRFVENGSGGPEAVIAAYLDAMMHD
FT                   AMGAQILVREYLDGAPYLSQLTTAEPALLDPLRRAAAVIAEGTDGGVDPVLAVVTVGGL
FT                   AALVASSREAMLPMVGQQLAPEAWRAHVLHVLANGLAPRAGGPRG"
FT   gene            165455..166711
FT                   /locus_tag="Adeh_0141"
FT   CDS_pept        165455..166711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0141"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79918"
FT                   /db_xref="GOA:Q2IM85"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79918.1"
FT                   /translation="MYRRPMTPGPRTILHLDLDAFYASVEQLDHPELRGRPVIVGGTGN
FT                   RGVVCAASYEARRFGVRSALPTARARRLCPDGVFLPPRFGRYSELSRRVFDVYRRYTPL
FT                   VEPLSLDEAFLDVTASRALHGGGPDIARAIKAAVRGECGLAVSAGVADVKMAAKIATDL
FT                   GKPDGLVVVPPGGVAAFLAPLPVGRLWGVGEVTEAALRRIGVATIGDLARMPESALAAA
FT                   LGPTHARGLRALACGEDPREVVPDEEAKSVGAEDTFDQDLLGRPALERELLAQAGTVAR
FT                   RLRAAGLAGHVVTLKVKYADFTLVTRRVTLERATDDDRAIFDAACAQLARVDLRRPVRL
FT                   TGISVSGFAGDEERGQLGLFGGAPAPPPPEASRRKALNAALDALAGRFGEGAVTRADLA
FT                   GRPPRRRHGDPEDGGDPEG"
FT   gene            166757..167617
FT                   /locus_tag="Adeh_0142"
FT   CDS_pept        166757..167617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79919"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79919.1"
FT                   /translation="MGAGTRPGEDLAIRERSQGELDARATALRALARSGVPFLVAGAYA
FT                   FFEYTGIFRDTKDLDLFLREQDLDAAFRVLEDAGFRTEITDSGWIGKAWQGEWFVDLIF
FT                   SSGNGVAVVDDLWFTHARPGRVMDVEVLLAPPEEMIWSKSFVLERERYDGADVNHLLHA
FT                   CGAGMDWDRLLRRFDRYWEVLFSHLLLFQFAYPGARSIVPDRVIEELVGRTLENLRSGD
FT                   HPVAMCRGSLMSRVQYVHDVERLGLHDGRRWDEAERGPAGRAGHGGAAGADAAGGADVS
FT                   PGGGG"
FT   gene            167553..168305
FT                   /locus_tag="Adeh_0143"
FT   CDS_pept        167553..168305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0143"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79920"
FT                   /db_xref="GOA:Q2IM91"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79920.1"
FT                   /translation="MAEQQAQTQQAERTFRLAAAADLHCRSDQHGRFRELVRMVNGEAE
FT                   GLVIAGDLTDHGTLDEAKTLAEVLSQLRVPCAAVLGNHDYEGGVVRDICRVLTEAKVTL
FT                   LDGDHAVFDRRIGIAGVKGFAGGFERGMLQAFGEPAIKAFVQESVNEALKLEAALAQLE
FT                   IPKKVVVMHYAPVFETTEGEDLQLRPFLGSSRLIGPCEAFGARAVFHGHSHHGTLEART
FT                   PKGVPVYNVAMPLLRKLMDDRRFRVFEV"
FT   gene            complement(168414..168794)
FT                   /locus_tag="Adeh_0144"
FT   CDS_pept        complement(168414..168794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0144"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79921"
FT                   /db_xref="GOA:Q2IM90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79921.1"
FT                   /translation="MTPGQYILVVDDDDDFREALSEVLVDAGYPVQQAENGEVALAKVD
FT                   EEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAVPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPMRH"
FT   gene            complement(168791..169756)
FT                   /locus_tag="Adeh_0145"
FT   CDS_pept        complement(168791..169756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0145"
FT                   /product="phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79922"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79922.1"
FT                   /translation="MQLELLYHGNCFDGCASAALFGRWFQEREGARLAGVRYRPVQHQQ
FT                   GDAFPADAFGADVNACVDFRYSPRLDWWFDHHASAFPTPADREAFERDGTGQKFWDPKA
FT                   PSCTGFIARTLADRFGWRAPELDELVRWADVIDAARFESAAVAVRLEAPALRIMTLLEA
FT                   TKDPSVPTRLIGAMQRMPLAEIAAQAWVAAPLEPILERHRGTVDVVRRNARVRDGVVEI
FT                   DLGETGIEAANKFIAYDLFPEARYTVVVSKDPKRTKVSVGSNPWAREKRTHDISKLCER
FT                   YGGGGHPVVGAVSLAPDRLADARRIAAEIASALRGEPNAP"
FT   gene            170065..171030
FT                   /locus_tag="Adeh_0146"
FT   CDS_pept        170065..171030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0146"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79923"
FT                   /db_xref="GOA:Q2IM88"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79923.1"
FT                   /translation="MDAIRVGALLDDTKFDLRLTLVAGKQGLSRRISSSRIQKPGLVLA
FT                   GFTEYLHKERVQVFGNTEMSYLATLPRERSVEVLRSFFAQDVSCLVVTKGLQPPPEMTA
FT                   AADEAGVPLLRTSHLSSNFIESVQNCLEDVLTAQTSMHGVLLDVFGVGILLLGKSGIGK
FT                   SEIALDLIMRGHRLVADDIVDVKRKTPESVFGAGSEIIKHHMEIRGLGIINIKDLFGVA
FT                   AIRERKKIEIVLELVEWDPNVEYDRLGVEERKFRILDVEIPMLVVPVRPGRNMTTIVEV
FT                   AARNHLLKLQGHHSAREFQERLNRAIALAPGGRVGEIDVE"
FT   gene            171027..171911
FT                   /locus_tag="Adeh_0147"
FT   CDS_pept        171027..171911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0147"
FT                   /product="uncharacterized P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79924"
FT                   /db_xref="GOA:Q2IM96"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79924.1"
FT                   /translation="MTATVSHAGPQVVILTGVSGSGKSTALRALEDAGFYCVDNLPIVF
FT                   LEKLLELSGHTAGEVSRMALVVDAREGRFLVEAPRVIRELRQKGADVEVLFLDASDEAL
FT                   VRRYSETRRRHPLAGEGGTVPDGIAAERLALADVRGIADEVIDTTTLNVHELKRLVTRR
FT                   FVAGDGAKLGVTLVSFGFRFGIPTHADLVLDVRFLPNPFFVPELKPHPGTDPRVAEFVL
FT                   GQADAKAFLERLVDLLGFLLPRYRNEGKSYLTIAIGCTGGKHRSVALAAALAERLEGSG
FT                   QPVRLWHRDVEKE"
FT   gene            172022..172438
FT                   /locus_tag="Adeh_0148"
FT   CDS_pept        172022..172438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0148"
FT                   /product="phosphotransferase system, fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79925"
FT                   /db_xref="GOA:Q2IM95"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79925.1"
FT                   /translation="MVGLVVATHGRLAEELLLTAEGIVGRLERCEAVSIVAGASMDEAR
FT                   EHIAAAVKRVDQGEGVLVLTDMFGGTPANLALTFLGDKLEVVTGVNLPMIMKLATARGE
FT                   GVSLHSVAELVTAYGQKNITLASELLRTRARSRT"
FT   gene            172482..172976
FT                   /locus_tag="Adeh_0149"
FT   CDS_pept        172482..172976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0149"
FT                   /product="phosphotransferase system, sorbose subfamily IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79926"
FT                   /db_xref="GOA:Q2IM94"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79926.1"
FT                   /translation="MIPLVRVDNRLLHGQILETWVPRLRIDQVMVADDEAAASSLAQAA
FT                   MTLCVPPELPVRIRRVAEVDYAGLASGGAKVLVLVRDVAGLAAARAAGLTAALAPKVNL
FT                   GNLHFGPGRRLVTPSVFVSEEDLSLLRGLAAEGFDVEARAIPSESPTGLAEIERRYAAG
FT                   H"
FT   gene            172993..173688
FT                   /locus_tag="Adeh_0150"
FT   CDS_pept        172993..173688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79927"
FT                   /db_xref="GOA:Q2IM93"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79927.1"
FT                   /translation="MGLLFLGLVAGLAAVERKGFLQAMLSRPIALAPVAGWVLGDAAGG
FT                   LVVAAPLELLWLGAVNLGAAVPVHEALGAAAIAGGAVLAGRAVGSGVTPEVAVLAVLLA
FT                   APVALVGRRADKAVEGWNERLARHAEAALASHRVAEAARSNLYGLAAPFAIAAVLAPLS
FT                   AWLAEALIPRLLAAVPGAAAPLRVGYFAFAALACAAGAKALRSRAAPRLFFAAFAAAFA
FT                   ALLTWRLLG"
FT   gene            173685..174452
FT                   /locus_tag="Adeh_0151"
FT   CDS_pept        173685..174452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0151"
FT                   /product="PTS system IID component, Man family"
FT                   /note="TC 4.A.6"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79928"
FT                   /db_xref="GOA:Q2IM92"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79928.1"
FT                   /translation="MSARVPRATLVRVFWRCLFLQAAWNRRGMQNLGFAFAIDPALRAL
FT                   YPEPARREEALARHLGFFNCHPYMAAAIVGGAIHHEERVAAGLEPGQGPLAYKATLQGP
FT                   LAAVGDGFFWTALRPFFGALAVVGALLLGVPALVAALVVYNAIHLALRIGLFRAGYLRG
FT                   DALVGTIAHLNLPVVADRLRAGGAALCGVAGAVFLMRGAAAGGPPAAALAAAAAAGGYA
FT                   ALARGARLLPTAYVATLAGVGAALLLGHLHGSS"
FT   gene            174455..174727
FT                   /locus_tag="Adeh_0152"
FT   CDS_pept        174455..174727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0152"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79929"
FT                   /db_xref="GOA:Q2IMA0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79929.1"
FT                   /translation="MPHQERTFVIVNTLGLHARAAAQLVQTSNRYKSEIHVEKDGMQVN
FT                   GKSIMGVLTLAAAKGSQITVTCDGDDADQAMTALAKVIENGFGET"
FT   gene            174724..176523
FT                   /locus_tag="Adeh_0153"
FT   CDS_pept        174724..176523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0153"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79930"
FT                   /db_xref="GOA:Q2IM99"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79930.1"
FT                   /translation="MSRSSATTLVGIGASPGIAIGRCWTIERRRVRTPKRRLTPEEVEG
FT                   ELARLRTSLEISDVQLAEVRGKVEEAQVPGSAEHTAIIDMHRMMLKDEMLVLEAQRQIR
FT                   EERLNAEWAVKRATRKIKNAFHEQADDYFKERRADVDFVGERIIKNLLGQAPDVEDVPP
FT                   EGVIVVAHDLSPADTALLLHEHKVAAFVTDAGAKTSHTAIVARALEVPAVVGVGRVTAV
FT                   AERGDWIVVDGARGLVVINPSPGERAGYEAAREKQLAGEQALLATRDLPARTLDDLTVR
FT                   LAGNIEFAEEVPSLLAHGGEAVGLYRTEFLFMGRSDLPGEEEHYQNYRRILEALAPRPV
FT                   TIRTFDLGGDKLPAGMRVTAENPALGLRAIRYCLRQPDMFRAQLRALLRASVHGNLRVM
FT                   FPMISGVAELRAAKHALRQAADELRAEGVPFRQVPVGIMVELPSAAMIADRLAAECDFF
FT                   SIGTNDLIQYTIGIDRQDKDVAYLYKPLHLAVLRLLKLICDAGRAAGVPVSMCGEMAGE
FT                   PVNALVLLGLGVSELSMNGPSIPLVKRVVRAARAEEGRALVDRLLALTTADDIEHEVQA
FT                   EMARRFPGLLDGDDEGPEPAGQG"
FT   gene            176681..177853
FT                   /locus_tag="Adeh_0154"
FT   CDS_pept        176681..177853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0154"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79931"
FT                   /db_xref="GOA:Q2IM98"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79931.1"
FT                   /translation="MPLQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACE
FT                   TLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPD
FT                   IGQGVDTGGAGDQGMMFGYACDETPELMPAPIQYAHAVTKQLAKARRAGLDLLRPDGKS
FT                   QVSVEYRDGRPARIDTVVVSTQHAESVSNKRLHEAVREQVIAKALPKRLVDRKTRILIN
FT                   PTGRFVIGGPMGDTGVTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMGRYIAKN
FT                   VVAAGLAARCEVQVAYAIGVAEPVSVMVDTFGTAKVPEGKIARAVREVFGLTPRAIIEG
FT                   LDLLRPVYEKTAAYGHFGRTEKTFTWERTDKKDALADAAGLSKIRAVAGV"
FT   gene            177991..178971
FT                   /locus_tag="Adeh_0155"
FT   CDS_pept        177991..178971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0155"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79932"
FT                   /db_xref="GOA:Q2IM97"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79932.1"
FT                   /translation="MPRPAPARPAAPSRRPEALLGWLELLSDPIRLRALRALEPRELSV
FT                   LELREVLALPQSTVSRHLKTLSDAGWLSARREGTQSLYGWAAELDPGARKLWQLARAES
FT                   DGWAVVRADAARLRAVRARRDEAQRFFAGAAGAWDGLRARVYGRGVAAEALLALVPPAW
FT                   TVADLGCGTGAVAAELAPRVRRVIAVDRSAAMLRAARRRTARFDNVELHEADLADLPLE
FT                   DGGCDAALLVLVLAYLDDPAPALAEAVRVLRPGGRLVVLDAARHQDEALRRRMGQAHPG
FT                   FEPDALAALVRRAGAAGVTARTLPPEPGARGPGLVACTGERPART"
FT   gene            179021..180496
FT                   /locus_tag="Adeh_0156"
FT   CDS_pept        179021..180496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0156"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79933"
FT                   /db_xref="GOA:Q2IMA1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79933.1"
FT                   /translation="MAVSAAKKKPAPSAPAPFEHKVKDLSLAGWGRKEIELAEKEMPGL
FT                   MAVRREYARQRPLAGQRITGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAA
FT                   VVVGRDGTPEAPRGVPVFAWKGETLEEYWDCTERALDFGGGKGPTQIVDDGGDATLLIH
FT                   KGAEYEKAGKVPPPSSAGSEELEVVLRLLAREQKKDARRWTRVAKACAGVTEETTTGVH
FT                   RLYEMQKAGTLLFPAINVNDSVTKSKFDNLYGCRHSLVDGLNRAADVMLAGKLCVVCGY
FT                   GDVGKGCAQALRGQGARVVVTEIDPINALQASMEGYQVVRLEDVVEHADVFVTATGNLD
FT                   VVTVEHMKAMKDCAIVGNIGHFDNEIDMAGLRKAATRVNIKPQYDAFVFPDGHRVLVLA
FT                   EGRLLNLGCATGHPSFVMSNSFTNQTLAQIELAVNRAAYAKQVYVLPKHLDEKVAALHL
FT                   EQIGARLTKLSKKQAAYIGVPQSGPFKPEHYRY"
FT   gene            180510..181388
FT                   /locus_tag="Adeh_0157"
FT   CDS_pept        180510..181388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0157"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79934"
FT                   /db_xref="GOA:Q2IMA5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79934.1"
FT                   /translation="MSLVSAALFGLVQALTEFLPVSSTAHLLVFGELLGHSLDDRRFRA
FT                   FVTIIQAGTTLAVLIYFRADIARLVAASTRGLVRGKPLGTPEARLGWYILLGTLPAALA
FT                   GKLLERRIEALGNWVIAGSLVGLGLVLLAAERLASHRRRVEDVGPGDALLIGVAQALAL
FT                   VPGSSRSGTTITGGMLLGFTREAAARFSFLLSVPITLAAGAYKLWSTVPDLRGEVAWTV
FT                   ATVVGTVVSAVAGYLVIDWLLAWLRTRTTYVFVVWRIAAGAAIAALILSGVLPAGAEAP
FT                   PPPPPALHAAP"
FT   gene            181385..181975
FT                   /locus_tag="Adeh_0158"
FT   CDS_pept        181385..181975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0158"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79935"
FT                   /db_xref="GOA:Q2IMA4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79935.1"
FT                   /translation="MTLDDLAAALVARAPGVAPVDRIAHEHLPRGGFAAAAVLVPLHVV
FT                   HGEVHVLMIRRPMKMSRHAGQIAFPGGKIDPGEESLAAALREAHEEVGLEPARADVMGQ
FT                   LSETLVLASAFRLTPWVASVPYPYPYAAAPHEVDEILHVPLSALSRPGAHRVEWREVYG
FT                   LRLDVHFFSFGKDVIWGATGRVLAELLSIWRAS"
FT   gene            181972..183060
FT                   /locus_tag="Adeh_0159"
FT   CDS_pept        181972..183060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0159"
FT                   /product="mannose-6-phosphate isomerase, type 2 /
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79936"
FT                   /db_xref="GOA:Q2IMA3"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79936.1"
FT                   /translation="MKIYPVIMAGGSGTRFWPLSRRNRPKQFLALAGDAPLLAATVGRL
FT                   PPLARPKDTFVVCGPKHAAAARRMVAQLPKENFIVEPCARNTAPCVGLAAIHVAAKDPK
FT                   GVIAMLPADHHIGRPEAFRDAVAAAAQLAEAGSIATIGIRPSRPETGYGYLKLGPRLAV
FT                   RAKGRKRLVAHKVERFVEKPDVVTAARYLADGSYLWNSGIFVFRADVILDEIRRAMPVL
FT                   GEQLEAIRRTLGTPAYARTLKRVFPDCPSISIDYGVMEKSARISVVPAEFGWSDVGSFA
FT                   ALSDVRVTDDLGNVAEGDALVIDGRNNVVLAGKDRPIALIGLDDVIVVDSGDALLVCRR
FT                   DRAQDVRKAVEELGRRGREELL"
FT   gene            183230..184600
FT                   /locus_tag="Adeh_0160"
FT   CDS_pept        183230..184600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0160"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79937"
FT                   /db_xref="GOA:Q2IMA2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79937.1"
FT                   /translation="MAKLSPTIFREYDIRGLVDQDLTEEAVSLVGKALGTRIRGAGGKR
FT                   AAVGWDARLSGPKFAKAMIEALTSTGVDVVSLGVVPTPLTYFAAHTLDVDGICMITGSH
FT                   NPPEYNGLKVGLGSATYYGEEIQALRREAEAGRFATGQGTVRAHDIVTPYREHVRQNLR
FT                   LGKRRLKVVVDAGNGTGGVVAVPLFEALGFEVIPLFIEMDGNFPNHHPDPTVEKNLEHL
FT                   RRKVLETAADVGIAYDGDADRVGAVDEKGNVLWGDQIMILFSRALLAEEPGAAIVGEVK
FT                   CSFTLYDDIAARGGRGIMWKAGHSLIKAKMKEEHALLAGEMSGHIFFAHRWFGFDDGIY
FT                   SSARLLELLTHTDRPMSALLADVPRTFSTPELRVDCPEDRKFEVVRRAQEFFAARYEAV
FT                   TVDGVRVVFPDGWGLVRASNTQPLLVLRFEAKTEARLAEIQALVRGKVDELLRELGA"
FT   gene            184604..185566
FT                   /locus_tag="Adeh_0161"
FT   CDS_pept        184604..185566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0161"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79938"
FT                   /db_xref="GOA:Q2IMA9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79938.1"
FT                   /translation="MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLHERGPEAVVA
FT                   TVVHALGQAAGAAGIAPASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGALLEKAL
FT                   GVPVRVANDLSVAAWGEKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGEL
FT                   GHIKVRLPRPGFTPRRCGCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELAEGDLA
FT                   RVTASVVEEAHALGDAYAVALWDEVSELLGLAVANLVTLLNPARLILGGGVLLGAPRLA
FT                   ALTLRRFDDAVSRSATRGLTVERAWLGDDAGVIGAAVLE"
FT   gene            186114..187604
FT                   /locus_tag="Adeh_0162"
FT   CDS_pept        186114..187604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79939"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79939.1"
FT                   /translation="MSLTARELAQVVAELAPLAGAYVEAVRAHAERALTLSLRGRAGDA
FT                   LLLLSAEPDVTRLHAARRRPPQPDAPYAVQAVLRRELEGARLAGLETLPGDRVVALSFE
FT                   RAPARGGPVRLVAELTGRHGNLFLVDAAGIIRAAAARNLSQRRDLAVGRPYQPPSLPPA
FT                   GPGSDAGQGAPRFAPVPGTPFPLSAAIEDAYLAREEERRLAEGRRRLREPVRAALARAG
FT                   RALAKLADEAARVPAAEADRRAADLLKTHLRAVRRGATEVAVTEWTEEGPREVRVAVDP
FT                   ALTPQANLERYYRRYRRIVESAARVEARAAEVRAREAALRALLGRIDAAGAADLPRLER
FT                   EARRLAAGPRPAAPPRRKRDEPALPYRTFRSLSGATILVGRGAAENDALTLRVARGNDL
FT                   WLHARGLPGAHVVVRLDKAKAPDAETLVDAAHLAVHFSDARGAPQADVAYTRARFVKKP
FT                   KGSAPGAVTYSQEKVLLLRTEPGRVERLLAEEEGGQGG"
FT   gene            187725..188468
FT                   /locus_tag="Adeh_0163"
FT   CDS_pept        187725..188468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79940"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79940.1"
FT                   /translation="MRPKESSRQLTLFSPEARRSAAHLLADALSGILTERVRLTVHDNR
FT                   STMVSFRRRPGEIHYRVHHMFLEAPDDVVSALASFAVAGRGAAAARRRQAGSRIDAFVK
FT                   EHRARIAAPRADRLQPRGRVHDLQALFDRLNAEHFGGAIEARIGWGPVRLGRRRRTVKT
FT                   GVYVQDARLIRIHPTLDRPEVPEFYVAAVVFHEMLHQAVPAVEVNGRRVVHGAAFRRRE
FT                   RAYPDHARAKAWEDRNLGLLLSSPA"
FT   gene            188646..190619
FT                   /locus_tag="Adeh_0164"
FT   CDS_pept        188646..190619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0164"
FT                   /product="Surface antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79941"
FT                   /db_xref="GOA:Q2IMA6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79941.1"
FT                   /translation="MAARAKPGEEPVLYGLEIQGTHALDAGDIASKLATQPSDRWAWQE
FT                   ARRLDADALAVDRKRVEAYYRERGFYDAKVVDVQVRPDGPGRAKVVMRVEEGEPILVRS
FT                   VEVTGLDAAPEAKARVGALPIRSGERFTERAYDGARGALLHALRNTGWADAAVTQRAQI
FT                   LPAEHAAEVRYEVTPGTRYRFGPVFVAGTAAVPRDRVREQAGIEIHPGDWFADDQLAKA
FT                   QARVFDLGVFGAVRVTRGAPDAQRGVVPIVVAVREVPFRTLRAGPGVGVQANTRWDVNG
FT                   TVGWTHRNFMGDLRKLQLELRAGYAWLVARPRKEGPIALATAEFSQPGAISRRIDATAR
FT                   LEIERGLEQAYDFWSERLRVGFPFRLARRLTLVPSWNLEVYQLENAVSTFDPTQPAKQG
FT                   PELQNCQGSVCLLSYLEQRVGWDGRNDPLNPRRGVWVMLAVQEGFNVGGYGYRYLRFLP
FT                   EARGFVPLGQKLVLAARARVGALVPVNQSGEPPIVARFTAGGPQSMRGYYTGRLAPMVL
FT                   RDGDWVPVGGNGLADGSLELRLDLTRTWGAALFVDAGNVSRPSGVPTAYRDVLDPTRLQ
FT                   WAGGLGLRYRTPFGPVRFDVGVQLPTNLAAGVPFDQRFPAVPSVENAGAPIYDKAGNVV
FT                   GTVPATHREPWIAFHLSIGEAF"
FT   gene            190619..195133
FT                   /locus_tag="Adeh_0165"
FT   CDS_pept        190619..195133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0165"
FT                   /product="protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79942"
FT                   /db_xref="GOA:Q2IMB0"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79942.1"
FT                   /translation="MRPAAAVGAVLGAVGWLLLGLAALAGVALSAAVLFASWGAGRPLV
FT                   ANALVRIADDALAGSFQLDEITVLPQGGIELHGLRVFDPEGRLVLEVGRAAVFADATRL
FT                   RNRVIGLTAELDRPSVLVEEGEGGLSIARAFAPAHPSPPRPPGAPEPRREDGAGWTLRV
FT                   QRLTLRGGDLWWVDGEGATRLEAQALDLDARGVVGPRRARVQLRLRGQADLPVAGALAL
FT                   DVRLARDGDVLRVSVLRARHGDTVLEAVGEGDLARRSGRVAITRLGVDSEKLRALAPGV
FT                   ALGGDLAASGYAESDGAVATAAVHVAPRAGEARGGGDAAAAVRLDGSRALGAEVALDAL
FT                   DPSRIWSGLPRGAVTLRARGGVAGEDLDDLRGRAQVSLARSTLRGGELGPGELTARADR
FT                   GSWEVQRLTLQAPGVAVLGSGRWRAGAGVSGRVSADAADLARLAANAERLVGQALPPLA
FT                   GRARVEATLSGTSRAPVLDGTVEAPHLALGSFALAGAKGVGHVAGPFRAVTGRLHLTAD
FT                   RVRSGGAELARALLLDAELAAADARLDASADVPALGREPVAVQARAVRTERGDEVILRE
FT                   LAVAYPGTRYALTAPARLFLTGPRVDRLELASGAQRIRLEGGIGARGALDARAEVEALR
FT                   LEGLPVGLLPRGAGLAGLVAAQASVSGTTRRPVAQGHLTLAEGRFRGLDGLSAVAEVGW
FT                   DGGARRARIELSAARAAGGTADVRLELPLPMQGRPGEPVAARLRGEALPLGPILHAAGA
FT                   ALPASGEVSLDATLEGAIGAPSLRAEASLTGGAWDDLSAIGLGLTADAPGERLSARLEA
FT                   TLEGRPAVSVRGEVPLDLSELLTRPAAALRALRAGRAAVDARVPGLELAALAGRLGLPD
FT                   ELAGRLSGDARLEGTLAAPRGRAAFQVEGGAWGGASGLGVALEADAGAQRVGATVRLAM
FT                   GGEELLRGEGSLGAAPERLLARGGLRSAPLSVSLVVPHASLARTSTSALLVEGTVDARL
FT                   TAEGTLAAPRLALEAEGRGLQVEGRPLGDATAQARWAEGRGSGRVTLAAKAGGTLEATA
FT                   SVGAPLGLDTRAADLRRAPAELALRARDLDLGFLPAVLPGWVRTASGKLQADVTARGPL
FT                   ERPSPRGTVRLADGRLAVSEYGDWTQIEVDATVTDDAVEIRRVAARRAHGSFEAHGALR
FT                   GMGGPDARLEGRIVSRELPIMHAGMDLATLDLQVDATGAYQPGALQVKLTVPRGTIRLP
FT                   KRAPRTLQSLERRRDIVVGRQPAPKKGPLPVPRGPGERPFTLTAQLVVPGRLMVVSDNP
FT                   RIRVELKANVTYELTGANDFATGTVEVVRGEVEPIGGRNFQIERGKVTFTGGPPKAALL
FT                   DVEAVYDNPVAKVTVAVAGPISDPEIRLSSQPPMDDGQIALLIATGRTELKPGSGGVGT
FT                   LTGEEAGRAALGAVATQAFKNLVADKLPLDTVAVDAGALRAGKYVTDKMYVGYTRRFDV
FT                   QLEQGQNVNEVRVEYQITRRWTFESRYGDAQSGGASLIWSKDY"
FT   sig_peptide     190619..190711
FT                   /locus_tag="Adeh_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.617 at
FT                   residue 31"
FT   gene            complement(195111..196292)
FT                   /locus_tag="Adeh_0166"
FT   CDS_pept        complement(195111..196292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0166"
FT                   /product="integral membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79943"
FT                   /db_xref="GOA:Q2IMB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79943.1"
FT                   /translation="MTTRARLLTFGLAAAWLAIGYLNVARGASHAGAGYRFWSFQHHCY
FT                   SDVIALHGDRYLGGGRPLPYLEDRIEYPVLLGIALWLPSFVPGGALVHFTVTYALLALC
FT                   LFAALLALERLPGARPFWLGATPALVYYAGLNWDLLPIALLCAALLALARGRPGAGGAL
FT                   TALGTSAKLFPGVLAPPALLALAAEPSRAPLLRFGAGLAGALLAVNLPFALAAPEGWSW
FT                   FFRFNAGRGAENSIWDALGVGRGPWLEVLSTGPMLLAVALGCAAAWRAARAGGDARRAV
FT                   RLAVALALTAWIATNKIWSPQYALYGFLAGALAAAPTGLFLVLSAVSVADFHVAFEVRA
FT                   RRWDPWFRDHLFHPDGVVRSVLWLALAAWIARELWRCARAAPAAGTVSSPSTR"
FT   sig_peptide     complement(196197..196292)
FT                   /locus_tag="Adeh_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.675 at
FT                   residue 32"
FT   gene            196619..197281
FT                   /locus_tag="Adeh_0167"
FT   CDS_pept        196619..197281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0167"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79944"
FT                   /db_xref="GOA:Q2IMB2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79944.1"
FT                   /translation="MTPLQRLADALAALVSTTGPYAPGILFFATLVEYVFPPFPGDLLV
FT                   VLGAWYAVEGAISWPLTFVSVTAGGLAGAWLDHRVGAALGRRLDARAARHGALSVQARR
FT                   LERFEASYRRWGGWLLVANRFLPGVRAFIFIGAGASRIPLRRVLLLGGLSAALWNAVLL
FT                   AAGAFLAHNQEELIQLVHRYTRVAWAALAACALLWVLGIAWRRAARRRAAAAGEEEA"
FT   gene            197278..198258
FT                   /locus_tag="Adeh_0168"
FT   CDS_pept        197278..198258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0168"
FT                   /product="Transglutaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79945"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79945.1"
FT                   /translation="MIALAAAALLAALPAGEARYRVELSGEPVGAAELRVACAGARCRL
FT                   TFETWLRAPEEAGGAVRVRRVEAEVDREGRLAGAVRRTEDGAPRAASAAPGRVPASAAE
FT                   LAILASLAAGGGAAACLPAFDEEDGRTGLACAGPALPDGARALEVLGEREEVRAAPDGF
FT                   PAEVRLPDQGARFVRDAAAAPPARAPRLPVRVPGPAEADRARAFCGLAADPPAPAPPPA
FT                   AAPPAAPGPGDCRAQAAAWIAAARRAGLEARQAVGVAHDGEGFTWHAWAEVRGPAGWIA
FT                   VDPAFGEAPARGPRFTVARFTLGDPAARAEAGRRILACWGRGRVR"
FT   sig_peptide     197278..197331
FT                   /locus_tag="Adeh_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.610) with cleavage site probability 0.527 at
FT                   residue 18"
FT   gene            198326..198994
FT                   /locus_tag="Adeh_0169"
FT   CDS_pept        198326..198994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79946"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79946.1"
FT                   /translation="MSGRTVRRPARKAPPTIDRTATLALADRARARGRRRKAVALYQRV
FT                   LAQHPEDLAVHGKVAPLLAARGEREAALRSFRAAIDGHRRAGFVDRALAVLAQATEAFP
FT                   RDDGLWEEMGSLELSRGRRADAVAALVRGGRTLLAARALGPAERLLHAAGRLEPWHGEA
FT                   TLLLARAWARSGRRRDAIRLLEGLAQRTGGRTRAAARALALRLSPTPARLWRWLRPSTG
FT                   "
FT   gene            complement(199023..200171)
FT                   /locus_tag="Adeh_0170"
FT   CDS_pept        complement(199023..200171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0170"
FT                   /product="Glutamate carboxypeptidase"
FT                   /EC_number="3.4.17.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79947"
FT                   /db_xref="GOA:Q2IMB6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79947.1"
FT                   /translation="MAARIEDALTWLQGQRGAMEALLERLVAQNSFTQNRAGVEAVANV
FT                   VAGQLRTLAMDVELRPSHHYGPHVLFTGRAAGAPVFLLGHTDTVFPPGTFEGFRREGDR
FT                   ARGPGVFDMKGGLVVMLFGLAAAKRAGVLERVAVRGVLVSEEEVGSPESQPVIRAHAAG
FT                   AACALGFESGRPGDLVVTRRKGVASVRVEARGVAAHAGNEHEKGKSAIWSLARFVDRAQ
FT                   SLTDYARGLTVNVGTIAGGTTKNTVPDAASCEVDLRFETVADGQALREAVEAAARDAAI
FT                   PGTALEVTPGAWRDPLERTPASSALAKEYGDCQRECGLGQGEAPLAGGGSDACTTGAAG
FT                   IPTIDALGARGKAFHTLAEEVDLGSLVAKASALARFLARRAG"
FT   gene            200287..201351
FT                   /locus_tag="Adeh_0171"
FT   CDS_pept        200287..201351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0171"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79948"
FT                   /db_xref="GOA:Q2IMB5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79948.1"
FT                   /translation="MATGKRFKAAVIGGSGYGGAEMIRRLLVHPEVELVRVASIDFVGE
FT                   PLSAADPALEAVTDLTFEGIPPAEAAAGMDVVLLGLPHTVAASKVPELAALPGVKVVDM
FT                   SGDFRLKDAAAYQRWYKHVHPCPERLADFVYGLPELNRERIRGARFVASPGCFATTIEL
FT                   ALLPLARAGLLEGVVHVQGITGSSGSGVAPSAGTHHPVRAGNLKTYKPLEHQHVPEITE
FT                   TLAAAGARDLALRFVPVSAPLSRGILATAFVELPEAWTQDRLDRLYREAYAGEPFVRVP
FT                   RKRLPEVAAVSGSNYAEVGVAVGPALGGRRTVTLFGATDNLVKGGAGQAIQNMNLVLGL
FT                   DEKASLADPGPWPP"
FT   gene            201348..202160
FT                   /locus_tag="Adeh_0172"
FT   CDS_pept        201348..202160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0172"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79949"
FT                   /db_xref="GOA:Q2IMB4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79949.1"
FT                   /translation="MKTIVLKLGGEIVHSPELDLVARDLRTLVDGWNRVAIVHGGGPQA
FT                   TALQKRLGLETRMVAGRRYTDEATLEVMKYVVAGQLNVDLCARLLANGVMPVGLHGASG
FT                   HAVQATRRPPRVMQGAGPEPVDLGLVGDVVGFNLPLLGDLFERRYVPVLACLGCDDAGQ
FT                   ALNINGDTVASQLAGALRADALVLVTSTPGVLRDVKDPSSRIPRITRAEFERLVADGTI
FT                   SGGMIPKLEESFEVLRGGARSVVILGKLSPGDLVAAVLEPGSAGTVLE"
FT   gene            complement(202166..202699)
FT                   /locus_tag="Adeh_0173"
FT   CDS_pept        complement(202166..202699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79950.1"
FT                   /translation="MRRIALAALAVSLASGCASREALWRYREEGTFGDGAPPLHAEPIG
FT                   EGAEYRLVAASLGEADLSVERSVAAVGDAPVRVDLGRVRLRSASGEELPLVRACLLEAA
FT                   PRCTAGGASRGFVATLSPGEVVRFRADFGPVDGLGPDRAPNPEVLKLTLSEEGVYVGGR
FT                   LQPVTVVLERVPAR"
FT   sig_peptide     complement(202631..202699)
FT                   /locus_tag="Adeh_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.472 at
FT                   residue 23"
FT   gene            complement(202782..204647)
FT                   /locus_tag="Adeh_0174"
FT   CDS_pept        complement(202782..204647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0174"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79951"
FT                   /db_xref="GOA:Q2IMC1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79951.1"
FT                   /translation="MLLHPAGAPRGGPSGLRFPAFLWALLHVPVFLALYATSIGQAVQA
FT                   TPAPYRAWLWPTFLPQALLLALLAFALALPFSLAPRAYRFAVGAVAGLLTGGLAVDAKV
FT                   LQSVGFHLNGFFLRVMLQPNALRETGVPLSDVLLFLGGALALVAVDVLAGAWFVRRFAA
FT                   PARRTWPWALALLLLSAAERVYGGGLTYFAGSSVFAASTTLPLQVPIRMQGLARSIFGE
FT                   RTNDPFEGTNASKRLPAGVDPAELRFEPRPDVLFVVAESLPAEHLDARTMPRLWARAQG
FT                   GARFTRHYAAASSTNYTLFSLVYGLQAQKLEAVVGAGRQPTLFPALTHNGYQVKVSAAS
FT                   CVDWMDLQKTVFGGVSDLETWCDGNDPSTRDAQMLKSARAFAARADPARPVFLFLFFFG
FT                   THFNYFHEPEDQVFAPAWDGLGGLKATRAPGQEIENRARNAAHALDRALDAFLDDFART
FT                   RGREPLVVFTGDHGEEFRQKGHLGHGSAVTDEQIHVPAVWLGPGVPAGVRDTVTSHVDV
FT                   VPTLFSLLGERHAPSLYADGVSMFDAPEDRFVVSTVGWEPRYAAIGKDLKVTMYAGMGG
FT                   AQITDPDDRPLPDGPARMARQAGRILRALRGESEPAPRAAAAPAP"
FT   gene            complement(204660..205829)
FT                   /locus_tag="Adeh_0175"
FT   CDS_pept        complement(204660..205829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0175"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79952"
FT                   /db_xref="GOA:Q2IMC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79952.1"
FT                   /translation="MISSAASRGPVRPETVEPGRGDGQDGGAGEAGPGKETSLRRPRAA
FT                   SAAVRPEAWPALAMFGVCALLAAETALLAAIGLGAGDALLPGGDHEGVLFGASLAAAVL
FT                   GGALASMTLLRALRASRADRDGRAQAEAALRTRDEFLGLAAHELKTPLTALFLELGAAG
FT                   RDAARRGDEAARGHLSRADRAARRLAELVSRLLVDARAAAEPLALEEVDLGALANDAVD
FT                   ARRELFDRARCDVTVRAEGPVSGRWDRTRVDRALASLLANAAKYGQGRPIEVTVRAEGA
FT                   QARLSVRDHGIGIPPERRAAIFDRYARAVSARHYGGLGLGLWIARREALALGGTVTVES
FT                   RPGHGAEFTLRLPAGAVAPLRGLPRAAGGALARAPARALRWLAWRSRRC"
FT   gene            complement(206001..206921)
FT                   /locus_tag="Adeh_0176"
FT   CDS_pept        complement(206001..206921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79953.1"
FT                   /translation="MQRRARRQHLGERVRVGPPLGAVEHVEQAAVHRGLEAPVQRLQVE
FT                   RVGHQERHREPARGRLLAGPRDRGGRAVHAHDPLAERGEVERVLAGAAAHVERVADDLA
FT                   RLRQRHQLRLRAPDVPGRRALAVAIVERAALRVGHGILRRRRGRRAPLLVPRAARAQDR
FT                   PMPFEPAFMSRLEAFQAELAEVRAPADWIAFRARWFTDLPWPSRTPEALAAARGDGAPR
FT                   VVAGRTFRRAPLPDDLTPEARYAYFSALARGFAAMYPHDAPGAGGSAVRHHCPACEIFS
FT                   DEPGDPACPGCGRPLLAMRLAPPPR"
FT   gene            complement(207162..207959)
FT                   /locus_tag="Adeh_0177"
FT   CDS_pept        complement(207162..207959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79954"
FT                   /db_xref="GOA:Q2IMB8"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79954.1"
FT                   /translation="MTLRSLLRASFLLALVAAAPAARAGGFSTTNVQLLQGWNFDKAID
FT                   TSFAGKLKDGTKTTLTLNHFSTWEYGDNFAFFDLSRGRFETDDTQWTDAYVEWHPRLFV
FT                   NQLLGQKEPLFGVIRNWGFAGEVNQGAGFYAYMGGLGLDFAVPAGWVLGLNAYYRYDNF
FT                   NRHGWQVSPFWTVPFAVGKVPFLFTGFIDVNGLKDEGGFYTGSDNGVEIWSQPQLLVDA
FT                   LAPFGGKAGKLYVGVEWWLHYYSLGSFEETSSAPQAMVQWTVF"
FT   sig_peptide     complement(207885..207959)
FT                   /locus_tag="Adeh_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(208005..209051)
FT                   /locus_tag="Adeh_0178"
FT   CDS_pept        complement(208005..209051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0178"
FT                   /product="arginine succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79955"
FT                   /db_xref="GOA:Q2IMC6"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79955.1"
FT                   /translation="MLLLRDAQKTDLAGLSALAKVLNTVNLPDDERALSGIVDRSVRSF
FT                   AGKIRNPLERAYVFVAEEPRTRRIVGTSMIIAQHGTRESPCTFFDVSEREHYSSTIDRH
FT                   FKHQVLSIGYHFDGPTEIGGLVVHPGQRGGEARAGKQLAFVRFLYMAMFRDRFRERVLA
FT                   ELMPPLTKDGRSLFWEAFGKRFTDLDYQEADKKSRENKEFIQQLFPPSDVYATLFSPAV
FT                   RRLLGKVGPDTEPVRRMLEKIGFRYVDRIDPFDGGPHYEATLAEITLVRAYRRARLAPG
FT                   PLDAGLHGGEDCLIAVTRGEGRTRFRAVRAEARLDGTNVWIPERAREVLEARPGERAHV
FT                   VPFDGGAR"
FT   gene            209206..209655
FT                   /locus_tag="Adeh_0179"
FT   CDS_pept        209206..209655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0179"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79956"
FT                   /db_xref="GOA:Q2IMC5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79956.1"
FT                   /translation="MRAVVQRVSRAEVRVDGAVTGAVGRGLLVLLGVARDDGAQDARLL
FT                   ADKLAALRIFEDAAGKMNLAVAEVGGAVLVVSQFTLLGDARKGNRPGFSDAAPPEAANA
FT                   LYEAVCGMLREKGLRVETGVFRADMQVELVNDGPVTILLDSRRLF"
FT   gene            209673..210017
FT                   /locus_tag="Adeh_0180"
FT   CDS_pept        209673..210017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0180"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79957"
FT                   /db_xref="GOA:Q2IMC4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79957.1"
FT                   /translation="MSDCLFCKIARGELPAKLVHQDADTVAFVDVNPQAPTHLLVIPRK
FT                   HIPTVNDLSAEDEALMGKLYRVAAALAKERGVDGSGWRAVVNTHGDAGQTVFHVHLHLL
FT                   GGRRMAWPPG"
FT   gene            210849..211742
FT                   /locus_tag="Adeh_0181"
FT   CDS_pept        210849..211742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0181"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79958"
FT                   /db_xref="GOA:Q2IMC3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79958.1"
FT                   /translation="MPVVRPRRSALYLPGSNARAIEKARTLPADALILDLEDAVAPAAK
FT                   DAARAQVVAALAQGGFGRRERVVRVNGLGTPWGAADLAALARAGADAICLPKVERAAEV
FT                   HAAVQALAAGHAPAGLALWCMIETPRGVLAAGEIAGASPRVACLVAGTSDLVKDLGARH
FT                   TAGRAEVLTSLSLVLLAARAHGLAALDGVFLDLEDAAGLEAACRQGRDLGFDGKTLIHP
FT                   KQLEPANRAFAPDAEELGRARRVIAAHAEAEAAGLGVTVVDGRLVEALHVEAARRTVAL
FT                   AEAIAAGPGGAGPHAG"
FT   gene            211815..212168
FT                   /locus_tag="Adeh_0182"
FT   CDS_pept        211815..212168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0182"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79959"
FT                   /db_xref="GOA:Q2IMD0"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79959.1"
FT                   /translation="MRGLRGATQCSANTVEAIEDAVTELCRELTSRNQLEPQQIVWAIF
FT                   TVTHDLDADFPARAARVQGWNGVPMICSQEIPVPGSMPRVVRVLLHVDSDGPRNHVYLR
FT                   GAQALRPDLHVRP"
FT   gene            212197..213063
FT                   /locus_tag="Adeh_0183"
FT   CDS_pept        212197..213063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0183"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79960"
FT                   /db_xref="GOA:Q2IMC9"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79960.1"
FT                   /translation="MNVPTNRPLPALPGHLGVVGLGLMGASLARAARRVDRGVRITAVE
FT                   PRAEVRARALADGVADQVSAEPDAALAGCGVVVLCTPVATIEALLAPVSALLADGAVLT
FT                   DVGGAKERVVTLARERVRPGVAFVGAHPMFGGHGGYDGATAEKWSAGGTVAICTDGDAA
FT                   AVEKVAALHLALGAGVERCTAAEHDAAVAMVSHLPYLVASALSVAVREAGPLAMHLAGP
FT                   GLKDATRLAEFPFDIQGEVARRNAHLPEAARRLERHLARILAAIAESPESARSALEAAR
FT                   AAREELF"
FT   sig_peptide     212197..212292
FT                   /locus_tag="Adeh_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.606) with cleavage site probability 0.537 at
FT                   residue 32"
FT   gene            213060..214382
FT                   /locus_tag="Adeh_0184"
FT   CDS_pept        213060..214382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0184"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79961"
FT                   /db_xref="GOA:Q2IMC8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79961.1"
FT                   /translation="MSAAPTSGPLTCRRAGPLRGAIEVPGDKSISHRSLLFGALSTGET
FT                   RVTGLLDAEDVHSTRKAVEALGAIVREEGGEVVVTPPATLREPGDVIDCGNSGTSLRLL
FT                   TGVLSGVPGLSVLTGDASLRRRPVRRVIDPLRAMGANLSARDGDRLPPVVVRGGPLRGA
FT                   RQVLPVASAQVKSAILLAGLFAEGETTVVEPEKSRDHTERMLRGMGVPVKVSGLEVSVS
FT                   AARPAGGRVDVPGDISSAAFFLCGAAALPGSEVTVRNLGVNETRTGLLDVLRAMGADVW
FT                   LANLREVAGEPRADVTVRADRLEATEIRGATIPRLIDELPVVMVMATQARGRTVIRDAK
FT                   ELRVKESDRLAAMGETLARAGARIELYEDGCAIEGPTPLRGVEVRTRLDHRIAMSMAVA
FT                   QLFCGGEPVVLDDVACVATSFPSFFRLLDQVAARVSVGGAP"
FT   gene            214379..215215
FT                   /locus_tag="Adeh_0185"
FT   CDS_pept        214379..215215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0185"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79962"
FT                   /db_xref="GOA:Q2IMC7"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79962.1"
FT                   /translation="MITGRTALYGVVGHPVAHSRSPEMQNAAFAKLGVDAAYVALPVAP
FT                   ERIDEALRGAHALGFQGLNVTVPHKPRAASLCHALDPVATAVGAANTLRRTRDGWEGFN
FT                   TDAPACRTLLEAAGVARGARALLVGAGGAARAAAWALLQLGTELRVAARREEAAAELCR
FT                   DLAAAVPGADAATADFEDLEAEADAAAVVVNGTSVELPGHEGRLPPLRFRADQVVLDFV
FT                   YGDTELARAARAGGARLVTGEQVLVRQGALAFTIWTGLPAPEADMARALEAREGAR"
FT   gene            215212..216357
FT                   /locus_tag="Adeh_0186"
FT   CDS_pept        215212..216357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0186"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79963"
FT                   /db_xref="GOA:Q2IMD4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79963.1"
FT                   /translation="MTLRYLTAGESHGPALVAIAEGFPAGLPVDFEAVDRDLRRRQKGY
FT                   GRGGRMKIETDAAQFLAGLRGGVTTGAPIALAVWNKDHENWKDLVSPYARGGRKFTQVR
FT                   PGHADLAGALKYGLDDARDVLERASARSTAVIVALGALAKALLSSQGVEVCSRVVAIGP
FT                   RDIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLP
FT                   IGLGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWR
FT                   ETNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPA
FT                   AAVVGEAVVAWELANALLEKFGGDTVEDVRRAVEAYAARIR"
FT   gene            216338..216826
FT                   /locus_tag="Adeh_0187"
FT   CDS_pept        216338..216826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0187"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79964"
FT                   /db_xref="GOA:Q2IMD3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79964.1"
FT                   /translation="MPLGSAETLALTGMMGSGKSTVAPLLARWLGRPLVRLDDEIVRAA
FT                   GKPIARVFAEDGEGRFRALERAAVAALPAGAVADLGGGAFCDPHGAARLLATARVVFLD
FT                   VSAQEAARRIGDDPARPLAGRWEALLARRLPLYRRAHLTVHVDGLTPEAVARRVLESL"
FT   gene            216823..217992
FT                   /locus_tag="Adeh_0188"
FT   CDS_pept        216823..217992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0188"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79965"
FT                   /db_xref="GOA:Q2IMD2"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79965.1"
FT                   /translation="MSRSRKPHAALYEAEAEAGAAVTEVIAARQGDHAYEVRVGPGAAA
FT                   ALPALADEHDAVALVSCRRVLSTAFGKDVLARLRRETPLALVHALPDGEAGKTLAELER
FT                   AATRLLRAGGTRRTLVVALGGGAVSDAAGFLAATYMRGVPWVAVPTTLLAMVDAAIGGK
FT                   TAVNLPAAKNAVGAFHPPGAVLADPAALRTLPRRELSSGLGEVLKYGALQPALLDAFAA
FT                   LGAAAPDPAVIATCARMKVDVVADDPTEHGPRKLLNLGHTFGHGVEAAGRFSRYTHGEA
FT                   VAVGLAFAFRLAARMGRVDGAAAERVEAAVAGAGLPVRVPPAIARAAARLMAYDKKRAA
FT                   GGLRWVLPAAVEGGWRVEWDVEAEPAAVEAAVAEISEARAGGRAGRRAR"
FT   gene            217989..218459
FT                   /locus_tag="Adeh_0189"
FT   CDS_pept        217989..218459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0189"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79966"
FT                   /db_xref="GOA:Q2IMD1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79966.1"
FT                   /translation="MILIVNGPNLNLLGEREPDVYGRSTLADVEQLVRDACAAWDVEVK
FT                   AFQSNHEGAILDFLQEHRKKARGVILNAGALTHTSYALHDCLKAMPAPAVEVHISNIHQ
FT                   REAFRHVSVIAPACRGQIVGLGIRGYLLAAEWLCAEIGAQPRGSEDRKKPSP"
FT   gene            218470..219474
FT                   /locus_tag="Adeh_0190"
FT   CDS_pept        218470..219474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0190"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79967"
FT                   /db_xref="GOA:Q2IMD5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79967.1"
FT                   /translation="MPRVAVLLPARDAARTVRAAAASILRQTERDLSLVCVDDGSRDGT
FT                   AEVLERLAARDRRVRLLRGPGEGIARALQRGLAACDAEVVARMDADDVAHPRRLALQLA
FT                   ALHADPSLAALGGRVRLFPRAAVRPGMARYAAWLNGLVTPALVERDLLVEAPLVHPAAA
FT                   IRRDALERAGGWRDGPFPEDYDLWLRLAAGGGRLGNLAEPVLAWRESPGRLTRTDPRYA
FT                   LARHVALKCAHLARHVLRGAPEVALWGAGETGRAFSDALRAEGIATAVFVEVDRKKIGR
FT                   TVRGAPVVSYEEVGRLRGLPLLVAVGAPGARDLIRAELARAGLEELADYRCVA"
FT   gene            complement(219574..220050)
FT                   /locus_tag="Adeh_0191"
FT   CDS_pept        complement(219574..220050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0191"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79968"
FT                   /db_xref="GOA:Q2IMD9"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79968.1"
FT                   /translation="MKGDAKVLDVLNEVLTNELTAINQYFLHARVCENWGYDRLYAKFR
FT                   AESIDEMKDADHLIERILYLDGMPNVQKLAKINIGESVPEILAADLDLEKHAIGVLNRG
FT                   IETCRNAGDNGSADLLEDILEGEEEHANWLETQLTAIDQIGVQNYLTEQLKKDS"
FT   gene            complement(220176..220760)
FT                   /locus_tag="Adeh_0192"
FT   CDS_pept        complement(220176..220760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0192"
FT                   /product="BFD-like (2Fe-2S)-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79969"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79969.1"
FT                   /translation="MRRRPAGPGASPPGRLHSAPRLTGVMTAGRAHDSESHSQHHLRSP
FT                   GAPSPRSRPLLRHRRAGLRARLHALRRGGGHRPRPRRARRLRRVAERLRGARPAAAAVR
FT                   LLRRVPRRRGGSAAARMGAGVIVCLCFNVSDSLVRRRAAEGASLRQVIAETGAGTACRC
FT                   CVAALAKVHAGGAATAPACARARAAPRRDAA"
FT   gene            220799..221851
FT                   /locus_tag="Adeh_0193"
FT   CDS_pept        220799..221851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79970"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79970.1"
FT                   /translation="MTDSFDLGAFRRDLTRRTADAVHALRARIGSETLYGFALFTSGER
FT                   DFAWVRASANTEDALTRRAAAAAALDPRFRGEAGRRLLRWSAPDWEYHDFAPEVRGLAV
FT                   PPAEGRRPTLDPALYDAFVGALKAVDRAGLFGRGADRAFLTVNILCDHASPAFFRRGLR
FT                   ALNPVPTAERHLHETAAAPFVRCVNRAPRRERMRIWLALYEDLYMEWRTPIAEEARARG
FT                   LSPWDVEEELARFGRKVVPALVDLLAHYGFAAPIDHNRGFETREVWLAGSALFLVRRIG
FT                   MVAEAEIARLQRLVGDFAERDRRLRVASTLAENTARVLHELRPRRFPPSEMDPLTFKLT
FT                   NPEPFLLRRP"
FT   gene            221900..222718
FT                   /locus_tag="Adeh_0194"
FT   CDS_pept        221900..222718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79971"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79971.1"
FT                   /translation="MTDRSRRARPAAARPSPHDRHVLYERAVQHAGSELDLVDRVVRRG
FT                   GGTPRRLREDFSGTALLSAAWVRRGRDRSAVAVDLDASVHGWARAHRVPALGAAAARLR
FT                   LVEADVRDGPPGPFDAVIAFNFSYGVLQTRAALGGYLRSAAAALAPRGALLLDAYGGWD
FT                   AEKELTERRRIGGGVSYVWEQESFDPITRRVRCAIHFELPGGRRLRRAFTYDWRLWTIP
FT                   ELTELVGEAGLEPEVLWDVAPRGATRYLPRRSASNQGGWIAYVVGRPKRA"
FT   gene            complement(222715..223614)
FT                   /locus_tag="Adeh_0195"
FT   CDS_pept        complement(222715..223614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0195"
FT                   /product="Pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79972"
FT                   /db_xref="GOA:Q2IME3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79972.1"
FT                   /translation="MRRLTLLVPDVDRYERIDRFIAARGGISRGLARRAIEAGGVFVDG
FT                   RRCKVAGRTLTPGQQVVVNLEEGGRAASAPAALGRERLLYADADLCAVDKPAGVPAQPT
FT                   LTTDRGALPELVSALLGAPVTLVHRLDRETSGVTVFARTREAAAALAEAFRTGAPEKTY
FT                   LALCARAPSPAEGRVALALGKDPARPGLRRVDPAGDPAATRYRTLREAPGGAQVEARPE
FT                   TGRTHQIRVHLAALGAPLLGDARYGGPRRVGEVAVPRVMLHAARLELPHPVTGVRMVFE
FT                   AEPPDDFRAVEAALVPER"
FT   gene            complement(223637..223912)
FT                   /locus_tag="Adeh_0196"
FT   CDS_pept        complement(223637..223912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79973"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79973.1"
FT                   /translation="MPIYEYECPKCGRFDALQKMSDPALQVHEVCGSKVRKLMSASAFA
FT                   FKGSGFYITDYGGKSAAAITPDRKPESKPEPKSDACAGCPASKSAA"
FT   gene            224090..225463
FT                   /locus_tag="Adeh_0197"
FT   CDS_pept        224090..225463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79974"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79974.1"
FT                   /translation="MDAQERDRLAGEVDALAAGLEEARGRHAAGLDPEPSLAPRFAARS
FT                   EAAHRRTVDALRAAGEEALAARVAALRAERAAAGHEEAWRAAEAAARGRGPDGEAPLAA
FT                   LELAALRERDRGRRLALARAAAEALEPAAAHREAACEAAARARAEVGHAPDWRVVVEGD
FT                   QLLAASDDAWRDVLAYRARTALEPLPAGDLARADLLHLLALGRWDGLFRAGMLPVALKL
FT                   TLEPLGLDGRARVDAADRPAQWPGVHVHGARISFRPRGGAGDWQDLVEGMGRALGAAAA
FT                   PPHRRDPALGAALGWLLGSLLLEPRWLADRAGVERRQAADVVRDLALRRLLALRARAAA
FT                   LRVATEVERGLSGARWREAYVEAMEAATGARWEGVRAARDADAAAHAAALRGADAGERL
FT                   RRDLRERLDEDWWRNPRAAPLLAGLLAAGALPPEPGDTAPAPGDAARALVARLEGKPA"
FT   gene            complement(225549..225929)
FT                   /locus_tag="Adeh_0198"
FT   CDS_pept        complement(225549..225929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79975.1"
FT                   /translation="MDTPWAAPTMARMETKKKGTTAVVTEGSAQAALRRGPARELTPEE
FT                   ERVMRMRLGAAPPRGTPLERSAEGLSDLEIEVLSYEIEAYMKWREREHAGAAATAPARA
FT                   PAPAAPSRAKEKIIRALRKKGL"
FT   gene            226148..226600
FT                   /locus_tag="Adeh_0199"
FT   CDS_pept        226148..226600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0199"
FT                   /product="CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79976"
FT                   /db_xref="GOA:Q2IME7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79976.1"
FT                   /translation="MAEWRENLIERDEDIRKLLAPVRRVAVLGMKTEAQSDQAAFYVPR
FT                   YLKDAGVEVVPVPVYYPDAKAILGAPVYRSVAAIPGPVDLVDVFRRPADVPAHVDDLVA
FT                   KKPAVVWLQLGIRNDAAAEALARAGIRVVQDRCLMVEWRRLGPAGR"
FT   gene            complement(226974..227924)
FT                   /locus_tag="Adeh_0200"
FT   CDS_pept        complement(226974..227924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0200"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79977"
FT                   /db_xref="GOA:Q2IME6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79977.1"
FT                   /translation="MKAFVRFAWSVLAYNLAVVVWGAFVRATGSGAGCGKHWPMCNGEV
FT                   VPRAPALETVIEFTHRATSGVALLLVLGLVVAARRTFPAGHAARRAAWASLALVLVEAL
FT                   VGAGLVLFGWVAKDDSAARGWVVAIHLTNTFLLIGAIALTAALAGRPRGLALRGHAGLA
FT                   AALGVAAGALVLTGASGAIAALGDTLFPATSFAQGLRQELSEEAHVLLRLRVLHPFVAV
FT                   FSTVALGWAARAALRARPDADTRSASFAVLLLAGLQLFAGVLNVALLAPVWMQLVHLLV
FT                   ADLLWVALMVLAAAALAPPDAAPAGARPDEAPALG"
FT   gene            complement(227991..228680)
FT                   /locus_tag="Adeh_0201"
FT   CDS_pept        complement(227991..228680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79978.1"
FT                   /translation="MRTALAAGIALGVLASCRAVQTRQDFTPVSDADFGRLGPGQLGPV
FT                   EPARADAAAARDAVARAKLRLQEAKREQGYAEADRTAAEADLQRAATEAKGANSAGDTA
FT                   WKARAQELADTAGLHRQAAEAHLAFAKRLAEARQADLDAAEAHEVSAQARLEQAKLQAL
FT                   ASAGVPAAGKYDARRFEAHVAKAVADEREAQARAAEAGRAAVAAEDGWRTLQRQWEARA
FT                   QGRGGAG"
FT   sig_peptide     complement(228621..228680)
FT                   /locus_tag="Adeh_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.617 at
FT                   residue 20"
FT   gene            complement(228738..229724)
FT                   /locus_tag="Adeh_0202"
FT   CDS_pept        complement(228738..229724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79979.1"
FT                   /translation="MRGCPAMRRASLALCLAALACSRSDPEARARVLGREDRPHEPAAA
FT                   AFDPEHPEAALALDADEAARRLGAFDWTAAAEWTVSAPGEEARQVHVTEHHQLRQSATG
FT                   EFEVRAEIDPGLGAGSSGGKHVIWTGGATYARALPAPFRERPTDRGRDARRFRDESFRL
FT                   AGTVAALYGPALRLEPAGEARLLGRAARRYRLSLAPAAKPPAPQPPPPGAPAPDPDTAR
FT                   RLAFLQGRVPVAADGELLADAETGVPLRVRLSGAFEVPNAPGVKARLELLAEVKALGGA
FT                   VGPVAAPAGALPDERKPAGPSTALEAAGLKKRGEEPARPAEPADEGE"
FT   sig_peptide     complement(229650..229724)
FT                   /locus_tag="Adeh_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.619 at
FT                   residue 25"
FT   gene            complement(229750..231576)
FT                   /locus_tag="Adeh_0203"
FT   CDS_pept        complement(229750..231576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0203"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79980"
FT                   /db_xref="GOA:Q2IMF2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79980.1"
FT                   /translation="MQEVHGNTLGLKPSQLHALRRTYRRRVDAQSIVSPELARHLAEVS
FT                   RETNRQVGVLLDRKGDVQAVVVGDARKLDLPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGRVHYAHLLPENPQGAMWKDEEAPTVHELAYDA
FT                   LSGALALEDEFARARAARRTGGRERAILVGFGGKGRGRAEAEASLEELKELARTAGVEV
FT                   LEATLQLRRDPDPRYLIGKGKLEDIVLRSMQRMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEGLGADRTLRRKQRNARGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELGDA
FT                   DLLLHVVDASDPRQEEQIAAVEEILRGLGLDGKRRLLVLNKVDRLPPETQAALAQRRDA
FT                   AAVSAVTRAGLGGLLARCEQLLWTDGRVALGDVIAAAPAGEEGAGAAGHLAGDAAPEPL
FT                   APEPPAPAAASVPGPGEPGPPRLLPASLRRVS"
FT   gene            complement(231700..232230)
FT                   /locus_tag="Adeh_0204"
FT   CDS_pept        complement(231700..232230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79981"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79981.1"
FT                   /translation="MAPSRAGPPPPGRGWGAAGPAARKAPLWAARPCADRVGSRPPTAR
FT                   RRRRCVIMPSPRVCGSCGRTRIILGAASVAPSARRPGETAMEAAIALEANAISLDGVLD
FT                   VPTARRLAAQLAAAAPGSLVRIDLTHVRELHDFGLAVLAQALSARGIRASFRGLGQHQL
FT                   RLLRYLGLDAVAA"
FT   gene            232281..232571
FT                   /locus_tag="Adeh_0205"
FT   CDS_pept        232281..232571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79982"
FT                   /db_xref="GOA:Q2IMF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79982.1"
FT                   /translation="MNRFIVRRRADGVVHLRRRSLRHLLVDRIAWTMALLFVATAAGMT
FT                   ALVAALVEFPLVVILLAPVIGLGVWAGRLARGDGLQPAPAPVDPRPPRRVA"
FT   sig_peptide     232281..232430
FT                   /locus_tag="Adeh_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.754 at
FT                   residue 50"
FT   gene            232762..234009
FT                   /locus_tag="Adeh_0206"
FT   CDS_pept        232762..234009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0206"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79983"
FT                   /db_xref="GOA:Q2IME9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79983.1"
FT                   /translation="MDSPAQSARAGAGSVLNAAVVVAALGYFVDIYDLILFNIVRIPSL
FT                   TAIGVSGDALVSEGLSVLNWQMVGMLLGGIVFGIVGDKLGRLHILFGSITLYSIATIAN
FT                   GFVHDLATYKALRFVAGLGLAGELGAGVTLVAEILPARLRGYGTMLVASVGVSGAIVGN
FT                   VVAKTLDWRVAYWVGGGLGLLLLVLRIKVSESGMFQALRHTAVRRGDFLAVFRGGERFR
FT                   RYLSSILIGVPIWCSNAILIALAPEFGRTLGVTGPVTAGDAVMFFYGGLVLGDLSSGLL
FT                   SQVWRSRRKVVLLFVALLAAANVFYFVAGRGASPALFLGACGLLGVAGGYWAIFVTVAA
FT                   EQFGTNLRATVATTVPNFVRGLVPVCTLSFQWARPHLGLVGAAAAVSALWFGLALVSAF
FT                   GLRETFGVELDYVEAD"
FT   gene            234013..234531
FT                   /locus_tag="Adeh_0207"
FT   CDS_pept        234013..234531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79984"
FT                   /db_xref="GOA:Q2IME8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IME8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79984.1"
FT                   /translation="MSAYVVDVEADGPIPGKYSMVSFGAVRVEPGLSRTFRGEVRPISD
FT                   LWLPEALAISGVTREQHLRFGEPGEVMADFERWIQETTRGKPVLFSDNLSFDWQYVNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDGHAQWKHLRATAHDHDPVNDAKANAGVLLQLV
FT                   DMGLKLNLK"
FT   gene            234539..235147
FT                   /locus_tag="Adeh_0208"
FT   CDS_pept        234539..235147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0208"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79985"
FT                   /db_xref="GOA:Q2IMF6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79985.1"
FT                   /translation="MTLFAQGALLGLSAAAQPGPYQAYLLAQSLRNGAVRTLPVVLVPL
FT                   TSDPPVIAAVLVALAQVPAGLLRALQLLGGAVVLWLAFSALRGLRAPLAAPEAKAPPRG
FT                   FWRAVLLNFTNPNAWIFWSAVGGPVLAAAWRDGRAEAGGFLAGFYAFLLGGNAALVAAA
FT                   GGLGRLGPRTQRALTAISGLALLAFGLWQLAKGLAGPRA"
FT   sig_peptide     234539..234610
FT                   /locus_tag="Adeh_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.702 at
FT                   residue 24"
FT   gene            complement(235152..236021)
FT                   /locus_tag="Adeh_0209"
FT   CDS_pept        complement(235152..236021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0209"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79986"
FT                   /db_xref="GOA:Q2IMF5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79986.1"
FT                   /translation="MHRPSRTPLAALAALALAAACTGKQRVATETKLASVLIPTEQEKQ
FT                   LGLQVKEQLETKEHVQYLEDPAVNAYVQGITGKILASAKKDRPDVDWSVKVINDPKTVN
FT                   AFATPGGFLYVYSGLLLAADDTAEVAGVLGHEAGHVVARHSARQMVNAMGLETVLGIAL
FT                   GKNPNGAAQLAAGLAGKGALLAYGRADESEADEYGARYASAAGYDPHGIATFFQKLEKG
FT                   EGKQPGWTTYLSTHPATPDRIEKVERYIAEHHLTGSGGRGGAELAKVKERLKAIPPPPA
FT                   PPAQGAGK"
FT   sig_peptide     complement(235938..236021)
FT                   /locus_tag="Adeh_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.351 at
FT                   residue 28"
FT   gene            236084..236986
FT                   /locus_tag="Adeh_0210"
FT   CDS_pept        236084..236986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79987"
FT                   /db_xref="GOA:Q2IMF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79987.1"
FT                   /translation="MRREAWAAAAAGRPADPRFEARRSPAVQADGRSFTQGGGVTMSRT
FT                   RLAVLSTAFAVVAAGVFGLGFLRGAAEASAAPAPPPLSSEYPGGAPIDAARIQTGRLTF
FT                   DRMPAEVSGALELHSAEIVKQAEVLATKQARITGTCAPGSAIRVVAQDGTVVCQRFPRG
FT                   VVSVSSLAGVPRVSTTATTQLSVPGGVGRYQSGGEDDFLVLPVDLPDGAVVTGFSFVFW
FT                   DSDARIDGAAYLYRSDDTAMAALVTKDAAEEVRVVSTQDIAAQKVDNGAFAYFVYLQLS
FT                   AAAGPRLVPIAASVAYKLP"
FT   gene            237061..238200
FT                   /locus_tag="Adeh_0211"
FT   CDS_pept        237061..238200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0211"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79988"
FT                   /db_xref="GOA:Q2IMF3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79988.1"
FT                   /translation="MSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELAEVSR
FT                   GRKVVLVSSGAVALGAERLGLARSRGKPWDLPTKQACAAAGQPHLMAAWGEALGRHGLV
FT                   TAQVLLTADDLASRKRFLNARRTFERLLDAGAVPVVNENDTVAVDELKVGDNDTLAALV
FT                   AGCVEADAVAMLTDVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVGGMIT
FT                   KVKAARRLGAQGVVTALLSGRRARALPALLAGEPVGTVFAPGAHRLSSRQGWLAAAARG
FT                   KGVILVDAGARRALVEQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAGYAAD
FT                   EVRRIAGLKTGEIERALGYKYLDEIVHRNDLVVLETGRE"
FT   gene            238203..239486
FT                   /locus_tag="Adeh_0212"
FT   CDS_pept        238203..239486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0212"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79989"
FT                   /db_xref="GOA:Q2IMG0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79989.1"
FT                   /translation="MRKEKSLGLAAEMRKLAEASREAARALSHADPRRKDAALRAAAEA
FT                   IGRRERRILSENARDVAAARAAGQNAAYLDRLKLDPKRLAGIAASLREIAGLRDPVGEV
FT                   TASWRRPNGLEIRKVRIPLGVVLMVYEARPNVTVDAAALCLKSGNAAILRPGSDALRSS
FT                   LALAEAFAEGLEKAGLPAASAQVVPTPDREATYELLALDDLIDLAIPRGGPSLIRAVAE
FT                   RSRVPVLKHYQGVCHLYLDASAPPQQAVDLALNGKVQRPGVCNATECLLVHRAAAGKLL
FT                   PPVGRALADAGVELRCDPTALTILKRAGVAAVPARPDDFGKEFLDKILAVRVVADLDGA
FT                   LDHIARYGSLHTEAIVTRDLASARRFQREVDASAVMVNASTRFNDGGELGLGAEIGIST
FT                   TKLHAFGPMGLAELTTQKFLVEGEGHVR"
FT   gene            239776..240099
FT                   /locus_tag="Adeh_0213"
FT   CDS_pept        239776..240099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0213"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79990"
FT                   /db_xref="GOA:Q2IMF9"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79990.1"
FT                   /translation="MAIAAAALDKKAEDVTVLDVRGLTSYADYFVLMTADSDRQASAIA
FT                   DHVEQTMKAQGVTKVGVEGYQGGRWILVDYGDVVAHVMGREARGFYDLEGLWADAPRVA
FT                   VEA"
FT   gene            complement(240045..240860)
FT                   /locus_tag="Adeh_0214"
FT   CDS_pept        complement(240045..240860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0214"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79991"
FT                   /db_xref="GOA:Q2IMF8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79991.1"
FT                   /translation="MLRQALSYCSGLLARRPAAGDGFRDELAFWDRELSGRGPYAEDVR
FT                   RRSTPSLMPLVYPHYLEPLLEEVRARTGAPPRVLDAGSGPLSMWAHGAEQDRIALTCSD
FT                   ALADAYRELLARHGLRPRYPLVQCAGEALSARFGEAAFDVAWMHNALDHTQDPGAVVRE
FT                   LVRVLAPGGYLVVQGWCREGTAERFIGLHRHDLWVEPPGRLMLRTLSADGRRLSGPVAP
FT                   CDGLGLELLEASAPSRTPRTWMKLVWRKPAAGYASTATRGASAQSPSRS"
FT   sig_peptide     complement(240798..240860)
FT                   /locus_tag="Adeh_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.719) with cleavage site probability 0.542 at
FT                   residue 21"
FT   gene            complement(240984..242675)
FT                   /locus_tag="Adeh_0215"
FT   CDS_pept        complement(240984..242675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0215"
FT                   /product="Multiheme cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79992"
FT                   /db_xref="InterPro:IPR010176"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79992.1"
FT                   /translation="MRPRLVPHLPLAAALALCLAAGCDRARVAEGDATERCLRCHGGDG
FT                   SAAPPRSARGATATSDRGVGAHRAHVAGGRVAGPLRCEACHVVPTDLAHVDGVARVAFG
FT                   EEARRAGAAPAWEPDAAGGPRCAGTYCHGATLAAGGAATAPVWTRVDGTQLGCDGCHAS
FT                   PPTSAGHPQGELASRCTLCHPDTVLASGAIDVAGGHHLDGRVDVAGGACGGCHGAPPAS
FT                   GAHALHATVPAGASPAYGALTVLEDLSPDGGAAYAFGCGQCHPLDLARHMDGRVDVVLA
FT                   PEGAPAGTLKARNAAGAGYDAASGTCAGAYCHSSGQEVPAYADAPAWTAPPGALGCAGC
FT                   HGNPPAYPTGGPAAADANGHLGLSTDGYEWGHFGGLPGPWHTSKHGGGWSPDEDAAPIT
FT                   CQSCHAETTAGAGPSGFYWLDTTGTYALPGGLLGYGCSSAACHGGAAASGRGAVAPLRH
FT                   VNGRRDVAFDARAALPELPWLPPAPDRPTRPYWVTHASPGGIAFPDPAIPGAVMEGATL
FT                   SMELGSARYDPATKTCSSVACHLQQAQVTWGAPHTGWGTCGTCHGF"
FT   sig_peptide     complement(242595..242675)
FT                   /locus_tag="Adeh_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.641 at
FT                   residue 27"
FT   gene            complement(242781..243671)
FT                   /locus_tag="Adeh_0216"
FT   CDS_pept        complement(242781..243671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0216"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79993"
FT                   /db_xref="GOA:Q2IMG4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79993.1"
FT                   /translation="MRAAVRTRIVATYLAVAALWGSTWMAIRIGLEDLPPLRFAGVRMA
FT                   IAALVLAPFALRGGAWREVVGPARAQLALVAVLQIALPYGLMFVAQQWVPSGLAAVLFA
FT                   SFPVWIALLARALVPGETLTPARVASALLGIAGVAVLQLPHLGDLEGSGRLLLGGALVV
FT                   LSSMIVALANVLVRRHLAAVSPLAMTAGQTAVGAVLLLAAAALLEQGRPAAFTASAVAA
FT                   LAWLAVFGTALTYVGLYWLVPRVPMAAIGALPLLDTSVAVTLGALVLHEPVGWNLALGG
FT                   GMVLAAAALTIPRRR"
FT   gene            complement(243740..244801)
FT                   /locus_tag="Adeh_0217"
FT   CDS_pept        complement(243740..244801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0217"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79994"
FT                   /db_xref="GOA:Q2IMG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79994.1"
FT                   /translation="MVRKVGTSRIVREIGRGGMGVVYEAFQEGLERPVAVKALDQKLVR
FT                   SSEVVERFRREGRAYAQLRHEAIVAVHDLVEKDDQLYLVTDLVDGADLARVLAQGGALP
FT                   ADCVAVIGARLAEALDYVHWSGLLHRDVKPANVMISRLGEVKLMDFGIAKGAEDPSLTR
FT                   VGMLVGSPSYMAPEVLAGDEGGPAADVWALGVTLYELVCGEKPFRGANADELFRLVRRG
FT                   RFRRVRSLAPGCPARVAAAIERCLARAPERRWKSAGALARHLDAFAAKKLAKLHPRARL
FT                   VALLANRGFATEEVALSRMDVATLNATRLADEKGTATVAEFPVRRRRRATALQAALALA
FT                   AAAAAWLAPLALS"
FT   gene            245070..248672
FT                   /locus_tag="Adeh_0218"
FT   CDS_pept        245070..248672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0218"
FT                   /product="pyruvate-ferredoxin (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79995"
FT                   /db_xref="GOA:Q2IMG2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79995.1"
FT                   /translation="MASRRMVTMDGNEAAASVAHRVSEVIAIYPITPSSNMGEWADEWS
FT                   AKGRKNVWGTVPSVAEMQSEGGAAGAVHGALQAGSLTTTFTASQGLLLMIPNMYKIAGE
FT                   LTAFCMHVSARAVATHALSIFGDHSDVMAVRQTGFGLLSSASVQEAHDMAAIAHRATLL
FT                   SRVPFLHFFDGFRTSHEVAKIEELTDDDLRAMIPEELVAAHRARALTPDRPTLRGSAQN
FT                   PDAFFQAREACNPYYLDAAGHVQAAMDHFGKLTGRKYKLFEYFGHPEAERVVVAMGSAC
FT                   ETAQETVEHLIARGEKVGLLKVRLYRPFDLGAFMTALPRTVHALAVLDRTKEPGALGEP
FT                   LYQDVVTALREAEQAHIDRFHHQITVIGGRYGLSSKEFTPGQVKAALDELSKARPMRHF
FT                   TVGINDDVTHLSLKTDPTFDTEGKDVVRALFFGLGADGTVGANKNSIKIIGEDTPNFAQ
FT                   GYFVYDSKKSGSVTISHLRFGPRPIHSAYLIEKANFVACHQFGFLEKYDMAEMAVPGAT
FT                   LLLNSPYGPDEVWGHLPREVQEQILSKGLKLYVIDAYKVARETGMGVRINTIMQTCFFA
FT                   ISGVLSRDEAIGHIKKTIEKTYARKGAEVVQKNFAAVDHTLAHLYQVKVEGRAATGAPR
FT                   PPAVSEAAPDFVKRVTALMLAGKGDQLPVSAFPVDGTWPTGTSKWEKRSIALEIPVWEP
FT                   SLCIQCNKCALICPHAAIRPKFYGPEVLGGAPQGFLAMDYKSADVKGAKYSLQVAPDDC
FT                   TGCTLCVEICPAESKTEKGKKAINMADAMPLKEKERANFEFFLSIPDADRKKVKLDVKG
FT                   TQFLEPLFEFSGACTGCGETPYLKLLTQLYGDRAVIANATGCSSIFGGNLPTTPYTQNC
FT                   EGRGPAWANSLFEDNAEFGYGMRLSIDKQAEQARELLAVLGPKLGDALVDELLKADQSD
FT                   ETGIEKQRARVAELKAKLQMMDGLEARWLLRIADYLVRKSVWIVGGDGWAYDIGYGGLD
FT                   HVIAQGRDVNILVLDTEVYSNTGGQASKATPMGAAAKFAVAGKNLPKKDLAMLAMSYGH
FT                   PYVARVAMGAKDAQTIAAFKEADSYTGTSVIVAYAHCIAHGYEMSEAIGQQEKAVESGY
FT                   WPLFRYDPRRVAAGDSPLKLDSAAPKIELARFTEGETRFRQVEQANPQAFARMLEQAQK
FT                   DVREKYALYEQLAKAMNPANLVPGAASGTGKPRA"
FT   gene            248841..249257
FT                   /locus_tag="Adeh_0219"
FT   CDS_pept        248841..249257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0219"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79996"
FT                   /db_xref="GOA:Q2IMG1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79996.1"
FT                   /translation="MAITWDPTLALGIEEIDAQHEELFRRVDALLESVQERRSAEETRR
FT                   MLAFLDAYVVEHFGAEEALMQAHRYPGLAAQRAEHAGFAADLAALREELERDGMNALLV
FT                   VRVNARVATWLFEHISRSDRAFGRFLLAAPAARA"
FT   gene            complement(249286..250182)
FT                   /locus_tag="Adeh_0220"
FT   CDS_pept        complement(249286..250182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0220"
FT                   /product="protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79997"
FT                   /db_xref="GOA:Q2IMG8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79997.1"
FT                   /translation="MTAPRQVLPGVTYLVTRRCFQRMFLLRPSPETNAIFLYVLAVAAR
FT                   RYGILVHAFCVMSNHFHLVVTDVDARIPEFEQYLNALVARAVNASLGRWESFWAPGSYS
FT                   AVVLSSPQDVLEKAAYVLTNPVKAGLVASAQAWPGLWSAPASIGAGALRAARPEPFFRR
FT                   NGPMPDEAQLALVPPPGFDSAEAFRAQLVDAIAARERAIGDAHALGGNGFLGARRVLAQ
FT                   RPTGRPTVPAPMRGLRPRVAARDPWKRIEALGRLAGFLRDYREAWRARRAGRADAVFPA
FT                   GTYLLRVAHGVPCAGVG"
FT   gene            250332..251306
FT                   /locus_tag="Adeh_0221"
FT   CDS_pept        250332..251306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0221"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79998"
FT                   /db_xref="GOA:Q2IMG7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79998.1"
FT                   /translation="MPPTLVTGAAGFIGFHLAKALLERGDEVLGIDSMVPYYDVRLKEA
FT                   RLAQLTGRPGFTFERLDLADRDATARLFERARFGAVVHLAAQPGVRYSLENPHAYVDAN
FT                   VTGFLDVLEGCRHHPVRHLVYASSSSVYGGNSKVPFAVTDNVDHPVSLYAATKKANELM
FT                   AYTYSHLFAIPATGLRFFTVYGPWGRPDMAPMLFARAILEGQPIKVFNHGQMRRDFTYV
FT                   DDIVEGVIRVLDRPPAAGVVPPHRLYNIGNSQPVELLRFIEVMEEALGKKAVRELLPMQ
FT                   PGDVPATFADVSELERDVGFRPATSIEEGVRRFVAWYRTYHRG"
FT   gene            251404..252372
FT                   /locus_tag="Adeh_0222"
FT   CDS_pept        251404..252372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0222"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79999"
FT                   /db_xref="GOA:Q2IMG6"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79999.1"
FT                   /translation="MPGVPPPVPAVRPSSGRDPSYPAVDCLGVKVARLEWPDLLEWFLR
FT                   RLDAPAPVRCGTLVLANAHTLNVASASPAARASIRAATLVLNDGVGLDVYARLRTGAPF
FT                   PYNFAGTDLVPRLLGECARRGLPLRVFLYGARPGRAEEAARRIERDYAPVTVVGVLDGH
FT                   ETTGDEARRAIDAARPDLLLVGLGNPRQEAWMAANAPALRARVAIGVGALFDFMSGSVA
FT                   RAPRAVRAMRLEWLFRLALEPRRLFRRYAIGVPLFLWRTLTYRPGLATSEPATSRPTQS
FT                   RLPAGRPRIGAPNDSGFGSVLARTAGDANDSGSGVRVGSAG"
FT   gene            252492..253376
FT                   /locus_tag="Adeh_0223"
FT   CDS_pept        252492..253376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80000"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80000.1"
FT                   /translation="MCAAAGAAAAGPLLVPGRMGYNALPALRNVDPVIGDRTELELSAT
FT                   AQLAGLGSEDVAGTPYVRLTVPFREVAALELDGTPFELFRTSAATEARLGARVRSGASP
FT                   GDLRAGARFLVLDERGWRPALGLRLVVKSTSGKDRGARRFTNAPGYVFDLLGGKDLAAA
FT                   GPVRLRALAKVGFLAWQVADGRQDDALDYGATLRAGFASGVAISAEWRGYAGWRGDDRP
FT                   MVLGLTADVPAGQRVLLRASVDRGLSADAPPLDVRLGVVLFLDAPMRRDRTAAPADPRL
FT                   AAGPRPRRQPGPR"
FT   gene            complement(253377..254546)
FT                   /locus_tag="Adeh_0224"
FT   CDS_pept        complement(253377..254546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0224"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80001"
FT                   /db_xref="GOA:Q2IMH2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80001.1"
FT                   /translation="MSRTRLAVLALALSPLALGACSNGDAPSAPASDAVRAPSASGSPS
FT                   ARGAGMDPHSMAGGKKILGVTTRNLYLGADLGPVMAAATPEAFVAATTAVWATVRANDF
FT                   HLRAEAIADELAATRPGLVGLQEAYLWRVQDPGDFLAGGTTPATTVAYDYVQDLLDALA
FT                   ARDLRYVVAAEVTLFDFEAPVATGQDVRMTDRGVILARSDLTTALPGGGVYATLLPVNV
FT                   LGNAVQVKRGWVSVDAKYRGEWLRFVSTHLEAYHAGVRTAQAAELAAALAAETRPVVLV
FT                   GDLNSEPGTEGEAVLAGAGFRDVWAAVNGDAAGLTCCFPEDLRTGPGDPGFADLSTRID
FT                   YVLVRGPAQPWSAEVVGETAAERVGGLWPSDHAGVAAEVRVTDGRHAEE"
FT   sig_peptide     complement(254472..254546)
FT                   /locus_tag="Adeh_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.409 at
FT                   residue 25"
FT   gene            254791..255933
FT                   /locus_tag="Adeh_0225"
FT   CDS_pept        254791..255933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0225"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80002"
FT                   /db_xref="GOA:Q2IMH1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80002.1"
FT                   /translation="MPRATGPRRGCRLLGLALAAAVALPGCKRGGGSTAEAAQEQPPVA
FT                   LAPENVAVVSSRRLQSGPEVAGTLHARRTATLRAEVGGAVAEVRVEAGERVKAGQLLAR
FT                   IDASALQDAVRAARSAVTSAQNALRVAESSARRAHTLAREGAMAEQDAERAEAQLEAAR
FT                   AQVEDAKARLAAAEQQAGKTAVRAPFAGVVSERNVSSGDVVSSGAALYTVIDPSRLQFE
FT                   GSVPAASVGALAPGAPVDFAVTGFGGRRFDGHIERVNPAVDPSTGQVRVYVDVPNADGR
FT                   LLAGLYAQGRVASQASEALAAPATAVDATSTPPTVMKVQDGKVQKVAVEIALRDDVAGA
FT                   VGFRSGVKQGDVLVLGSARGALADGTPVRVVEDPRAQQSN"
FT   gene            255952..259116
FT                   /locus_tag="Adeh_0226"
FT   CDS_pept        255952..259116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0226"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80003"
FT                   /db_xref="GOA:Q2IMH0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80003.1"
FT                   /translation="MFISDFAIKRPIVTITVMLALVIFGLLALVTLKTDEFPDVQPPVV
FT                   AVTIVYPGASPETVEREVIDPIEDAIFSISGIDGKQTTASATDGLAQFIVFFDFEKNLM
FT                   EATQDIRDAISSKRQDLPTEMEEPVLVRFDPSQEPIVTLTLTSKTLPVPALTRLADEVV
FT                   SRDLRSVQGVADVRLVGGQKRELTVQLDPEAMAAASVSAAEVVGALQAQNLAAPVGRVN
FT                   TPLGEQSIRLSGRLATPEEFEQVAVASRGGQVVRLGQVAKVLDGAEEARTLALFNSGEA
FT                   VGLEVLKTKGYSTTAVADAVKERARALEPRMEGAKLAVVQDSGTRVRQSVDDVQRTLIE
FT                   GALLTVLVVFLFLNSWRSTVITGLALPVSVLAAFVSVWAFGFTLNTMSLLGLSLAIGIL
FT                   IDDAIVVRENIVRHIELGEDHTTASHKGTDEIGLAVTATTFSIVAVFVPVAFMYGVAGQ
FT                   WFKPFALTIAAAVLVSLFVSFSLDPMMSAYWPDPQVEKGERRGPVGRALGAFNRWFDRQ
FT                   AAGYRRVVAWALDHRWLVVAFATLSLVGSFALQGAFGGAGFVPVSDRSEVSLIVQTPPG
FT                   SSIEYTRRKVEETDRILRSHPEVAYTYASIGTPIPLQAPGVDQALIYARLTPKRERDVS
FT                   QDALGAVLRRELSRVAGAEISVFTSGFGGAFKSIQLELRGPDSRVLTELAEKVKAVAAG
FT                   VPGAVDVGLSTRGQKPELAVEVDRGLAGRLGVTVGQVAQSLRIAFAGLDSGDWVDPTGE
FT                   TRKVMVRLAPEARERASDLRQLPLVLPSREGAPRILPVGQVARITEGLGPAQISHLDRQ
FT                   RVVSVQGNVAGRSLSEVVNDIERRLASELKLPPGYTLRQGGESADQAEVFTRIGVALLL
FT                   AVMLMYLVLVLQFGSFLDPLAILLSLPLSLIGVVLALLVTGDTINLMSLIGVILLFGIV
FT                   AKNAILLIDFAKWAREERGLSIRDALVEAGGIRLRPIMMTSVAVIAGMIPVASGLGEGG
FT                   DFRAPLGRAVIGGVITSTLLTLLVIPTVYEIMDGWRTRLGRLFRRAFSRGGERHAREAA
FT                   QRREEP"
FT   sig_peptide     255952..256038
FT                   /locus_tag="Adeh_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.461 at
FT                   residue 29"
FT   gene            complement(259141..259656)
FT                   /locus_tag="Adeh_0227"
FT   CDS_pept        complement(259141..259656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80004"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80004.1"
FT                   /translation="MTAHRPLPLLALAALLALAAGAPLTARASAAPGNADALRGVTSGK
FT                   GLFLVDLADGPKLAMYLKLIAGSHDGLRAQGVAPDFKVVFIGPSVRFLAGVAPAPGRAA
FT                   DRAAAAEIAGAVRELKRRGAALEVCAIATKVFEVEDARLLPELTVVADGFVSLIGYQAQ
FT                   GYHLVPIY"
FT   sig_peptide     complement(259570..259656)
FT                   /locus_tag="Adeh_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.546 at
FT                   residue 29"
FT   gene            259849..260454
FT                   /locus_tag="Adeh_0228"
FT   CDS_pept        259849..260454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0228"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80005"
FT                   /db_xref="GOA:Q2IMH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80005.1"
FT                   /translation="MSPREKLVETAAALFYRYGCHAVGIDTVLAEAGVAKMTLYRHFRS
FT                   KDELVLAALRRMDERFRNAFMAAVERASDTPAGRLDALFDVVRDWVRGKDFYGCPFINV
FT                   TAEFAAHDDPVHVAAAEHKRLALEYIERLAAEAGAADARGLARALKVLLEGCTVLAQVT
FT                   GQPGFVDDAQQAARLVLREGLRGAVPARAPRRLRRARA"
FT   gene            complement(260630..262054)
FT                   /locus_tag="Adeh_0229"
FT   CDS_pept        complement(260630..262054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0229"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80006"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80006.1"
FT                   /translation="MRTPDAVVVGSGPNGLSAAVALARAGLRVLVREAAATAGGGARTL
FT                   PLTLPGFLHDHCSAVHPLAVASPFLRTLPLAAHGLRWISAPAAVAHPFDDGTAALLGPG
FT                   FEATDATLGADARAWRALFAPLARELPALLEEVLGPVLHRPRRPLLLARFGVPALLPAA
FT                   RLARARFRGPRARALLAGLAAHANRPLEAAASAAFALVLGAAGHGVGWPFPEGGAGAIA
FT                   AALAAELRAHGGELVTSAEVRRLEELPPARAVLLDLTPRQVLRVAGARLPARYARRLAA
FT                   FRYGPGAFKLDWALAGPIPWRAPECAGAGTVHLGGELEEIAASEAAVERGEVPARPYVL
FT                   LAQPTRFDPSRAPPGRHVAWAYCHAPRGFEGDLTAAVEAQVERFAPGFRELVLARAVRG
FT                   PAALEQDDANLVGGDVGAGEASLAQLVARPVLSAHPWSTPVPGLYLCSASTPPGGGVHG
FT                   MCGWHAARAALRHLVL"
FT   gene            262231..262839
FT                   /locus_tag="Adeh_0230"
FT   CDS_pept        262231..262839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0230"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80007"
FT                   /db_xref="GOA:Q2IMH5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80007.1"
FT                   /translation="MPDESDERLMLRFRDGDARAFEALVRRHRTPIFSFLLRLTRDRGR
FT                   AEDLCQEAFLRVVKASGAWEPRARFRTWLYAMARNLAVDESRRMAFRRASSLEADPAAS
FT                   ALAADGPAPDRAADAALVRPLLEAALAALPDEQREVFLLREHAGLRFPEIAEVTGAPEP
FT                   TVKSRMRYALEALRERLAAMGVEPDSPAGAPASTRSAAP"
FT   gene            262836..264074
FT                   /locus_tag="Adeh_0231"
FT   CDS_pept        262836..264074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0231"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80008"
FT                   /db_xref="GOA:Q2IMH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80008.1"
FT                   /translation="MSDERFHERLGARLHDAILEHAYGELPGGEARALERHLEACETCR
FT                   AELARIRGTRALMSGLEDAPAPERGEAVLLAAAREAAGARARRRRLPTWTWTWGAALSA
FT                   AALLAVGAVSYRLLALHPGPALRDDPEALLGRAPAPAAQAGPEAAAPDVPATASSPAGG
FT                   PDEVRAERARPAAPPAPERRREAPRPGAAAKSAPSAAPAAAPEADVAAAPRTSIAPAPA
FT                   APRAFVAPAAPAPAPAPRALRADAGDAGPPAAGPAPAATLEAAPEDGDAASGARRAAPA
FT                   VRAQSRDAAASPAPAGPDAQARWRALRQAGALRGEVVAFTDCDGEAWRKVETDAQGRVV
FT                   RYARHGRLAGRAFEAELYYGEDGALALARYREAGGPWREVRPPAPAGAIPAAALQPARA
FT                   ADARADAPPRCGP"
FT   gene            264217..265320
FT                   /locus_tag="Adeh_0232"
FT   CDS_pept        264217..265320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0232"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80009.1"
FT                   /translation="MARILYGVAGEGMGHAVRSRVVIDHLARTHDVQVVVSGRAHDYLK
FT                   ARERDHLGVNRIWGLSIVYEDNEVRNFRTVLKNVGGAVAGGWPRNVKAYFDLTESFRPE
FT                   VVVSDFETWSYLYARTHGLPCVSVDNNQAVNRCDHPPEILAGHEAEYLVAKGVVKAKLP
FT                   GCFHYLIATFFQAPVAKPRTSLHPPVLRPEILSARAEPGAHLLVYQTSTSNEALPDVLR
FT                   GAGVECRVYGLRRDLTADAREGNLVHRPFSEARFVEDLRTARAVISGGSFTLMTEAVYL
FT                   HKPMLAIPVKRQFEQVLNARYLQALGYGATADDLDARVLGDFLARLPDLERGLSRYRQD
FT                   GNRELLAKLDDVLARALDGGEPAEPRA"
FT   gene            265317..265778
FT                   /locus_tag="Adeh_0233"
FT   CDS_pept        265317..265778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0233"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80010"
FT                   /db_xref="GOA:Q2IMI1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80010.1"
FT                   /translation="MKIRVVAVGRDRSGLYAPAVDEYAKRLGRYLRFELVEVPEARKLA
FT                   GTPGAKGEEGAALLAKLGPRERVVVLDERGDELTSVAFAERVRRWMERGQDVALLIGGS
FT                   DGLAPEVLARAEERLAVSRFTLAHRLARLVLVEQLYRAMTILRGEPYHK"
FT   gene            265891..268449
FT                   /locus_tag="Adeh_0234"
FT   CDS_pept        265891..268449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0234"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80011"
FT                   /db_xref="GOA:Q2IMI0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017309"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80011.1"
FT                   /translation="MTRLRTPAALATFLAVLACGGGGGDSQPLPTTFTLSGHIAATAGQ
FT                   DVDGDVADPGAPRTPNDSAAQAQQLAPVTTLGGYASAGTDSQDWYKATLEAGQTVVLDV
FT                   ADAAASLELCLLASDGVSVVSCAIGGANQVIPVAAAGQHYVRVTAAAGSSNYALTLGVN
FT                   GAGAGAGSAPHLALPFVPGELVVRFRDDALEVAAAGDLPRRAAALGLTALAGARGRAAL
FT                   LSMSGPEGRARALAALGVEPLAPGALGAGADPVMAEKWDTLRAIAALRRRADVESADPN
FT                   FLFQPALVPTDTYYKYQWHYPLISLPQAWDLETGDPGVVVAVVDTGVFLAHPDLSGQLV
FT                   TGYDFIRDPAMANDGNGIDPNPDDPGDAATLGGSSWHGTHVAGTVAAALNDSGVVGVAP
FT                   GARVMPLRALGVGGGTSYDIMQAVRYAAGLANDSGTVPATRAAVINLSLGCQGCFSSTE
FT                   QAVYTSARNAGVIVVAAAGNEASSAPGYPAAYAGVLSVSAVDMKGAKAPYSNTGSTVDL
FT                   AAPGGNTAVDLDGNGYADGVLSTLVKDTTGTREPIYAFYQGTSMAAPHVAGVMALMKSA
FT                   CPGLTPDGVDARLQAGLLTRDLGTPGRDDTFGWGLVDALKAVQSCGAALPPSLSVTPGR
FT                   LDFASADTVLQLQAARVGEGALTVTSVSDDAAWLTVAAPGVDASGLGAYTATVDRTGLA
FT                   DGRYTARITFTPSVGAPVIIPVTLQVGAAAAAGDAGFLYALLVRDGVNGPELVKQWAGA
FT                   ASGGSYAFRFDGVSAGTYYLVAGSDMNDDGYICDAGEACGAWPTLGVLTPLGASGPRSD
FT                   LDFSVAFDPAVAPVGAAAGTPGRAPGFARQPASKGVAGLR"
FT   sig_peptide     265891..265965
FT                   /locus_tag="Adeh_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.473 at
FT                   residue 25"
FT   gene            268574..270124
FT                   /locus_tag="Adeh_0235"
FT   CDS_pept        268574..270124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0235"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80012"
FT                   /db_xref="GOA:Q2IMH9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80012.1"
FT                   /translation="MPKTKPVLLVVLDGWGIRAAREANAIAIAGTPNMDALQREFPHAA
FT                   LETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVEDGSFYKNDALLLACRR
FT                   AREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARTYVHAFMDGRDTPPKSGLD
FT                   YLAAVERRIAAAGYGKVATVTGRYWAMDRDKRWDRVAQAYAAMVSGEGFKAASGAAAME
FT                   AAYARGETDEFVKPTVVVNGDGKPVGSIRDGDAILFFNFRADRAREITRAFTQDGFHDF
FT                   ERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQLRTAETEKYAHV
FT                   TFFFNGGRETVFQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQALGTGQYGFALVN
FT                   YANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGNCEMMTDPVTG
FT                   QPHTAHTLNPVPFILADPDFRGAKLREKGVLADVAPTALQVMGLPQPKEMKGLGLVIR"
FT   gene            270197..270883
FT                   /locus_tag="Adeh_0236"
FT   CDS_pept        270197..270883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0236"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80013"
FT                   /db_xref="GOA:Q2IMH8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80013.1"
FT                   /translation="MLRAAVRALLDLVYPPRCAACGEPVAEEPFCEVCAGALEPVPPGC
FT                   ARCGAPGAGPACGACLAAPPAFDAVRAGGLFGGPLADAVHALKYGGRPDLARPLGAWLA
FT                   ARVPLPPGAAVVSVPLGRARRVDRGYDQAALLADALARAAGARGRRLRGALRRARETSP
FT                   QVGLGRAERARNVAGAFLAGPAVAGRDLVLVDDVVTTGATADAAARALRAAGARSVTVV
FT                   ALARAE"
FT   gene            270946..274716
FT                   /locus_tag="Adeh_0237"
FT   CDS_pept        270946..274716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0237"
FT                   /product="tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80014"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80014.1"
FT                   /translation="MLARPAALLALCLASTGSARAPSPLPPPTGLDPDAERAAAAVAAL
FT                   DRERRGPRGLAALAELDALADDLPELAHVAAAYARAADDREAHPEVRALARFRLAEVER
FT                   ARGNLQKEAASLRRLGFVERWRVIGPFDDEGKRGLAEAFPPEKAIDLAARHPGKAREVA
FT                   WRALPEDAVVDGFVHLGAALRPAREVVAYALAEVEAPRELEARLWLGASGAARVWVNGA
FT                   AVLTDADYHPARLDQRGVVVTLRRGANRILVKLCHQDGRMGFYLRLADARGEGLELAAA
FT                   DPRGAALREVPAPGPAAPIAPAVGALEQRAKAARGARAEAEARLELARVLAARQGGDVQ
FT                   ERRAAAEARRAALLAPGWADAQLEAAALDEDHGRRRQRIEAALAAAPEDPRALRALGQE
FT                   ELDQGRPQAAARLLERAVRAAPGWAAPRVELADALSRAGLEARGALLAEATAAAFATVP
FT                   SAVRAAARSARRLGRTEEAAARSRTLVALRFDDAQTRAALAQILADRGDVAGAQALLEE
FT                   ALRLDPSDVYQRLRLADLLAASGRGEEAERAYAAALALAPDEPDAWERRGRARLSQGRV
FT                   KDAQADLQRALELRPQSPELKLLVRSLEPAREPFERPYLLDARELAAAAPAAEPDEDAL
FT                   VLGELKVTRVLPSGLSSTYTQSVVKVLTPRGADQARRQTVSWAPDRQEVRVERARILKP
FT                   DGTVIEAHDESERSASEPWYRLYYDLTARTLSFPALAPGDVLEVAWRLEDVAGENLLSD
FT                   YFGDLTFVDDTTRKARFDYVLLVPAARAIHANAPAGIAHAQRALPGDVVEHRWSARDLP
FT                   RVVPEPGMPGWSEVSRHVHVSTYASWDQVARFYWGLVKDAVRPTPEVRAEAERIAAEVL
FT                   RARRGDGTRVARAQAAASTLPPPGGWDLETQRALTRAVYDFVVSQTRYVGLEFGIHGYK
FT                   PYRVDQVLQRRFGDCKDKASLLRAMLESIGIDARLVLLRMRRLGRLPEAPASLAVFNHA
FT                   IVYVPALDLWLDGTAAYSGSGDLPGEDRGATVLVVNPDGKPRFATVPEALPEQNRGETR
FT                   FDVAIAADGAASVRGAWRVSGAEAPTYRRAYLVEEQRRAQLEQTFNRSFPGVRVASVTA
FT                   SDLTRLEDDVTMQFALEIPRFARPDGAGLRFSPFGATRGWGESWAALSSRWHDLDLGSP
FT                   TETVFTYRYTLPAGWRIAELPDGDAARTPYASFDVRYRRDGAALVAEARVRLEKGRIPA
FT                   RDYPAFRELTGRIDRAFARKVRIVPAQEAAR"
FT   sig_peptide     270946..271005
FT                   /locus_tag="Adeh_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            274713..278432
FT                   /locus_tag="Adeh_0238"
FT   CDS_pept        274713..278432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80015"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80015.1"
FT                   /translation="MSRAARRGPPRIPGVAAALAALALACAAPRAEQAEPGRATREGLA
FT                   ALEQNDVARAEARLGPASRVRDPWARFGASLLARRALDGEAEAQRLLATVEAGPDEPIA
FT                   LVALRRLSELAERGPALAAQVDAGVLRLGAGGRLHGLAAYRARVARVTAAEVLGDHDAA
FT                   AQARRENGAVSAWSIAGPFAAHHALDFGAPIPPDRGELPASVPGRAGGPAVPTRALPAP
FT                   DGTVALDGEPAAGDLFALATDVDLARGGRYLVTLGTQLSARLVVDGALVHERRAFAAWL
FT                   PGLVHLPVELARGRHRVVLEVTRGAPSTGIHLAFARADGAASDARFAAPPPGPPPAPPV
FT                   ARPRAEPALTPRALALALEPDVGAATARLLAARDALVNDREAAKVLLAEALALRPEAAA
FT                   LRAARADATADDPTLDEQVARARAEADLREALRLDPGDAEARAELAALLRGAERHDDAE
FT                   AVLAGLAPEPAARPAGIAARARAAQARGLLERAEGLAAEALRSAGSCDAADLAYELAVR
FT                   RGAAAREDEAMAVLSRCRGGRERLAAHLRRRGDPVAERAALDPVVRARPWAVEPGLTRA
FT                   DALVAAGETRRATAALEAIAAIWPRDARVQRRLADARELSGDAPGARAARERALALDPA
FT                   DLQLRRALALEDGTEVLADVAADPRAAIRAYEAAGRRNGASTVMVLDAAYVDVHPGGAA
FT                   TERTQQIVHVLDQQGVEQFGEVTVPAGADVLALRTVKPDGTTLEPERAGSAKGSVSLAG
FT                   LAPGDYVELDYVRAVQSPPGLEGYAADPFYFQVPGSRLFRSLYVVRAPAGLGLEADAHG
FT                   MPAPAPVRDGGREVLRAERRDVPAIVPEPDAPGGAEYLPFLSVGTGGGRAALQRAVADA
FT                   LPERTRATAELRAFAREIAAGGGGPAQLARAAYARVAQAVLGSGGGMGEDASVALSRGR
FT                   GSRLAVLKAVLAELGIESRVALVRPYSADPAPYRFPALGLYAAPLLRVRAGGATFWLDP
FT                   TARHAPFGAFPAVLAGCEALVLPEAGEAPEVDRTPESPLVEEGRETTARLVLAADGSAE
FT                   ASGTDRYLGYGGAELKAALERLDASQRRQAVEGMLGRVLRGVTVTDVAFAGEDDPAAPL
FT                   EIRWKARVPELARAVEGGLVLDQPLFPARLGARLVRVASRQTPLLLATPERQVQRIEVV
FT                   PPRGLGVTADAPRTASSPSGSFTRTERVDGGTLVRDERLELRRGRIAPEHHAELAAFAA
FT                   AVDQAQERPLLLAR"
FT   sig_peptide     274713..274808
FT                   /locus_tag="Adeh_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.359 at
FT                   residue 32"
FT   gene            complement(278803..279414)
FT                   /locus_tag="Adeh_0239"
FT   CDS_pept        complement(278803..279414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80016"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80016.1"
FT                   /translation="MRRLLALLVLGLAAGAGLGLALRLGRAPALPDPPAVATRIREVAR
FT                   LEALDVTLYKKVAFSPEPVEAGSLWGDVAGWLRHVFRTPHGKAIVFADAHLGLDLARLD
FT                   ASRVRVSGRTVEIALPPLEVRIALRPGETEVIGSNLDSAETARLLELARAAFEREVQAD
FT                   AALRARARSSAERAIRGLLLGLGFAEVRFVDALPAAAPTS"
FT   sig_peptide     complement(279349..279414)
FT                   /locus_tag="Adeh_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.676 at
FT                   residue 22"
FT   gene            complement(279424..280002)
FT                   /locus_tag="Adeh_0240"
FT   CDS_pept        complement(279424..280002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0240"
FT                   /product="TfoX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80017"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80017.1"
FT                   /translation="MPISPSFVEHAVDLLAALGPVQARRMFGGVGLYCDGVMFGLLDGD
FT                   ELFLKTDGETRPWFLEAGCRMWIYPGMYETSYYRPPDDAHEDAEAMLPWARLALDAAIR
FT                   AQAARAAKARAPRGAGAKARPARRAKRAKPGKAAKGTAKAAKTKRPAASKRTRASVGAR
FT                   RTKRTAAHTRRPRTRPAKRGRARPARPPR"
FT   gene            complement(280036..281175)
FT                   /locus_tag="Adeh_0241"
FT   CDS_pept        complement(280036..281175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0241"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80018"
FT                   /db_xref="GOA:Q2IMI8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80018.1"
FT                   /translation="MARPFGVYVHYPYCTHRCPYCDFAVTTERPPGAGRYARAVRAELG
FT                   LRAAAFEGLALRSVYLGGGTPSLWDAEEIRDVLDAIRGRFGLAAEAEVTLEVNPESSDP
FT                   ARLEAWRAAGVNRISVGVQSFDPGVLAKLGRRHGPERAERAIREASAAIGNVSVDLIYG
FT                   ARRSSVETARRDAERAVEAGAAHVSAYALTLEPDVMAEEVPLARMRREGRLPLPSDEDT
FT                   LAQAAALRAALRRLGLRRYEISNFARPGRESVHNGLYWRHESYLGLGAGAYGCRRGEAG
FT                   SVRYGNLRDAGAWLAAVEAGRLPTAEEDRIDARADRNERLMLALRTREGAPLAALGPAQ
FT                   AREAADLVRHRLAVRRDGALVLTRRGLDLHSAISERLFE"
FT   gene            complement(281221..282318)
FT                   /locus_tag="Adeh_0242"
FT   CDS_pept        complement(281221..282318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80019.1"
FT                   /translation="MPARHSLAPLACAATLLALLAASPARSAAAQQAPPPAGAPGEPPC
FT                   EPVKPCEIPDEPAAGPAEPPAELGAEVRRLFDLVACRGAAPAGLDAQVVAAFCAEQRKA
FT                   LEAFRAGPRAQAFEALAPLRPAGLPSSVVVPGGADLLTALGAFPGLKNVTTFSAAPAGD
FT                   PRVLAGLAPDRLRQGLAAVRAGAQALLRGEGASARGAARAGEFPVQLALFLTALAAEGY
FT                   EPTGLRSFAVQPDGTLRYLTRAELGAGRAPLASSELTFVRRGDDPRTRTRTHRHVAAEL
FT                   SDAAVARSPGVLAHLAGKGELSVALGAAGASPWRDDHARLRTLLLERAAMVVSSGPRLP
FT                   AALARQAGLSAEERGPFQVVRRPAR"
FT   sig_peptide     complement(282226..282318)
FT                   /locus_tag="Adeh_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.566 at
FT                   residue 31"
FT   gene            282520..284592
FT                   /locus_tag="Adeh_0243"
FT   CDS_pept        282520..284592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0243"
FT                   /product="Oligopeptide transporter OPT"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80020"
FT                   /db_xref="GOA:Q2IMI6"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80020.1"
FT                   /translation="MAEPSTVVKPEVEQKEFRPYIGADRTLPEFTPKAVLLGALFGILF
FT                   GAATVYLALKAGLTVSASIPIAVIAISLGRKVFKTSILENNIIQTTGSAGESIAAGVVF
FT                   TLPGFLFLSAGPGGSSVGAGYFSYVTLFTLSMVGGILGVLMMIPLRRSLIVKEHGQLVY
FT                   PEGTACASVLIAGDKGGDFAKTAFQGVGFALAYALLQKVFHVIAETPAWVTKQTNKWLP
FT                   NATVNGEITPEYLGVGYIIGPRIAGVLVAGGVLAWLGLIPLLSVLVPGEVIARQLVKVG
FT                   ASPEGFGFDAAAGTFANLPRAVYLAYIRQIGAGAVAAAGFITLLKTFPTIVSSLRDSIR
FT                   SLGDKAGAASVSRTERDLSFVTVIVGSIALVVLLVALPQVPGDTVLNKLLTAVLIIAFG
FT                   FIFVTVSSRIVGIIGSSSNPISGMTIATLMATAMVFVSVGWTGAAYEPMALVVGGMVCI
FT                   AAANGGATSQDLKTGYLVGATPRAQQLALFVGAIASATVIGVTVKVLDTPTARMISEGI
FT                   TEHAIGSSYFPAPQATLMATLIKGLLSLNLDWHFVLVGAFVAITMELCGVKSLSFAVGL
FT                   YLPLSTTLPIFVGGALKGVADFMSRRKGGAGEEGELGSGSLFATGLVAGGALFGVIVAF
FT                   LQVFAEGTMKRLDLQEPIVHAIGSTGYAVLGVVFFAALAAVLYRAARKPQPGLEA"
FT   gene            complement(285046..287472)
FT                   /locus_tag="Adeh_0244"
FT   CDS_pept        complement(285046..287472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0244"
FT                   /product="LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80021"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80021.1"
FT                   /translation="MQPAEARRRLGAAAALHRRGHRRRHRRAPGHPHPRRRLPQEALRA
FT                   GRAARPRRRAAPRRRARPAAAARAAARRRGGLARPAGGRERATPRAAAGGVRRGRRARP
FT                   RRRARRRRHPAARRRRAPSARRRAPPAAPAPAARRPARQGEGGQRHPTPRPRRRARRLA
FT                   ARSRAAEGHARGEARVLPRPAPRARRVPGAGARRHRRDEGRGGRARRRARPARARPRGR
FT                   ARPRRRARGAAGRGRPGRRRAGRAPRGPPAPAGGERVHPPLALRGAERDDAAAGVRRAG
FT                   DRGADRRRRGGARAARGRAGRGGGGARAGHGRGGGRPRRRARRAGGRARAGRGRRRARA
FT                   GAGRGRARAGAGRGRRAARHGRGARRRGGRRARRAGGRAGGRARRAGRAGPGARRGRGA
FT                   RGRGPARRRGGGRRAPRRGGRGRGARPGRRRRARRRARADRRAGGRAGRGGRDARGAGG
FT                   GAPAGAGRGPRVRPEGRRRRARVPGQGRRAGRRRPAHRRPRGRARRGARLGGGHARRAG
FT                   AGGERAGRGRAEGRAGRRRARPARARGGDRAPGRRGRAGARPPARGRGEAARAARARRR
FT                   GGRPAAQGGRVAPRDGAAAHPGRRGRLAVGAGRRRRAGARRGARRRRGRQAAGLRRAPR
FT                   VGAGRRAPQARRAGGRAERPGRRAGEGADRPAGRPGRGRAAPPRRRRRGRRGRAPPRRR
FT                   GRAPEGRHGGAGEAPRGARPRRARHEEADPGAGEGRRRPAPAARAGRRSRRGREAEGRR
FT                   GAARRGARRPARRERLPERRGRPLPAEEPRPAGPARLAARGLRRRAPLRVRRSSP"
FT   gene            complement(287418..287663)
FT                   /pseudo
FT                   /locus_tag="Adeh_0245"
FT   gene            287869..288732
FT                   /locus_tag="Adeh_0246"
FT   CDS_pept        287869..288732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0246"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80022"
FT                   /db_xref="GOA:Q2IMJ2"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80022.1"
FT                   /translation="MSTHSLTLDVPRARAEDLSAELWELGASGVEVRDGEGTPMPGQPQ
FT                   PAPGRALLVAWFADRASAEAAADAAGGGEVAEVPDEDWGETWKKGLGPMVIGRAFVRPS
FT                   WVDAPVPPGLAEVVLDPGMAFGTGTHPTTSLCLAGLSELLAARPGASVLDVGTGSGLLA
FT                   IAARKLGAGRVTGNDNDPVAVAVARENAARNGVPEVALTEAALPAIGGAFDVVVANILA
FT                   NTLVELAPEIAARLAPGGAVLLSGILTPQEDEVRAAYLALGLRPLAGGDRREGEWSLLA
FT                   LEKPRA"
FT   gene            288729..289451
FT                   /locus_tag="Adeh_0247"
FT   CDS_pept        288729..289451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80023"
FT                   /db_xref="GOA:Q2IMJ1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80023.1"
FT                   /translation="MSLRRVHLPPERIGEGRAALTDEARHYLRDVLRLAPGAAVELFDG
FT                   RGGAWEATVLDGFEALALGARRAAPGGGAPVWLLVALAKGEKIDLVVQKATELGAARIA
FT                   PFAAERSVVRLEPEKGEARAARWRRIAEEAARQCGRADVPEVRAPASLEAALAEVPAGF
FT                   GAFVFHPGGAPLSEAAPSPAGGYAAVVGPEGGLTDAEREACACAGARATSLGPRVLRAE
FT                   TAAIVAVALLQARFGDLR"
FT   gene            289512..290537
FT                   /locus_tag="Adeh_0248"
FT   CDS_pept        289512..290537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0248"
FT                   /product="RDD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80024"
FT                   /db_xref="GOA:Q2IMJ0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80024.1"
FT                   /translation="MRCPRCHREAGQGTVFCAGCGAPLALVAEPPPRALDASLSIDRRG
FT                   DARPPGTPPPLRGMPPPASAADTFVFGVPPAPPRPGRAREVDRSGWDLGPPLGVRQPDA
FT                   PRPQAAAPLAPAADAPEDDFEFGPLPDLRPEPARAAPRPPAVFAAAPDAGPEPLGAPAL
FT                   PADAPGRGLDAAPIDPIDVDVDAVEVHLRRPATWRRAASWAIDVLPFAALAIWALQAIA
FT                   GAVPLAPGEPSGPAHALDLALRDGGALALPLAAGAVILGLVYQTLGHALAGATLGKLAL
FT                   GLRVVGPDGRRPTLARSAARAALSAASALLLGLGLLAALFTRSGRSLHDLAAGTWVVEA
FT                   P"
FT   gene            290570..293074
FT                   /locus_tag="Adeh_0249"
FT   CDS_pept        290570..293074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0249"
FT                   /product="PBS lyase HEAT-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80025"
FT                   /db_xref="GOA:Q2IMI9"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80025.1"
FT                   /translation="MRRDLAQLLVEEGAIPAAAAERAAARQAEAGGALDTALLELGLAG
FT                   EDVVLRALERASGLPAAPDWAWDASDARARRVFPSRVAERHGLAPFALDGRELSLVATH
FT                   PVDLALLDEISFMLSLHLTPHVGPEWRVRALIHRLYGGALPPRLAALAAGGAAAATPGE
FT                   EAASPEPAVAAPDADAPEPDAPPTPEPDPAPPAPASSGPAAAAFDDAAPLEPLAAAVAQ
FT                   VLESADFSFLDAPPATPSPAPAGAAHPAPSARPSAGSGPADAPGAPRGERAESPPEPAP
FT                   RPAPRRMGETAAPPPAPAPGAPGRWTRAEAQAALAAASERDEVLRVVLRYAREFFAFAA
FT                   VFAVSRDAVAGHDALGEEEGEDARALCRSVAIYTSDPGVFHTAIETHAPHLGPISPEPD
FT                   GNRAILDGLGRGTPRTVLVHPVVLRQRTACLLYADNGPAAVSPRRLADLVLFLAGLAPA
FT                   LERVIQARKRARGAAAGEAPAAPPAPPPPEAAPVPVPSPSPARAAAPPRPTPAPVAAPS
FT                   AEPWQAHEPAAALADLEVDIDLFEEELGAAAPPSGAVRFDPEAEVTALLETDPGSLDRI
FT                   AGLARLAAFPEAALPVVWARLPGPIESDDDGASPTALGPLAAALAALGPAAVPAMVEVL
FT                   RDRDPVRRRIAATVLGAAGDPSTFPALAERVLDADPRVAGAAIAALAAHRRHPEMRAVP
FT                   EKLRRALLSGVAARTTFAARALGALRDAESVPLLVQVLESSEREPAEAAAAALAEITLQ
FT                   RLGTDPRRWLAWWKQNRGRGRAEWLLSGLTSAEREVRAAAAEELARAAPPPVSYQVDAP
FT                   AAEREAAARLWAGWWARSGLVL"
FT   gene            293218..294777
FT                   /locus_tag="Adeh_0250"
FT   CDS_pept        293218..294777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0250"
FT                   /product="propionyl-CoA carboxylase carboxyltransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80026"
FT                   /db_xref="GOA:Q2IMJ8"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80026.1"
FT                   /translation="MPHSDPDPRRALLDRLDAEAEKGGGDERVARQHREGKLTARERID
FT                   AFLDPGTFVEMDRFKTHRCAEFGMAEHKVLGDGVVTGYGLVEGRQVFVFAQDFTVFGGS
FT                   ISGAVAEKICKVMDRAMEVGCPVVGLNDSGGARIQEGVVSLAGYAEIFLRNTLASGVIP
FT                   QLSVIMGPCAGGAVYSPAITDFIFMVKDTSYMFITGPDVIRAVTHAEVTKEDLGGARTH
FT                   ATRSGVAHFALDTEEAALRAVRELLSFLPLNNVDDPPVQPCADDPGRRDELLKTIAPEN
FT                   PGKAYDMKEVVRAVADDRHFFEVAEQFAPNIVIGFARLNGRPVGVVANQPAVLAGVLDI
FT                   DASVKAARFVRFCDAFNVPLLTFVDVPGFLPGTDQEWNGIIVHGAKLLYAYAEATVPKI
FT                   TVITRKAYGGAYDVMASKHIRADVNLAWPGAEIAVMGPEGAVNVIFRKELLAAKDPVAE
FT                   RARLVQEYRDRFASPYKAAELGYVDEVIRPEDTRPKVIRALEMLRTKRQELPAKKHGNI
FT                   PL"
FT   gene            complement(295094..295750)
FT                   /locus_tag="Adeh_0251"
FT   CDS_pept        complement(295094..295750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80027"
FT                   /db_xref="GOA:Q2IMJ7"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80027.1"
FT                   /translation="MPMRTHELHPSIVHAPLALLPAAAIADLVATARPRDRGLDAVGRT
FT                   LWWSAAAGGLAAGLAGMAASQEIEVRSEHARDAMFLHGIGNLGLVLAAFGVAAWRSRNR
FT                   ACLTTALTGLAATAAAGYTAYLGGELVYGHGAGVRAMGGAASEAPPLFSAEAPGRLARD
FT                   AVRGLRWLLSRGARAVTGRERVDRTALGPLAEAGTGAEPPPPGARTDGGLGASPM"
FT   gene            complement(295938..296141)
FT                   /locus_tag="Adeh_0252"
FT   CDS_pept        complement(295938..296141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0252"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80028"
FT                   /db_xref="GOA:Q2IMJ6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80028.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDDGGEDVFCHYSAISGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKV"
FT   gene            complement(296293..297468)
FT                   /locus_tag="Adeh_0253"
FT   CDS_pept        complement(296293..297468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0253"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80029"
FT                   /db_xref="GOA:Q2IMJ5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80029.1"
FT                   /translation="MTADATPVHTEETAAPFPRLDRAAIEALVRAGKRLLVQGGMGIHA
FT                   SDGLAGKVARHRGDRLVGVGTISAVLKTPEQLRAEIRRARAEAPGGFVGVNLMAAINKD
FT                   DFEALARVSIEEKVSFLVQGAGISREIVRWCREGGVPFCGIVSSGRLAAMYEKWGADFV
FT                   VAEGAEAGGHIGDIGHPLPTLVDEVIAATSLPVIAAGGVDASDVSRFLAAGAAGVQMAT
FT                   RFLACSDGDVHPAFKQMHLAKREDDVVIITSCVKGMKARAVRNAFTERLARGEAVPPRS
FT                   KLWWFGKDGYRGRRGSCIQCLGEGLCKARASGFKESFCITDALLEAAVHGDTEAGLFYT
FT                   GQSITRIGERDAGQLPSAGEILADLELRLAGEARPSDAGPQARPDAVGAAA"
FT   gene            297653..299029
FT                   /locus_tag="Adeh_0254"
FT   CDS_pept        297653..299029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80030.1"
FT                   /translation="MPPDHAPRRTAVGSARRAMTTAPAPSPAPLVVAVDMGYGHLRAAS
FT                   ALADALGTEVLKVDRAPVAGPEEERLWQRVRRGYEAISRLSQVPVAGRPLAWALDSITD
FT                   IPRLHPRRDLSAPTRGVRALERLARGALGAGLVARLRAEGAPLLTTFYSPAVVADRAGI
FT                   ERVYCVATDTDLNRIWAPLEPARTRIQYLVPTRRAARRLLAYGVPAHRITFTGFPLPDA
FT                   LLGGPSLPVLKRNLAARLVRLDPTGEFRRSMPEELAVFLGALPREEEGKPAQLTFAVGG
FT                   AGAQAAMADAFLPGLRPALESGAMRLALVAGTRPEVEARFREALRRAGLEPLLGGAVEI
FT                   LRAPSFGEYYARFNALLARTDVLWTKPSELTFYGALGLPLVLAPPVGVHERYNRRWARE
FT                   SGAGLKQRDARFAAEWLSDWLADGLLAAAAWAGYMRLPKFGLYRVLEALGRTPAANVAP
FT                   "
FT   gene            299213..299947
FT                   /locus_tag="Adeh_0255"
FT   CDS_pept        299213..299947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0255"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80031"
FT                   /db_xref="GOA:Q2IMK2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80031.1"
FT                   /translation="MLAVFSFVYWIFFVLTLPFLFAVALVVFVLTAPFDPRRVALQLWS
FT                   CAWASFYVVVNPLWRSRVVGREKLPWNGAAVLVANHLSMLDILVLYGVFRPFKWVSKAE
FT                   LFRVPFVGWNMWLNDCVPVWRGDRESVRKMMAHCRAHLARGAPVMIFPEGTRSPDGRLQ
FT                   AFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGVVLRQRMRAEVRVLDPIHPSSFESPA
FT                   ALRDAVREAIAAALPPEHRPGA"
FT   sig_peptide     299213..299308
FT                   /locus_tag="Adeh_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.733) with cleavage site probability 0.553 at
FT                   residue 32"
FT   gene            complement(300521..301738)
FT                   /locus_tag="Adeh_0256"
FT   CDS_pept        complement(300521..301738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0256"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80032"
FT                   /db_xref="GOA:Q2IMK1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80032.1"
FT                   /translation="MAPHDAPGHEAVQAAPAPGRVDVLSALDRLLAIEPEEHALRRIVS
FT                   ALADAVPAVVAAALLVPDDEGRLAIAAEVGGEGRPPAPADGGAALAAGAPWVRADPGWP
FT                   LPAGARAGAAAAAGGGALLVMGTRGEGGFEPGALALLRLAADRAGLALERGRLRRARES
FT                   AEEAARRALAEVDSRRRAVDYILGIVGHDLRNPLGAVHMSAALLQKRGGLEGWQARAIE
FT                   RMRSSAGRMARIIADLLSYTRTRLGNGMPIDRRPARLDEIARRPVDELGAVNPGREITV
FT                   AVAGDLSGSWDPDRLEQVISNLVSNAVDHGDPDSPVRVELSGEPDACVLRVRNTGPPVP
FT                   PEVLEHLFEPFSRPPDEKSRKGSGLGLGLYISREIVRGHGGEISIASDGETVITARLPR
FT                   SPTPAP"
FT   gene            301954..303486
FT                   /locus_tag="Adeh_0257"
FT   CDS_pept        301954..303486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0257"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80033"
FT                   /db_xref="GOA:Q2IMK0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80033.1"
FT                   /translation="MSPTRPIEKVLVANRGEIAVRVMRTCREMRIPTVAVYSEADRGAL
FT                   HVRKADEAVFIGPAPARESYLSIERILDACRRTGADAVHPGYGFLSENAELARALDRAG
FT                   IALIGPPAAAMDAMGVKTTARRNMAAAGVPVVPGSEEPFAEEAEARAFAERIGFPVMIK
FT                   AAAGGGGKGMKKCDRAEDFAALWQSARREATAAFGDDRLYLEKFLEKPRHVEIQVFADQ
FT                   HGNCVWLGERECSVQRRQQKVIEETPSVVLDDRLREAMGEVAVRAARAVGYVGAGTVEL
FT                   LVDAHRNFYFLEMNTRLQVEHPVTEMVTGLDLVRMQLEVARGEPILAQEQVQRRGHAIE
FT                   ARVYAEDPARGFLPQPGKITYLRVPGGPGIRDDSGVYAGWVVPQWYDPMISKLVAWAPT
FT                   RPQAIDRLIRALGEYVVHGIGTNLGWLAAALDHPEFRSGDYDTGFCARNAKALVRPPDP
FT                   SLERVALVAAAVAAFKRERDAAEAHAARAGQGAARSGWARAGRLRALRGGGR"
FT   gene            303483..303995
FT                   /locus_tag="Adeh_0258"
FT   CDS_pept        303483..303995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0258"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80034"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80034.1"
FT                   /translation="MKTYVALLDGGKREVTVGVTRLATGQYEVRVGDEVHRVDAYAHDY
FT                   GTLSLLVDTRSYSAMLDDRGAKVHVQVDGSVFPLELLDERKLRMRRASPRASVEGRRAV
FT                   TAPMPGRVVKVLVAPGDAVRAGQPLVVVEAMKMENEMRSPKDGKVVEVRVVEGQAVEGS
FT                   ALLCAVE"
FT   gene            304068..305717
FT                   /locus_tag="Adeh_0259"
FT   CDS_pept        304068..305717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0259"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80035"
FT                   /db_xref="GOA:Q2IMK6"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80035.1"
FT                   /translation="MADEKKQRWLEGTYAKAVKKGPERRPRFETSSGIREEPVYGAGDV
FT                   RPGLEERLGLPGEYPFTRGVQPTMYRGRFWTMRQYAGFGTAEESNKRYRYLLESGQTGL
FT                   SVAFDLPTQMGRDSDHPRARGEVGKVGVAIDSIRDMEVLFDRIPLGEVSTSMTINATAG
FT                   MLLAMYQAVGEKQGAAPAVLQGTIQNDILKEYAARGTYIYPPEPSLRIITDIFAYTAKV
FT                   MPRWNPISISGYHIREAGSTAVQEVAFTLADGIQYVDAAVKAGLDVDAFAGRLSFFFNA
FT                   HNDLLEEVAKFRAARRLWARIMKERFHAKDPRSWMLRFHTQTAGSMLTAQQPDNNIVRV
FT                   TLQALAAVLGGTQSLHTNSRDEALGLPTEDSVRIALRTQQIIANESGVADVIDPLGGSW
FT                   AIEAMTDEIEGRAQAYIQKIDELGGMVHAISKGYVQREIQEAAYAWQRQVEAREQVVVG
FT                   VNAFKSDDPPVPVMKVDPALEAQQVERLKALRASRSAPAARAALDAVRAGARGTDNLMP
FT                   LILAAVKAECTLGEISDALREVYGEYRETVVL"
FT   gene            305724..307541
FT                   /locus_tag="Adeh_0260"
FT   CDS_pept        305724..307541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0260"
FT                   /product="DnaJ like heat shock protein with
FT                   tetratricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80036"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80036.1"
FT                   /translation="MSDAPPKPPGETPPPRTRPDVPAGPPRLERVPDGYRPPAVPRAAA
FT                   PAARPPPPPPPAPTYGLAAREVGADAAIAAGLAHQGALAADSALRLYGLAAATRASGRL
FT                   TLAPEGRSYALVFRRGAVEHAASSDPADDLGRFLLRKGVLRPEQLVEAEAARAAAGGDL
FT                   AAALVGARLVPPGDVAALLAEHGLALVARALAVEDGTWAWEPGVGPPPSGFPLGPPFAA
FT                   LCAAVRALELPAVKRRLGDREERAASRMAGRVRIEDLRLTPQEARAAALVDGERSPAEI
FT                   AAASPADAAAVLRLSLLLGELDLLAFGAPRRARAPAPGVAPPPARAATPTPTPRPTPTP
FT                   VPPPAAAPAAAAPRPPPPRPPPVAAAPAPRTTPAPAAVRRATALEPAALRATLASLQDA
FT                   DHFQVLGVKRDAPAAQVKVAYFQLAKLYHPDAIPTDAPADVRKLCADLFGRVSAAWAEL
FT                   GDEARRAQYLQELQSGGAPEVDVMGILQAENLFQTGTQLVKARRYDEALAKFLEALQLN
FT                   PEEPEFGIWKAWCEFLRADDKKRQQAQSAAAVEAGLKKNPRCAPGYLFLGQMAKVLGDL
FT                   ALAERHLRRGLAAAPDNADLARELKYLRK"
FT   gene            307554..308117
FT                   /locus_tag="Adeh_0261"
FT   CDS_pept        307554..308117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0261"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80037"
FT                   /db_xref="GOA:Q2IMK4"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80037.1"
FT                   /translation="MPAPTNPKKRALMPSSPLRRALRAAGHHLSPVVQVGKDGLTEAVL
FT                   RQLDEALLAHELVKMKVGTESPEDRLEIADRLLAEDVQVAQVLGRTVLAYRRHPERPRF
FT                   EPAPAGAAAERAERPEPRRAPGKGRRAPTRGPRAAAREQRAPAKGKRPLAKGKRAPANG
FT                   RRPPANGKRPATRRPAPRAKRTKR"
FT   gene            complement(308142..308453)
FT                   /locus_tag="Adeh_0262"
FT   CDS_pept        complement(308142..308453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80038.1"
FT                   /translation="MFPLLAAAALLLAFASWIRFRRLEQALVGELAALTARVKDLAERV
FT                   DAAEADVGHAVTQTEIAESLLLDKGIAEPEELEALRRRVDEDDAPAPAYQPERDGALH"
FT   sig_peptide     complement(308406..308453)
FT                   /locus_tag="Adeh_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.499 at
FT                   residue 16"
FT   gene            308583..309182
FT                   /locus_tag="Adeh_0263"
FT   CDS_pept        308583..309182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80039.1"
FT                   /translation="MTRAVKRLIRDVALRMPELGHVRASRVLVVAGEARRSSRATIRPA
FT                   HFGATRRRAGEGGAVKPLVRIKGRKILYVVTLRPLWFLASTPEERIGTILHELYHASNR
FT                   FDGTLHRGRRHSRFPRARYNRKIRTLLRAYLAQAPEDVVAPFAHQGVVRARMWLERPGS
FT                   FRAGEYSGRRLYTEKQLFYGLVRMRAGARRRGQPAG"
FT   gene            complement(309179..309748)
FT                   /locus_tag="Adeh_0264"
FT   CDS_pept        complement(309179..309748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0264"
FT                   /product="Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80040"
FT                   /db_xref="GOA:Q2IML1"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80040.1"
FT                   /translation="MPKTLTLPARPEDVRGLAAGDEVLLRGRIVTGREAAHRYLAAHDD
FT                   PQVRRWTEGAVLYHCGPVVARAPGGGWRFVAAGPSASGGHEPWEAEVIARYGLRGVLGK
FT                   GGMGPRTLAALRAHGAVYLHAAGGLAVSLARHVTRVLDVARLDALGVTEAIWLAEVEDF
FT                   PAVVTMDAHGETLHAPGAEPGTPAPG"
FT   gene            309958..310896
FT                   /locus_tag="Adeh_0265"
FT   CDS_pept        309958..310896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0265"
FT                   /product="Pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80041"
FT                   /db_xref="GOA:Q2IML0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80041.1"
FT                   /translation="MRREIRLPLTASGRLDRALADALGLGRAAVKRAFALGEVRVRGRR
FT                   ARASDPAAPGALVELDVELPAGPPEPEPDAPLAVLLERPRYLVVDKPAGVAVHPLAPGE
FT                   GGTLANAVAARHPECAGASPEPREGGAVQRLDLETSGCVLFARDPEAWEALHAQLGAHT
FT                   VDKVYLALAVGRVPAGGVCSVPLAQRGGRVLPAPDAEAEERLRARGLRPRPAETHYEPE
FT                   RRFAGHTLLRVRIVTGVMHQIRAHLALLGHPVAGDALYGGAAAELAGLERQFLHAWRLA
FT                   FDDPDGGGRVAVESPLPAELEAVLARLPAAR"
FT   gene            complement(310979..311425)
FT                   /locus_tag="Adeh_0266"
FT   CDS_pept        complement(310979..311425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0266"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80042"
FT                   /db_xref="GOA:Q2IMK9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80042.1"
FT                   /translation="MAMGLGSKRPVTDINVTPLIDVVLVLLIIFMVLTPLAEKQKFIRV
FT                   PEYQPEMQPVPPDSVPPDQTVLTALGNGNVLLNKQEMTINDAMQRLHVAYDGRPSKVMF
FT                   FNAEDSVRYEQAVKVLDAAHGAGVNTIGMMTDPPLTGGAAPEQQ"
FT   gene            complement(311428..311847)
FT                   /locus_tag="Adeh_0267"
FT   CDS_pept        complement(311428..311847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0267"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80043"
FT                   /db_xref="GOA:Q2IMK8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80043.1"
FT                   /translation="MSMDVGGKGVKSEINVTPLVDVVLVLLIIFMVITPMLQRGKPVVL
FT                   PDAKHVSALKQGGDPILVSVTKDGKIWIDKEEVQKADLSQMLTIAMQMQPGAPVLVKGD
FT                   RDVTYKTIREMIFEISKTHLMGVSLAASQIKDKEK"
FT   gene            complement(311883..312641)
FT                   /locus_tag="Adeh_0268"
FT   CDS_pept        complement(311883..312641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0268"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80044"
FT                   /db_xref="GOA:Q2IML5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80044.1"
FT                   /translation="MSLQVIQTLQQLASAQATPEVSFDLLHMWKTMGPFAKFIAGVLAV
FT                   MSIYSLGVMAERLVTFARAQKASRQFAAALRDLLPAAKFGEAVELSRKLKRGHLPKVLG
FT                   LAIEEYSHGVEALRTHGPRDVGQFDVIAAVNRAVERSSLRTVNDLRRGLGALATVGSTA
FT                   PFVGLLGTVAGIITAFQAMAATGSGGLGSVSAGIAEALVTTAFGLLVAIPAVMMFNYLT
FT                   NRVEDMQVDITDSATELMDFFMKEGRGEAK"
FT   gene            complement(312694..313488)
FT                   /locus_tag="Adeh_0269"
FT   CDS_pept        complement(312694..313488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0269"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80045"
FT                   /db_xref="GOA:Q2IML4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80045.1"
FT                   /translation="MLLFPADSPVNTSERNVFDEVTKQEGGKNAAKRAGYVFGSTLFQV
FT                   LLVFAIITASAAIKAKVIDEPVVDVKFVKAVPPPPPPPPAPPPPAARKRPPDEKPRTDL
FT                   PKPPPPTALLQPKDVQAEMKPPDPNEPPEPEYDYGDAAAGEGVVGGVVGAAPQQSQIED
FT                   APAYATAGYKKPQMAQPNCVQNSVRLPRELMGYISGPITVKFAIGRDGQPSRFEAMTNV
FT                   PDKRIGDAIWNAVQSCKWIPGADAQGRPTAIWVILPLRFTAG"
FT   gene            313952..317332
FT                   /locus_tag="Adeh_0270"
FT   CDS_pept        313952..317332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80046"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80046.1"
FT                   /translation="MRKKLLRLLRIAPLALLFAGVAFAQTTGTIIGVVTDASTGKPVAG
FT                   AVIVARSPNLQGEQTAVTDANGNYRITLLPPGAYSLAVQLEGFKPAERSDITMRADKTI
FT                   RANIAVVPEAVQMEEQVVRTGAAPVVNIGAAESGAVVSREFMANIPVGRSVENVATVVP
FT                   TAQADTYGVSFAGAQSPENSYIVDGLNVTDPVYGTFAGNPNSQTLTPTLQNNFVQEIDV
FT                   KTGGFQPEYGRTTGGVLNVVTRSGSNEYHGSVFTDFTPRMLIDPTGKIAGTNGEAIGWR
FT                   RKPNEGAYDLDFGFEVGGPIMKDKLWFYAGVAPIVTRTYTERFLQLNRLAADPDTGEMV
FT                   PVVNESSGLIEQDIVPGTEKVYRSGRTTYQYVGKLTYLLDENNNLTLSAVGMPTSATSI
FT                   SMAGGPSRRTFDESGNTFDGSLRYAGKFLEKRLIVEAQAGWHYNSSAPKDKTQAGVDQL
FT                   NTPTLQFRFRTPVTNFEQLDECANDGNQNARCGVNLYNIGGLGYLSDAVSNRLATRVSA
FT                   SYLSEFLGSHNTKVGVDFERSTFAQDKRYAGGYYYATTGNGIIYTRRGYGYVNTPDVPP
FT                   DDPNYGLIPTSRGTITGTSTVPGNVVFATRVQNTAGTNSTAVFAQDSWQLPQNVTLNYG
FT                   IRWEGQSLNNISNPSSNGFTINNSWAPRVQAIWDFTGSGRGKVAGSWGRFFYAMPLDLG
FT                   DRTFGAERSLLYYMPTSTVGGAPGCAIPGNATRGGMSSPTDQSLVSYDTRQLSPSACGV
FT                   TNWGGNYAQGGADLRNRNFLFGTSGTAASPVSPDISQAYVDQFGGQIEYEVLSDLSVGL
FT                   EYAGRRQGDIIEDMSPNDGLGYYIGNPTKGGEFTGSDGVVYNPSAPTATDTATGRVMVI
FT                   PFPKPERSYDGVTLSVRKNFSRGWQASASYTYSVLRGNYAGPYRPEDDQLDPGITSQYD
FT                   IPSIMTNQKGYLYGDRPHQIKLFGSYTWAASPRFSLTGGAAYTGQSGNPVSALAGYNDS
FT                   YDVSQTFVVPRGMGGRSPWTNKVDLRGAVEYVIKAPYALKFTVDVFNVFNSEDAVIMDQ
FT                   DYTFDMTQPISGAKCSNKSSVGKANPVQALQSACPDLKYLKTIDGRNVTVNPNWGRPAP
FT                   GTASFMMPLSLRLGLSLSF"
FT   sig_peptide     313952..314026
FT                   /locus_tag="Adeh_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            317355..318146
FT                   /locus_tag="Adeh_0271"
FT   CDS_pept        317355..318146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80047.1"
FT                   /translation="MKTLTKLALTLIAVAGLQACDPYEDENKGVPSVINVISSDSGTAY
FT                   EGTNTGTSWTISTPSAFVLFVKVNAGKLLDGASIQATTDDCTPANDWLSVNGAGPGNWM
FT                   SCYYPQSPAGFEGASVVLYPGPSISTVDSWFSLSELEPGIFNLAGTVSDKQGHPLAIDV
FT                   NAFVNDLAAAQSDTAGTEITTEFSDAGVNMTNVQLWEAPDVSGAPGTWTAVATTTPYVH
FT                   AGVAVGSTWWYKVTADTNGFPATAASFETAPVSVTTEPPAP"
FT   sig_peptide     317355..317414
FT                   /locus_tag="Adeh_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(318359..319018)
FT                   /locus_tag="Adeh_0272"
FT   CDS_pept        complement(318359..319018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0272"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80048"
FT                   /db_xref="GOA:Q2IMM0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80048.1"
FT                   /translation="MAEISAKMVQELREKTGAGMMDCKKALTEAGGDLVKAEEVLRKKG
FT                   LSAAAKKTGRAATEGAVASYIHMGGKIGVLVEVNCETDFVARTEGFQGLVKEIAMQIAA
FT                   ASPRWVRREEVPADVVAKELEIAKAQAREQKKPEAILEKIATGKVEKFYSEFCLMEQAW
FT                   VKDDKKKIQDVLTDAVAKIGENIQIRRFARFVLGEGLEKKQENLAEEVAKAAGLQK"
FT   gene            complement(319122..320027)
FT                   /locus_tag="Adeh_0273"
FT   CDS_pept        complement(319122..320027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0273"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80049"
FT                   /db_xref="GOA:Q2IML9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IML9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80049.1"
FT                   /translation="MKALLEAGVHFGHQTKRWNPKMKPFIFGARNGIYIIDLQKTVGLA
FT                   RNALRFVSDSVAKGGSVLFVGTKKQAQDAIREEASRSGQFFVTNRWLGGTLTNFKTVKQ
FT                   GIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKELSRLPSALFVIDTKK
FT                   EHIAVHEANRLGIPVVAVVDTNCDPEGIDYVIPGNDDAIRSIRLFTGKVAEACIEGKGR
FT                   YSAWVAEHGGHDERREQEDRDAASERGHKDRRDRRDRRGGPRERREPREDRAAASANVE
FT                   VVRKGEVAPAAAPEAAPAKE"
FT   gene            complement(320429..321493)
FT                   /locus_tag="Adeh_0274"
FT   CDS_pept        complement(320429..321493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80050"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80050.1"
FT                   /translation="MPRRRPASPRTRPGHPAAAAGEVRAPVRAGARGDVLLAWARDRDG
FT                   RKVNAGRLDPADRRRLAPFTCLGCGEPLVPHLGRVRARHFAHAPGSACPLTAPETALHL
FT                   DAKERLLALCAEAFERRRTVTVLARCPSCRRLAPRDLAAEGDAAAAEGAVGPLRADVLV
FT                   LRAGRPALAIEVLVTHAVEAEKEAALAAAGVPAVEIDAREEWERAEADGAVAIVPVRSL
FT                   GFPACPACAAGARADADRALGGEAAEIAELEAYRARGLLGPALRAPAVAGPGAAPGDAP
FT                   PPADAPFSEAERADLLARFACPDCGGSAIAFGARIARHPCPGRPTRPIAWRGYDGARIE
FT                   LTWWKRPAGPPPRR"
FT   gene            321815..322075
FT                   /locus_tag="Adeh_0275"
FT   CDS_pept        321815..322075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0275"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80051"
FT                   /db_xref="GOA:Q2IML7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80051.1"
FT                   /translation="MVGISKDAPAAQKKWKEKLGLPFPLLSDADTAVQQAWGVWKEKNM
FT                   YGKKVMGTERTTVVVGPDGKVEQVFPKVKVDGHVASVLESL"
FT   gene            322139..323452
FT                   /locus_tag="Adeh_0276"
FT   CDS_pept        322139..323452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0276"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80052"
FT                   /db_xref="GOA:Q2IML6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IML6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80052.1"
FT                   /translation="MTRKPHPQRPPRNDLVDALVLEVHGLVHDQGWLADRALERVLRRE
FT                   RALWANERRAVAEAVYGILRSQGQLDFLLGGSPPLATRYAAWLVRGAGVGPAQAAARLG
FT                   AAPRALAGLAEADARIAAIADPLDRFAVEASLPRWIAERLVSELGEAEARALAAVLNRR
FT                   APLTVRANALAGDREALRAALAAEGVPAEQTRFSPWGLTLDGHQNAFALEAFRTGGFEI
FT                   QDEGSQLIALACGARPGQVVVDACAGAGGKSLALAAEMHNKGSLHALDSDAGRLEDARR
FT                   RARRAHVHNLRTRVLPAGPEAEAALTDLAGKADVVLVDAPCSGLGTLRRKPDARWRLQP
FT                   GDPERFAAIQRELLGRFARLARPGGRIVYATCAMGRTENDDVADFAERELGLAPAPLAP
FT                   FLGAERARALGASESRCALYPHRHGTDGFFFAAFAKRA"
FT   gene            323468..324310
FT                   /locus_tag="Adeh_0277"
FT   CDS_pept        323468..324310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0277"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80053"
FT                   /db_xref="GOA:Q2IMM5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80053.1"
FT                   /translation="MPELPEVEIAARNLRRWAEGRRVEEVGWDPRARRIFRPATPAAFA
FT                   RAVEGARFAGIRRIGKHLLVSLERGGAPVGLLAHLGMTGKWVLRAAGDPAPRHARAWLR
FT                   LEGDGVLHFQDSRLFGRLRTVPGARFDEVPEVAALGPDPLEDGIDPAALAGALAASRLP
FT                   LKVKLLDQRLLPGVGNIHASEACYRARLDPRRPSRTLSRAGAKALAAGILASFRMTLDA
FT                   EDGPEITYVEEPGAENPFLVYAREGEPCPRCRRAGRTSPIRRIVQAQRSTFFCPRCQR"
FT   gene            324321..325172
FT                   /locus_tag="Adeh_0278"
FT   CDS_pept        324321..325172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0278"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80054"
FT                   /db_xref="GOA:Q2IMM4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80054.1"
FT                   /translation="MRPEDLARLSVAELRTRLLDRGEALGDACEAALEADPRAGAREVL
FT                   RLVRKRRRENRAEGQRLRHLLRYEAELWERGLVHVAGVDEAGMAPLAGPVVAGACVLPR
FT                   DYRPRGIDDSKQLDRAERERLAEDIKRNAVCWAVARAEVEEIDRLNVYWAGMLALRRAV
FT                   DGLSARPEHLLVDARKLPDLPFPQTPIVHGDALSLTIAAASILAKTARDALMAELDLAH
FT                   PGYGFARHKGYPTAEHFDALGRLGACPIHRRSFAPVRVALGLEPAQGDLFALAEAAVAE
FT                   DD"
FT   gene            325334..326983
FT                   /locus_tag="Adeh_0279"
FT   CDS_pept        325334..326983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80055"
FT                   /db_xref="GOA:Q2IMM3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80055.1"
FT                   /translation="MHEPSTKNDLFRPAYPAEDLEENRDRRPPPGLALDPPEAPPPEHP
FT                   PEIPVDRLDGDALKVIARLRHMHHQAYLVGGCVRDLLLGATPKDFDVATDAHPGEVRAI
FT                   FRNCRLIGRRFRLAHVYFRAGKVIEVATFRKNPTDVAEDVGEGEGDLLITRDNVFGTAE
FT                   EDSVRRDFTVNGLFYDVATGEVIDYVGGRADLEAHRISTIGDPEIRMREDPVRALRAVR
FT                   FAARLGFTIAPDTFEAMRRTAGELARCAPARVLEETFKLLRCGGSARAFELLRACGALP
FT                   VILPALGAALETWDDGRRRAFFAHLAALDRLVRSGAEVSEAVLLGALLMHLGADAPRAG
FT                   RPDADAGAPRWDEADAFLASLVQTARLPRKVAERIRLALQAQRQLEEPGKRRRRRGRGP
FT                   AGQTYFQDALQLLEIRVRATGSGGEALERWTAEAPHAHPAAERPGRAGPREDRRDHRRE
FT                   GAAPRRPDRDEGAVREVVIPVEAAEAADEAGEEVREVESSAAGDAGEGEASQGGRRRRR
FT                   RRGGKRRRRRGAGASGPDGGAQVPPAEAGGQG"
FT   gene            327055..327810
FT                   /locus_tag="Adeh_0280"
FT   CDS_pept        327055..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0280"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80056"
FT                   /db_xref="GOA:Q2IMM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80056.1"
FT                   /translation="MASEKASNPKARYQRILLKLSGEALMGDGKYGISPKTLTSIAHDV
FT                   KDVVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINSMALQDALEKIGV
FT                   PTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIVVF
FT                   DLTQRGNVRKVVLGEEIGTTVGRPSARNA"
FT   gene            327830..328396
FT                   /locus_tag="Adeh_0281"
FT   CDS_pept        327830..328396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0281"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80057"
FT                   /db_xref="GOA:Q2IMM1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80057.1"
FT                   /translation="MGTIADDILGDLHGRILKTLDQLRTDLSAVRTGRASLHLLDNVRV
FT                   DYYGTPTPLNQVATMSVPEARLIVVKPWEKSMIPPIEKAIREANLGLNPMSDKDLVRVP
FT                   IPALTEERRKEIVKQVKHKGEEHKIAVRNVRREAKELIEVAEKDGDISGDDAEKALEKM
FT                   QKETDDGVKKIDEIVAAKEKDVLQV"
FT   gene            328408..328611
FT                   /locus_tag="Adeh_0282"
FT   CDS_pept        328408..328611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80058"
FT                   /db_xref="GOA:Q2IMM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80058.1"
FT                   /translation="MARSPAALLLLLGPLLALGFAAGAVRALAARPDLPARRRRALSAA
FT                   WVLLLLAGAPLWLVAAALLGFW"
FT   sig_peptide     328408..328497
FT                   /locus_tag="Adeh_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.845 at
FT                   residue 30"
FT   gene            complement(328631..329059)
FT                   /locus_tag="Adeh_0283"
FT   CDS_pept        complement(328631..329059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80059"
FT                   /db_xref="GOA:Q2IMM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80059.1"
FT                   /translation="MRELLVFLHILSAATWIGAALWVPGDVKRTVALGRPFVEQLAARA
FT                   RPALKLDLYAGFAVLVTGVLLIGVDGGHPRTGILVGFAATLARLLVVGFASMPAWRRVE
FT                   GAVASGDLAAATAPARRLAMLGGIGHALWAIALAGMVF"
FT   gene            complement(329230..329733)
FT                   /locus_tag="Adeh_0284"
FT   CDS_pept        complement(329230..329733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80060.1"
FT                   /translation="MTKFAWSVLALALLGAPAAARAGGLLELSVGSGARIDPSPTERIP
FT                   TNVMLTAGYGFADMLKLELGAVANLGDVEDSKFDVDLRPMLVVSPPLFPVYLRGIMTVN
FT                   SLVEEPVKIGYGGALGVRLGVMGLGAFVEAGVLARIVEVPDAAGVTHDKTFTIVEGRIG
FT                   GYWD"
FT   sig_peptide     complement(329665..329733)
FT                   /locus_tag="Adeh_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 23"
FT   gene            complement(329868..331577)
FT                   /locus_tag="Adeh_0285"
FT   CDS_pept        complement(329868..331577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0285"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80061"
FT                   /db_xref="GOA:Q2IMM6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80061.1"
FT                   /translation="MARSGRIALAQVNTTVGDFAGNAARVRAAAEVARDAGAALAVFPE
FT                   LTVCGYPPRDLLDLPDFLERARQALEELARPAAWSKGIALVVGFPEAPAGAPPPGVYNA
FT                   AALISEGRVAAVGRKSLLPTYDVFDETRYFLPAGASTTAAAPEGLGVPLGLSVCEDIWN
FT                   DQRFWDRPRYARDPIADLVRAGAGLVVNVSASPYAMGKAPLRERMLSASARDHGAPIAY
FT                   VNQVGGNDALLFDGGSMLLARDGAVLARAPLFEEVVLVCDLDGGAPLALGLDGRPLPPP
FT                   PAPPADPQADEVLRALVMGVRDYVRKCGFRQAVVGLSGGIDSALTACVAAEALGAENVL
FT                   GVAMPSRYSSGHSREDAAELARNLGVGFREIGIEPMHAAFLAALAADGAPPLCDLADQN
FT                   VQARIRGQILMAISNDTGALVLTTGNKSEIAVGYCTLYGDMAGGLAAIGDVPKTLVYRV
FT                   ARAANARAGRTLVPERTFTKPPSAELKPGQLDQDSLPPYDVLDDILQAYVEERRPLEAI
FT                   VARGHDEATVRRVLRMVVQSEYKRRQAAPVLKVSEKAFGEGRRFPIAQGYRY"
FT   gene            331606..332511
FT                   /locus_tag="Adeh_0286"
FT   CDS_pept        331606..332511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0286"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80062"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80062.1"
FT                   /translation="MPRRILVAEASAPLLAPLRRPLRAAGVELDAISPAAASGRLGPAS
FT                   HVAAIVPGGAAGAEAVRAIRAADPLLPVIALFADEAEAAAAAQGEALGADGALVAPVGP
FT                   AAVVGACRLAERLRAATARAVEADARRLAAEAPRHAADLEFLKRLLPLEVKRSRRYGYP
FT                   VSIALVAVDRFAEVAGRLGPHGRTAVLAEVLGLLAASVRDIDLAAPFAGERFVVLMPHT
FT                   RAEGGLQVARRLCARIRERGAGEGITVSAGVAGHDGGGTVSFAGLVKRAAEALTRARAA
FT                   GGDRAEPAEPPRPRDRIVMG"
FT   gene            332516..333610
FT                   /locus_tag="Adeh_0287"
FT   CDS_pept        332516..333610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0287"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80063.1"
FT                   /translation="MRRSLAAALAAALAAALAAALAAALAALASAGGLAGCRRAGPELP
FT                   EVRLHASPDLPGEVVRDLAARFAVARVVLVPRAEDAEVAWASDPAALLALAPRLVPGSA
FT                   APDPATARFADPQGRFAPVAARARVLLVARDGRLPVDPVNLRDLADPRLRGRIALAHPS
FT                   RGAGPATCAALSLVYGEASVGRFLRLVAANAPVVVGSDAEVRAAVAAGRAAVGLAGSVD
FT                   GAAGAASAAALRVVYPDQAGRGAVVLPTAAAALAPAGGGAPSPAAARLVAWMAGRDAER
FT                   ILVARAPGLLPLRPETPVPVGVEPAGNLRALSLDWDRLAAEAARLAPLLERWPDGFAAA
FT                   GHGRAGATEAASPEGRPGRADHAP"
FT   sig_peptide     332516..332605
FT                   /locus_tag="Adeh_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.465 at
FT                   residue 30"
FT   gene            333965..334309
FT                   /locus_tag="Adeh_0288"
FT   CDS_pept        333965..334309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0288"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80064"
FT                   /db_xref="GOA:Q2IMN1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80064.1"
FT                   /translation="MAQIDIEILTPFAAKFMEGTSLTPAERAEVLRIAQGFACKDSAAA
FT                   AGVSPETIRARRKRIYRKLDVPGSGELLASLLSLSLKMLAKGERIEPRPVAPAQPQPAA
FT                   ATTSSAVMAR"
FT   gene            complement(334453..336450)
FT                   /locus_tag="Adeh_0289"
FT   CDS_pept        complement(334453..336450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0289"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80065"
FT                   /db_xref="GOA:Q2IMN0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80065.1"
FT                   /translation="MPNARPELVEKAVNTIRMLAADGVQQANSGHPGMPMGAADMAFVL
FT                   WTRHLRFDPAEPRWLGRDRFLLSAGHGSMLLYSLLHLAGFDCTLDDLKKFRQLHSRTPG
FT                   HPEYGHLPGVEITSGPLGQGFANGVGFALGHAMLSAKLGPANPVADAFVYAIVSDGDLM
FT                   EGVSAEAASFAGHHKLGRLVYLYDDNGITIDGKTSITFSGEDVTKRFEAYGWHVQSVDG
FT                   RDLDGIDRAIQAAKAELGRPSLVRVHTTIGFGSPGKAGKSSVHGAPLGEAELEATKKAL
FT                   GWPLEPRFLVPDDVRAYWAEVRAEKAAQKQAWSAAEHAWRAANPEQAALLDAHVERWVP
FT                   ERILDRARAELPAPDATRKVSQAILQKIAPLVPCLVGGSADLAESNLTEIKGAGSVAPG
FT                   SFAGRNVHFGIREHAMGAIANGLAYDGLFVPFVGTFLQFADYMRPPVRLAALSKLQAIY
FT                   VWTHDSIFLGEDGPTHQPIEHLTALRAIPNLHVCRPADPEETAAAWAHALQRRDGPTAL
FT                   VLTRQKLAPVKRSVPLDPEAILRGGYLVDAPAGATFTLAATGSEVPLAQAALEALAKQG
FT                   VVGRLASIPCLECFLAQPKAWRDEVVPPGQRVAVVEAARGTEWWQLAGRDGLVLGIERF
FT                   GSSAPEKALAEDYGFTPAQVAGRVARWLAG"
FT   gene            complement(336521..337117)
FT                   /locus_tag="Adeh_0290"
FT   CDS_pept        complement(336521..337117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80066.1"
FT                   /translation="MPSRLRRFLHLERPRDGGAAPDPATGAADRAARFGAVQPPGPAAA
FT                   GPSATGARLERFGAEPEPALQLLDRGDRLPFTRCLRCGMDSHALAVECPGCGAALDTPE
FT                   QRAADERLRVERARQAGEEARAAAARREAFAREEAEEAGARRALGEALAQEVGERERRR
FT                   LEAEGLGGGPGPLELGARVLRALGARWGRGGGGRG"
FT   gene            complement(337127..338665)
FT                   /locus_tag="Adeh_0291"
FT   CDS_pept        complement(337127..338665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0291"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80067"
FT                   /db_xref="GOA:Q2IMN6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80067.1"
FT                   /translation="MSAPGAAPRPQPAFVQELDTLVRARYPLVYLVTSEEQRLEAILDG
FT                   LADRHGKALLGWSVARGFRRLGGTRGPAPEDAKDPLAALAAIEQLAEPALVVLKDFHPF
FT                   LSDPAVVRGLRELGHALKATYTTVILLSPTLVIPPEIEKELSVLDVPLPGYRDLLELLK
FT                   EIVGVVRQSGRAQVELNQDDADQLIQAALGLTLSEAESAFAKAIATDGRLSRDDVPLVL
FT                   EEKRQVIRKSGLLEYFATDARLAGVGGMASLKAWLGRRGAAFSEAARRFGLPEPKGLLL
FT                   LGVQGCGKSLTAKAVAAQWRLPLLRLDMGRIFSGLVGSSEENLRRAIRVAESVAPVVLW
FT                   VDEIEKGLSGTQSSGVSDGGVTARVFGALLTWLQEKTAPVFVVATANRIEQLPPELLRK
FT                   GRFDEIFFIDLPLAAERREIFQIHLARRRRDPARFDLDALAAASEGFSGAEIEQAVVSG
FT                   LYDAFAEGVDLAQAHVERAVRESLPLSTTMREDIARLREWARTRTRPASAPAAG"
FT   gene            complement(338693..339133)
FT                   /locus_tag="Adeh_0292"
FT   CDS_pept        complement(338693..339133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0292"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80068"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80068.1"
FT                   /translation="MPPIRVYLVRHARAEASAGDDDARRLTPEGREGFAALVARLRARL
FT                   AIRGVLASPLVRARETAGLLAAAARAPVEEDPRLAAGACGGAELLALARAAGDGAALVG
FT                   HNPEVAEAVALAAGRGLEVRPGTIAAVDLGPASAALAWLEAP"
FT   gene            complement(339147..342176)
FT                   /locus_tag="Adeh_0293"
FT   CDS_pept        complement(339147..342176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0293"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80069"
FT                   /db_xref="GOA:Q2IMN4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80069.1"
FT                   /translation="MGAENGAGAANAAKVEELLGALAEALARGEGVTPRPASTYRLQLH
FT                   PGFGFDAAAALVPYLDALGVSDLYLSPVLASAPGSTHGYDVVDHARLDPELGGEEGYAR
FT                   LAAACRARGMGILLDYVPNHMGIGPWNAWWMDLLENGPSSVHAPAFDVDWTPLKSELAN
FT                   KVLVPVLGDQFGRVLERGELRLARDGGALAIRYFDHAFPVAPRSVPLVLRHGIERLREA
FT                   LGPEDPSLQELESICTALDKLAPRSETRPEAVAERAREKEVAKRRLAALYDASPAVRAF
FT                   VDENVAAFNGTPGDPRSFDLLQRLLDAQAYRLAFWRVAGEEINYRRFFDVNALAALRME
FT                   EPRVFAEAHRRVLALLRDGDATGLRIDHPDGLYAPAAYFRRLQACYLAERARALARARG
FT                   TALENGAEALLLERIFAALEGGGLPARPLYVVAEKVLAAGERLPEGWDVDGTTGYEFLA
FT                   AVNGLFVDPAAQRAFDALYARVAGGRQDYRRTVEEKKRLVMSSSMASEINMLAHRLSRI
FT                   SETDRRTRDFTLNELTRALVEYVALFPVYRTYVTRRREVDARDRAYVEATIARARRRSP
FT                   VVDPSIYDFLRDVLLQRYPEGLPDAARAAWLEFALKLQQATGPVTAKAVEDTAFYCFVR
FT                   LVSLNEVGADPDRFGTSPDELHALLAERRARFPGSLSASSTHDTKRSEDVRARISALSE
FT                   LPGELRAAVSRWARVNRAHVRRLEGRTAPDRRDEFLLYQTLLGTFPDGGLTPGTPAHAE
FT                   YVGRIQAYMEKALREAKVHTSWTHPDEDYEGGVRGFVAGALSSRAFLRDLGALAERAAR
FT                   AGRISSLAQVALKLAAPGIPDVYQGTELWDLSLVDPDNRRPVDWARRARALEAIQAELA
FT                   RGPEARRALARRLSAPDALAGGEAKLLLLAEGLRLRRRERTLLLEGDHRPLAAEGPLAG
FT                   HVVAFARTLGGRAVACAVPRLVLRLQDQGGGAPRWEGRLPLGGLAARWVDVVTGTVHRG
FT                   DAPALADLFADFPVALLASE"
FT   gene            complement(342213..343772)
FT                   /locus_tag="Adeh_0294"
FT   CDS_pept        complement(342213..343772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0294"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80070"
FT                   /db_xref="GOA:Q2IMP2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80070.1"
FT                   /translation="MSRQAGVLLPLFSLRSQADWGVGEIPDLVPFARWCADAGFSLALL
FT                   LPVNEASRGQNSPYGALSAFALDPVYLAPSALPDFQAAGGLDALSPDERALLAAVRAAP
FT                   AVRWDEVRRLKRRALEIAFARFERDEWSRRTDRARALEAFARQEAGWLDDYALFVALHD
FT                   EAGGRAWTEWPAPLRDRDPAALATARARHAREILFQAWVQWQAEEQWRRARAAANGAGV
FT                   ELGGDLPFMVAPDSADVWARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDVMAREGY
FT                   PWLTARARRMADLFDLYRVDHVVGLYRTYYFPNDGGPPAFVPSEEGAQIANGERVLGIF
FT                   SEGARVVAEDLGVVPDFVRASLERLRIPGYRVQRWEKNWEAGGNAFRDPARWPPVSVAT
FT                   TGTHDSESVADWYEALSREERGQLLALPELEPLRGRAPERWDDGVRDALLALVYGAASD
FT                   LALVPFQDALGMRDRVNVPGTVTGENWTFRIPMDLGALAADAAARTRLRELAVRAGRAP
FT                   PG"
FT   sig_peptide     complement(343716..343772)
FT                   /locus_tag="Adeh_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.981 at
FT                   residue 19"
FT   gene            343899..344870
FT                   /locus_tag="Adeh_0295"
FT   CDS_pept        343899..344870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0295"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80071"
FT                   /db_xref="GOA:Q2IMP1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80071.1"
FT                   /translation="MSSRGRFAPSPTGPLHLGNARTALLSWLAARTAGSAYVMRVEDLD
FT                   GPRVRPGLEARILEELRWLGLDWDEGPDVGGPLGPYRQSERLPRYAAALERLRAAGLAY
FT                   PCFCSRAEIAAASQAPHGASDEGPRYPGTCRELSPAEVARRSASRRPAWRLRVEPGPVA
FT                   FEDGVHGPVAHDVAAEVGDFVVARADGVPAYQLAVVVDDAAMQVGEVVRGDDLLPSTAR
FT                   QLLLYRALDLAPPRFAHVPLVVGPDGARLAKRHGALSLGELRSRGADPRAVVALLAGLS
FT                   GLAAGHPHDACTPRELIGRFSLARLPRAPAVLSPERIAALLP"
FT   gene            344867..345460
FT                   /locus_tag="Adeh_0296"
FT   CDS_pept        344867..345460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0296"
FT                   /product="tRNA-(MS(2)IO(6)A)-hydroxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80072"
FT                   /db_xref="GOA:Q2IMP0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80072.1"
FT                   /translation="MIAYTARVRLLRSPTDPRWTAVALAELDRTLQDHAHCEKKAAASA
FT                   LKLVADHPERAAMVRALAKLAQEELQHFLAVLAELGRRGTALPPDEGDPYAQALLRHVR
FT                   GGPRPEDRLVDRLLVGALIEARSCERLSLLAGALPDPRLRELYARLAQSEAGHERLFVD
FT                   LAREVDPAADARLEALAAEEARVVAALPLLPRIH"
FT   gene            345460..347595
FT                   /locus_tag="Adeh_0297"
FT   CDS_pept        345460..347595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0297"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80073"
FT                   /db_xref="GOA:Q2IMN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80073.1"
FT                   /translation="MAPDAAAPAAVPGPGPGPGDAPRRGRRAPWGGAAAAAAVLVVGGA
FT                   LLQQHEIAEERGRRRAVLERADLAARAIEDDLSRSLAAAHALAALVRHADIDRFEEVAD
FT                   DLLAHYGGISSLQLAPGGVLTRIHPLAGNEAALGLDLLADPGHRASAERTIQSRELTAE
FT                   GPFELRQGGQGVVGRIAVFRPAPGGGEAFWGFVAVAVRLPEVVSRTRVAALSAAGLDWA
FT                   LRRDGAAQPFASSGGALPRLAVAVKVRLPGEAWELDVAPREGWVRWGGLVMPAALLVLV
FT                   AAAIGLLAQRLLRLPEELRRAVDERTAALALANRRLAAELVERQRAEEARQAAEAQARH
FT                   GQKMEAVGLLAGGIAHDFNNLLTGILGYAELLGEPGTAADEAAAGIRQAARRGAALTRQ
FT                   LLGFARRGKYQQVPVDLHALVREVSELLERTLDKRIAIRHQLAAGTAVVRGDPDQLQQV
FT                   VLNLAVNARDAMPSGGTLTFETAEVELDAEGTRARPGLAPGRHVAITVADTGVGIPAAV
FT                   RERVFDPFFTTKPAGQGTGMGLAMVYGIVQNHGGWVGFESEEGRGARFTVLLPEAPAAE
FT                   RDEGVPAGAPEHGAGRVLVADDERGVRETTARLLRRLGYDALPAASLAEALEVQGRGAL
FT                   DLALVDLAMPAGDGPETLRALRRAQPELPAVLMTGYGLDARVRDALQGGFRGILHKPFS
FT                   VEELAAEVARAVRRRGA"
FT   gene            complement(347873..350584)
FT                   /locus_tag="Adeh_0298"
FT   CDS_pept        complement(347873..350584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0298"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80074"
FT                   /db_xref="GOA:Q2IMN8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80074.1"
FT                   /translation="MLAPLATLAALALAAGPAAPPLELTTFSLPNGLTVVLAPDHRLPQ
FT                   VAVDTWFQVGSKDEAPGRTGFAHLFEHLMFMGTNRVPGNRFDVIMESGGGSNNASTSSD
FT                   RTNYFSVGPSQLLPTLLWLDADRLQALADAMTQEKLDLQRGVVRNERRQSYENTPYGAA
FT                   ELVIPEVMYPQGHPYHHPVIGSHADLEAATLEDVKGFFRTWYVPANATLVVAGDFRPDE
FT                   VRPLVERMFGAVPLRAPPAPARAAPVRLEREVRRILSDRVELPKLILVWHAPAAYADGS
FT                   AELELLADVLAEGPSSRLDRRLVQELRLAESVTAYLDPGRLGSLFRVEVTATPGADLER
FT                   VKREALAVVAELQAKGPEARELARVRAQAERRRREEREHLVHRADKLNEYLAYYGEPDG
FT                   FARDLARVTSATAGGLREAARGLGEGRLDLRVLPARAGAGAAKAEIPDAPPPPLATRPF
FT                   DPPAPEVFRLANGLEVRVAPRPGTGLFAAHLLLPGGAAAVPAEKAGLAPILAELLTSGA
FT                   GGRSAAEYADAIRALGASVEAEARPASLQVSVSGLSAHLAPALDLFADAVLRPNLARAD
FT                   FEREAALALARVEARPDDPRKVAPVVAAAAIFGRGDPRGRPVDGWAATVRTVTLDDVRR
FT                   LAPRLLDPRGATLVVAGDVDPAALRRLLAPRLGAWRGAGPAPAASPAALTAAQGGRILL
FT                   VDRPGAPQTRILLARPVAPAPEPARALRELVNVVLGGSFTSRLNQNLREKHGYTYGARS
FT                   AFATEGGQGLFTAGAAVQTEVTGAALVELRRELDGLAAAGVDAAETAKARETARHRTVE
FT                   EIQTTAGLAEALAAAVLEGRPPDALRREAEALTAVEPARAAAEAKAGPYAFGGFTVVLV
FT                   GDRKTVVPQLEKAGFPRPAAVDPDGTPIPDPE"
FT   sig_peptide     complement(350513..350584)
FT                   /locus_tag="Adeh_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.474 at
FT                   residue 24"
FT   gene            350769..352106
FT                   /locus_tag="Adeh_0299"
FT   CDS_pept        350769..352106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0299"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80075"
FT                   /db_xref="GOA:Q2IMP5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80075.1"
FT                   /translation="MRAVRLQDLTRVGLWIALYVLLALYPLLWLAAVPAPGGGDFRQEL
FT                   AAALGFLGLSIMAMQFLLTARFQWLAPPFGTDVVYAFHRHVTAVALVFVAAHPLVLLGP
FT                   ELGVGGMAAWLLPWRAPGAVGAGVWSLYALVVLAVTSYGRRRLRLPYEAWRVLHGVAAT
FT                   AAVLLGLWHAAAARRLLAGPVTRVMWIAWTLAWVALLLRVRVAKPLALRARPYRVSEVR
FT                   PERGDAVTLVLDPDGHEGFRFRAGQFAWLALGASPFAAREHPFSISGSSQRAPRVELTV
FT                   KALGDFTRRVQATRPGARAWVDGPYGTMSVDAFPDADGYLFVAGGIGIAPCLSMLRTLA
FT                   DRGDRRPHQLVFGTGRWERTPFREALAELATRLDLTVVHVLEHPPDGWTGEVGVVGEDV
FT                   LRRHLPRGHRGCFVCGPPAMMDAVEKALVRLGVPLRDVHSERFDLV"
FT   gene            complement(352187..352627)
FT                   /locus_tag="Adeh_0300"
FT   CDS_pept        complement(352187..352627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80076"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80076.1"
FT                   /translation="MNLWKLAPAALLALAAPALASAGEEGGCENCPAHKAHAEHGAKAV
FT                   PAAATAAAGTVKKGVRTIPVTVTSDGFTPAEVKAKAGETVKLVVTRKVQRTCATEIVMK
FT                   DFGVNQPLPLDQAVTVTVKPKQPGTYRFACGMDMIAGNLVVE"
FT   sig_peptide     complement(352559..352627)
FT                   /locus_tag="Adeh_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.551 at
FT                   residue 23"
FT   gene            352630..354318
FT                   /locus_tag="Adeh_0301"
FT   CDS_pept        352630..354318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0301"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80077"
FT                   /db_xref="GOA:Q2IMP3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80077.1"
FT                   /translation="MSPDRVRPITTAWGVPAREGGEVPGIRRLRPGARCRRPLHCDRGG
FT                   HGCGGRRRPRRPEGCAATAGSDPAGRETSAMMHATGTAKRLALGLGALVLLLAIASAAA
FT                   IIGSARIHRGIAETMRREEGVRLSLELASAVRDQYAHQAHTIIIGDASHLGFYADARDT
FT                   VLRLTRALREAADRPEERSLVDRIESESGRLDRIFRDSIVPAVLRGERQSVQEEHGRAQ
FT                   LVVTHIQDLTQELVSRFEAQIAQARAGADQAERRTLAVLVAILVAAPLVAAAVSLAIGR
FT                   SIAVPVAQLQAGAARIAEGDLETRIEVRGAPELVSLARRWNEMTAALRDHQEQLVRSEK
FT                   LAGIGRLAAGVAHEINNPLGVILGYAKLLRKKADGTLAEDLAVVEEEALRAKHIVDGLL
FT                   DLSRPLPPPSEQVDLRALAEDVVARLREARLLDGVSAEVEGAATAPGHAEKLRQVLVNL
FT                   VRNAGEAAGPGGRVAVRLREREGVAELTVQDSGPGIPAAARGKMFEPFFTTKPGGTGLG
FT                   LAVSRAIARAHGGELAVAAAAEGGACFALTLPGAVRRRAAGGAKP"
FT   gene            354315..355712
FT                   /locus_tag="Adeh_0302"
FT   CDS_pept        354315..355712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0302"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80078"
FT                   /db_xref="GOA:Q2IMP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80078.1"
FT                   /translation="MTGGPVRVLVADDKENMRKLLAKILADGYAVEEAEDGARALSLVA
FT                   TRAYDVVVTDIRMPGADGFELLGAVKARAPDTEVVMMTGYATIPDAVRAMRMGAFDYLE
FT                   KPFDPDAALAVVARAAEQKRIADAARRDGDGAGEPSSFHNLVGRSARMRAVYGLLDKAA
FT                   GLDITVLLLGETGTGKELAARAIHYHSARRERRFVPVNCGALPADLVESELFGHARGAF
FT                   TGAAAAKAGLFEEAQGGSLFLDEVGELPLPAQVKLNRALQEREIRRVGDTQPLKVDVRV
FT                   IAATHRDLREEVRAGRFREDLFYRLHVFPVTLPPLRERAEDVPLLAQHFLAKHARALRR
FT                   ELAGGFEPEALRRLAGYPWPGNVRELENAVERAVAVSSGDRVRVADLPAEVAGAAPAGP
FT                   EPADLAKLPYKEAVAEARDRTSREYLVALLAEFGGNVTRAAERAGMERESLHRLLRRYG
FT                   LRSDDFK"
FT   gene            355792..356271
FT                   /locus_tag="Adeh_0303"
FT   CDS_pept        355792..356271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0303"
FT                   /product="protein of unknown function DUF456"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80079"
FT                   /db_xref="GOA:Q2IMP9"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80079.1"
FT                   /translation="MEILLYALGAAALVAGVAGVVLPVLPGSLLLVAGAVLVAWAGDFQ
FT                   RVGWGTVAVAAVLSVAIWAVDWLASVLGAKAFGASGWAVAGAGVGLLVGFFLGLPGIVL
FT                   GPAVGAIAFEYARNPDVKRALKAGAGAFLGFVLGSAVKVALAFAVVGAVALALIW"
FT   sig_peptide     355792..355893
FT                   /locus_tag="Adeh_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.304 at
FT                   residue 34"
FT   gene            complement(356290..357129)
FT                   /locus_tag="Adeh_0304"
FT   CDS_pept        complement(356290..357129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0304"
FT                   /product="Fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80080"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80080.1"
FT                   /translation="MARRVAPVGASPSPAPVSGRAEGGVLTCPPSRGGLAAQRRSRPGT
FT                   PHWGEAMIGSRVAVLASVLAAALACERAAPRPGPSAASVAPAAAPRAPAPPRELDARAV
FT                   TDRHVVLRWQPAAGAAAYEVLVGDRVLPADAPPLDDRGVGPARAYCYAVRAVDAAGNRS
FT                   PATPAACVRTPDLVAPTAPGAPAASAQGTESAVISWSPSHDDVAVAGYELLRDGAVVAR
FT                   ASAGVTHALEAGLAPGREHCWSVRARDAAGNASAAAGPACAHTADAPPARRFPAPAP"
FT   gene            357181..358320
FT                   /locus_tag="Adeh_0305"
FT   CDS_pept        357181..358320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80081"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80081.1"
FT                   /translation="MPRRPRLARLRAAALASLLAALAPAGAAALAPDAPLGAWTPGPLR
FT                   GLSLDMPLEDARGVPSPIVDVRWVAANAWSVPTVLERGGDRVMVRLDAQTDVLQASVAL
FT                   PWRRAWVGAVAERLGTRVEARLLRTWGGWTDRPIEAWHGLVGSWNFQREAWSRDVVDVR
FT                   LGRDDGRGIAVAGPRTALGDVAVRTALRIAGDGAGGPGRLALALRLDVKLPTGAPSRLG
FT                   GSGSPDLGLGLAATWTPARWLTGHGMASLRAVGPLPRGAALRPRPLQAGIEASLVARLG
FT                   DHLALILEDRLLAPSLGSHRWTLSPEVERPQASAWYALFRAHDQISAGLRAGEVTVYFS
FT                   EDFTPGTRHARDAREGGQAWFYDSNAPDLALGVAWTRRL"
FT   sig_peptide     357181..357270
FT                   /locus_tag="Adeh_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.476 at
FT                   residue 30"
FT   gene            complement(358315..358935)
FT                   /locus_tag="Adeh_0306"
FT   CDS_pept        complement(358315..358935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0306"
FT                   /product="molybdenum cofactor cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80082"
FT                   /db_xref="GOA:Q2IMQ3"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80082.1"
FT                   /translation="MTETAETLGFGGLVLAAGPSVRMGEPKQLLLWRGEPLVHRAARAA
FT                   VEAGLWPVVVVVGACAEEVRAALAGLPVATVLNRDHAAGVSGSLRRGLSRLGECAPSLA
FT                   GAVILACDQPGVDAAHVAALAGALRVTGRPVAASADGGALMVPALFSAALFPELRALDG
FT                   DEGAERLLSRDPARVAPVPLAHGGCHVDTPEDWRRARLMGGGS"
FT   gene            359181..360164
FT                   /locus_tag="Adeh_0307"
FT   CDS_pept        359181..360164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80083"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80083.1"
FT                   /translation="MSHLPACRLLLALACALAAGTAVGGTPREPVATFSIAARDPATGE
FT                   LGVAVASRFFAVGTVVPWAKAGVGAVATQAFCNTSYGPRGLDLLAKGATPAETLGILLR
FT                   SDPERDLRQVGIVSAAGASATYTGKGTNAWAGGRSGPDYAIQGNILTGEAVVAAMERAF
FT                   VGGKGSLADRLYAALAAGDAAGGDSRGRQSAALLVVKEGAGYGGFDDREIDVRVDDHPR
FT                   PFEELKRLLDYAQMNAAWNEGWTAFRRKQLPAALAAQERAAARAPANGEVLYDLAVIRL
FT                   AAGQRAGALEALRRALAANPKLGAQARTDADLAALRGDAAFEKLVR"
FT   sig_peptide     359181..359255
FT                   /locus_tag="Adeh_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.969 at
FT                   residue 25"
FT   gene            360166..361359
FT                   /locus_tag="Adeh_0308"
FT   CDS_pept        360166..361359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80084"
FT                   /db_xref="GOA:Q2IMQ1"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80084.1"
FT                   /translation="MGAAARRALAGALALAAAMGIGRFAYTALLPGVQRGLGFDDAAGG
FT                   AIASANLVGYLAGVLWARRLAGSARRGAALRLGLAATAVLTAAVTAVGSEMGWAAVRFG
FT                   SGVASGLVFVLASAAALEVAPGHLPRPGVLYGGVGVGIALAAVVAAVAPPAGGWRIPWW
FT                   VLGGAAAALAVPGWRDLSAPLAHDSGSGGAGSGGAAVASGRGRPAVGFGRLATAYFLEG
FT                   LGYIVSGTFAVAAVRRTPGLEALAPWTWAMAGLAAAPSALLWASFGRRVGVRSALVAAH
FT                   LVQAAGMALPSLSSAAWAALAGAALFGGTFIGITTLTVAAAREIRPNALGRAVGTLTAI
FT                   YGVGQIVGPLAAGAVAQHLGDPRPAVLGAAAAVALGAVVLLMPSRPSVMAPAPDRGR"
FT   sig_peptide     360166..360249
FT                   /locus_tag="Adeh_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.512 at
FT                   residue 28"
FT   gene            complement(361374..362267)
FT                   /locus_tag="Adeh_0309"
FT   CDS_pept        complement(361374..362267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0309"
FT                   /product="protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80085"
FT                   /db_xref="GOA:Q2IMQ0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80085.1"
FT                   /translation="MTAPRQVLSGVTYHVTRRCAQRDLLLRPSELVNETFLYVLGVALR
FT                   RYGLLLHGFCVLSNHFHLVLTDPGARLPAFEQYLDSLVARSINAALGRWEAFWASGSYS
FT                   AVALATPDDVVDTLAYALANPVSAGLVSRGSEWPGLWSSPERIGAGPIVARRPEHFFRR
FT                   NGSMPESVELELTLPPGFDDVVQFRDRLVDASTRRELVATERLKAEGRTFLGVRRVLAQ
FT                   SPNARPATVAPRRGPKPRVGARDKWKRIEALGRLRTFLDDYREALKALRAGLRDVVFPS
FT                   GTYRLRVAHGVRCAPG"
FT   gene            362431..362634
FT                   /locus_tag="Adeh_0310"
FT   CDS_pept        362431..362634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0310"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80086"
FT                   /db_xref="GOA:Q2IMQ7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80086.1"
FT                   /translation="MPYVNIKITREGATAEQKATLIRKVTELLRDELGKNPSTTVVVID
FT                   EVDTDNWGIGGESVTVRRKRGS"
FT   gene            362684..363454
FT                   /locus_tag="Adeh_0311"
FT   CDS_pept        362684..363454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80087"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80087.1"
FT                   /translation="MQPWETVERAHAPDGTELVLARRGGEWVVRAAGHVLMSSRAHGSE
FT                   EALAALALERCARPRAVLLGGLGLGFTLRALLDRLPPDAKVVVAELLPELAAWNRGPVA
FT                   DLAGRPLEDPRVRVQHGDVLARISEARGAYDAILLDVDNGPSALAHAGNHRLYGDAGVH
FT                   ACRAALRQGGTLAVWSAGPDERYLSRLERAGLEARSVTVPARGRATQGGGGVRHVVFLA
FT                   TAPAQGGARRPVTPPRAGGAGRGPGPHARGARGR"
FT   gene            complement(363427..364398)
FT                   /locus_tag="Adeh_0312"
FT   CDS_pept        complement(363427..364398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0312"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80088"
FT                   /db_xref="GOA:Q2IMQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80088.1"
FT                   /translation="MAITRLPPHPFSLRQLQYAIAVADTLSFRRAAERCRVAQPSLSTQ
FT                   VAQLESALGVRLFERDRRRVLVTGAGRPLLELMRRLLLQADDLQEAARQAGDPLAGALR
FT                   VGVIPTISPYLLPAIAPALRDAYPALRLTWLEDRTAELVRSLHAGTLDAALLAVEAELG
FT                   DVEVAPVARDAFVLATPPGHPLGAARGPASAAELRDASVLLLEDGHCLREQALAFCSRA
FT                   RTRELEYRATSLSTLAQMVAGGAGVTLLPELAVPTETRRADLRLRPFADPAPFRTIALV
FT                   WRRSSPIAEALRRLAGTVKTAYPAPAGRPAGPERQRPRAPRA"
FT   gene            364515..365051
FT                   /locus_tag="Adeh_0313"
FT   CDS_pept        364515..365051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0313"
FT                   /product="Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80089"
FT                   /db_xref="GOA:Q2IMQ4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80089.1"
FT                   /translation="MLTVGDRFPEFSLQAVTSLESGNEFETITQASHPGKWKVVFLWPM
FT                   DFTFICPTEIAEFGRRNGEFQDRDTQVLGASIDTHYVHLAWRKSHPDLKNLPFPMLADT
FT                   RRELSGALGVLHRDGVALRATFIVDPEGVIRHVSVNDLSVGRNVDEVLRTLDALQTDEL
FT                   CPCNWKKGESTLQVA"
FT   gene            365055..365615
FT                   /locus_tag="Adeh_0314"
FT   CDS_pept        365055..365615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0314"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80090"
FT                   /db_xref="GOA:Q2IMQ8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80090.1"
FT                   /translation="MAALDAIREALPEPARDIKLNLQAVLQPGPLTPAQRWGVAVATAA
FT                   AARNERLLAAILADARAEVEPAVVEDALAAAAVMAMNNVYYRFRHMVGKPSYSEKPARL
FT                   RMNRLVKPAASKLDFELFALAVSAVNGCETCVRSHEQVVVGGGVSEDQVHDAVRIAAVV
FT                   HAAAVALELAGHAAAPSAAAAAG"
FT   gene            complement(365617..367563)
FT                   /locus_tag="Adeh_0315"
FT   CDS_pept        complement(365617..367563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0315"
FT                   /product="transcriptional regulator, SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80091"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80091.1"
FT                   /translation="MMHPSPNWTVHLLGAPRLAGATAMVRLDRRTAALLALLAIDGPQP
FT                   RSRAAGLLWPESPEKTARANLRQLLRRLREAAGGDLVGAGDPLELSPAVSVDVRGGPRP
FT                   EEAWPDGRLLDGVDLEEAPELSEWLTGARRTLDAARLDAALAAAARLEAAGRLGAALAE
FT                   VQRALALEPLSEEAHRREIRLRYLGGDRAAALAAYERCRATLRATLGVEPSSETSRLAD
FT                   EVARGRRVPARPAGAASLPLSVTRPPALAGREREWALMEEAWAAGKGIALGGAPGVGKS
FT                   RLMQDFLSTHARPLFFEGRPGDRAVPYGTHARTFRETLGALSSAGVALPPWVRAELARM
FT                   LPELGPSPGPLATEADRVRFWNAKLEAMRVAFRAGFDALGFDDTQFVDPASAAAGTYVL
FT                   EQLLRDTETPLRTVHCFRTAEMPPDVLAHIRALAEAGRALYLELEPLADDAVEELVRSL
FT                   DVPGIERVAAEVARYAGGSPLFALETVKHLVETGAVERGIPDRTPPRLEALLRARFERL
FT                   SAPALQLARALGVLGTDFTLERAAAVVEARAMDVAVGWSELEAAQLVRGTAFGHDLLAE
FT                   AVVAATPAPLRSFLHRRAAEVLAATDGAPGRIAAHWERAGDPIRADACRREAESAARTT
FT                   LLATEAAGYFRAA"
FT   gene            367966..368991
FT                   /locus_tag="Adeh_0316"
FT   CDS_pept        367966..368991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0316"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80092"
FT                   /db_xref="GOA:Q2IMR1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80092.1"
FT                   /translation="MIRSPEAHPRRALPAQGATSARRSLLRLISADAPDAAASAGRAPA
FT                   GPAPAAVARAIAGAERRPLAWVDRDGVLRLANAAFAALLGAEPPSLEGRSACDLLCADA
FT                   PGRAQALLRAAFRGALHRTELTAVRGGRTYGLKVELAAVGRGASAALCIDVHEVVERAA
FT                   APVACATAGDLDYRISAGASDFGRLLALSGAGAEAALRVGRRCHEVLHGRPSPCPGCPA
FT                   LRGGGEAWPRVEVRRAPRTGGFQVATATALPGDEVLISVRRVDDAALAAVREARTAELV
FT                   RRFELSPREEEVLRLLLIGRQAADIGTALGITPRTAKFHQANVLRKLGASSRRDLLGLA
FT                   S"
FT   gene            368988..369845
FT                   /locus_tag="Adeh_0317"
FT   CDS_pept        368988..369845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0317"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80093"
FT                   /db_xref="GOA:Q2IMR0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80093.1"
FT                   /translation="MTRARSEPDWGAIALAMLERGREPAAWVDAAGTVRLATASLERLL
FT                   GAAPRALEGRPVAAVLTGAPALADGRVEREVTTAAGRRLRVALEPGCEPACEPGALLRV
FT                   LEVLGDLPGLGAGELDYAIETAPGAFGRLAWVRPLGGAALEPVPAARCHEALHGRSEPC
FT                   ADCPVRGGGTWPRVHARTLAPAPGYEVVTAAPEGAERVHLTVRRLAEAAVHGLVEARAR
FT                   ALARGAGLSEREEAVLNRLLQGEGLADIGRALGITLRTVKFHQANLLRKLGAESRADLA
FT                   RVLM"
FT   gene            369960..370739
FT                   /locus_tag="Adeh_0318"
FT   CDS_pept        369960..370739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0318"
FT                   /product="split soret cytochrome c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80094.1"
FT                   /translation="MRDESIGRRGWIKLVGGAAGAGAALVVARQAGAAPPAAGKGLQAI
FT                   PWPYAPLDPDATAERAFKGYLEGHCMYGAFDALAGQVADKLGAPYTSFPTKLFTYGAGG
FT                   VAGWATLCGALNGAAAAFQLLSPKPEPLVDALFRQYEQASLPDWVPASAKFPNVKSVAG
FT                   SVLCHASVSAWCKASGKKAYSPERKERCGVLTASVARHAAIILNAQHAGKAFPVLEDKA
FT                   TAECVSCHEKGGVLENTRAKMACGGCHFNLGTKHPAI"
FT   sig_peptide     369960..370061
FT                   /locus_tag="Adeh_0318"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.950 at
FT                   residue 34"
FT   gene            370763..371896
FT                   /locus_tag="Adeh_0319"
FT   CDS_pept        370763..371896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0319"
FT                   /product="Phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80095"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80095.1"
FT                   /translation="MTLTPLLLALSLAQTPPAADPAAAAAQPAPAPVKAAPTLAGALAN
FT                   APKPTFWGFINAQYSRTEGLNGADDTSTFEIRRARIGARGKVHDLVGYSVLFDGADSKL
FT                   KDAYVSVFALPGVEVRMGQWKTPFGYEQYESDTKLLWVNTSYVVGSLARGPDSRDLGAG
FT                   LLVQTPKLGPVSAEVLGSFVNGAGPNKKDDLETKNFWGRAGLTLKLPSITLKAGGSYGT
FT                   GQQIQATGANGTFDGVGTPIDDTYFYFHTYGADATLDTPWFFAAAELIQSERDLSRYTT
FT                   TAPITAATRSSRTARGWYAGAYGKTPWNLGPIFRAERFDADRTAAGGRLERYTIGAYVD
FT                   VIPVNARLILNHELDQGQTGAAGRTGDRTTLFAQVIF"
FT   sig_peptide     370763..370822
FT                   /locus_tag="Adeh_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.584 at
FT                   residue 20"
FT   gene            complement(371948..372721)
FT                   /locus_tag="Adeh_0320"
FT   CDS_pept        complement(371948..372721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0320"
FT                   /product="BioH protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80096"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80096.1"
FT                   /translation="MSPCHTMTASDGPLLTLLLPGLDGTGRLLERFVAAASGTLELRTL
FT                   SYPPDRVRSYAELAELVRAELPRGRRFALLGESFGGPLALRVAAGRPPGLVGVVLAASF
FT                   HRRPAARLVSALRPLSPAFFRLPLPAHAVRVLLAGHDAPDALVADVQAAVASVQPRVMA
FT                   RRAHEALHVDATGWLRDCPAPVLFLGGRQDRLLRTGLAIEIRLVRPDAEIRMLDAPHLV
FT                   LQRRPDEAMRAVEGFLARSPAATAPLRAASADEPA"
FT   gene            372915..373748
FT                   /locus_tag="Adeh_0321"
FT   CDS_pept        372915..373748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80097.1"
FT                   /translation="MIGWISALALAAAVALVGVRRARFAREVAAEARSLWAVREDAPPS
FT                   RLDPGTLPEPVRRYLGLAGALGAAPLTAARLRHGGTFRPALEGAWRPIRGVQYLAAEPP
FT                   GFVWWGRVRLAPGLEVAARDRSAGGEGGMRIALASALVVADVTGPEIDAAALQRLLGEL
FT                   VWLPTALLDARHVAWLPRDASSARARLRVGGREVEATFHFGGDGLPERITALRYRDVKG
FT                   RGVLTPWTGRCADWREVGGVRVPFRMEASWELDGRDRPYARFELERLEHGVPRPF"
FT   sig_peptide     372915..372992
FT                   /locus_tag="Adeh_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            373948..376242
FT                   /locus_tag="Adeh_0322"
FT   CDS_pept        373948..376242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0322"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80098"
FT                   /db_xref="GOA:Q2IMR9"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80098.1"
FT                   /translation="MRTTGTTTLALLAALALAPSAASAAADDPQLPDVAPTTDNPSHPL
FT                   GDAQAARKAVAIQEKLNGRTKGRTHQVARGQYVELERLGEDRIWTVVGEFGDAVNATYG
FT                   GTAGPLRNQIPEPDRAVDNVTIWAPDFSRAYYEALLFSDAPGDVSMRNFYKELSANRYT
FT                   VNGEVTDWVKVPFNEANYGANYCGGIVCARTWLFVRDAVNAWYNAQIAAGRTPAEIDAY
FT                   LAQYDVWDRYDHDGDGNFNEPDGYIDHFQAIHAGEGEETGGGAQGTDAIWSHRWYAFYN
FT                   NIGATGPAFNRAGGIRIGNSSYWIGDYTVEPENGGVGVFAHEFGHDLGLPDLYDTSGNT
FT                   GGAENSTGFWTLYSVGSYGASGRPEDGLGTKPIHMSAYEKIFLGWSNYQVVRAGQYASL
FT                   KLGAAEANTKQAQTLVVLLPDKVVERNVGAPYAGTYFYYSGSGNDLDSSMTRQVTLPAG
FT                   SASLTAKVRFDIELDWDYAYLTVNGAPVQTNLSTSTSPNGQNFGNGITGSTGGAWVDLT
FT                   ADLSAWAGQTVTLGFRYWTDVAESRPGFFVDDIAVSGQAVDGGEAEAGWTYHGFVRTNG
FT                   TLAAPYFNAYFAEYRQYRGYDQSLATGPYTFGYLNDPALQNWVDHFPYQDGLLVWYYDT
FT                   SFANNNVGDACASGRCGGLFLPVDAHPGLVLRPDNGKAWRPRFQAYDSTFGLEPTDVVC
FT                   LHANSQEGCFGGLAGNPLFDDTQSYWVPPDPSLNHYGWSSVIVPNTGTTIRVVGTSAQG
FT                   DFMQVVVAPKR"
FT   sig_peptide     373948..374022
FT                   /locus_tag="Adeh_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.415 at
FT                   residue 25"
FT   gene            complement(376211..379474)
FT                   /locus_tag="Adeh_0323"
FT   CDS_pept        complement(376211..379474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80099.1"
FT                   /translation="MPALALARLHRACRLRAFSEDPHAPSRSPAPPRRRPRLRPRARRL
FT                   LRRRRGRRRRPRRLVLRAPRGELAAGGGVRAGAGRGRRLGERDGADPVQHLRGHRHPRR
FT                   RPVLPARHDPGAVHAGLRRGHRHAGAHAGGAARALDVLRGLHPAHRARRAGRAVRRLGA
FT                   RLRHPRRAGHRRAGGRRRPGRRPLQPPGGRDDRLRRRARRLGLRADGVRGERRRPADVR
FT                   RAGPPRGDRDADVLRARRGGEPERHRHRHLRHRRGSARRRLGVPARRRHRRPARRGAGG
FT                   RVRRGHGPGDGDRRPAHPRARAGDRRRVRPRHADGALPARPPPRVRHDLHRHDRPGRHR
FT                   PRRQRAARRGLLDLHHRPGLRRAGHHRQRDRRRVRGAAAGHAHLCGRGRLRLRARGVHD
FT                   RRQRAGAGQRHRGGGRRRRPHRGGRGRDPAPLLLGGSGGQPRGGAPAALLRVHHRVHLR
FT                   RDHRRARPRRRGGAGPVRRAGRRRLDVRVPSRPGHRPALARHRARRGRLRRRGCLGAHP
FT                   AGEPHERLAAPGPGGVGRGQPGPGRHGGGRVPLGGRRRDVRAAPAAHHGRQRRPGDGDR
FT                   RRRQGRVRRDVARPRGLARPGAHVRVDRRGPGRRRRGARRRHRGRVRRDLDRPPPLHRR
FT                   RRDVRPAGHRHRPRTPLRRRPRRRGDRRPRVRRHRRRPRHPGPRRDRRARLGHVHRPPV
FT                   PGRRDLDPGRGGLRPGRLGGERAALLVGLHRRVLRLGGRRGDVRAALVRRARQHRGHRL
FT                   HRVRRGRARVRRLRARVLPVHRRGRDLPLRGAARRRGARRGRRRRLAVRRARQRRGRLH
FT                   RRVPHLRAAHQGGRAREPGRRGSRGGGHSSLRGHHLRALGLLRRRRHLRAAGDAHERRH
FT                   GRLRGGPRREHRVPRADVLAAGLHRRRRALHAAAAAGRLDELPLRHRRRGRPRRHRRGG
FT                   GARHGVRLHRRRRHLRRARRGGRAGGAGQLHPLPARGGGGALRRDPRGLERRPVQLHRR
FT                   RRHVHRRGGRPGLAGRGVRERPGALPRRRPAPRLDRRRRHLRLARRGGRAARAARTRGV
FT                   RPLSRRTGRRGVGGGTGAVPAPPVPARGRATASARPRPA"
FT   gene            379534..382158
FT                   /locus_tag="Adeh_0324"
FT   CDS_pept        379534..382158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0324"
FT                   /product="peptidase M1, membrane alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80100"
FT                   /db_xref="GOA:Q2IMR7"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80100.1"
FT                   /translation="MPIPALALALAAVAASAPASPPALPAGEVPPALRLPAGVRPVRGE
FT                   VSLTLDPAAERYRGRVRYPVVLDAPARVVWLHAEGLEIEEAKVGGRPARAVLAEGGLLG
FT                   LVPDAPQPPGEADVEIAFAGTVDRVRSRGIYAVPEAGRWYAYTFFEPADARRAFPCFDE
FT                   PGFKIPWRLSLTVKAGDRAIANTPAAREAPDGGGTRVEFAETRPLPSYLVAFVVGPFDL
FT                   VDGGAGGAARVPVRFVVPRGRGGETRYAASVTARMLDLIEAETGVPYPYEKCDVAVVPR
FT                   FWGTMEHPGIVALGQPLTLVPPAEETRERKLRYATIAMHELVHHWFGDLVTMAWWDDTW
FT                   LNESLTSFLDSVVVDALEPAWRRTARRRAEGRASALEADVLAAAKRLREPVGSRDEIEG
FT                   AFDNAITYDKGASVAAMYERYVGREAWRAVLRDHLLAHAHRTATTEDFLATLASRSTPA
FT                   VAASLRGFLERPGVPLVRASVRCDGRGAAAVVRQERFLASGARDPAAAWSIPLCVRAGA
FT                   GGRVETACGLVGGEGPEGEVPLPFCPEWLWPNAGGTGYHLTALDPAALPGLWPRLAPAE
FT                   RLAAATDASLLARRGDLPPEAALGLVAPLAASEDGLQVEASLELARLAQPEWMEPADHA
FT                   RWRAFVRDTWGRRARAIGWMPRRGEPDDATALRRLLLPRVAGEGEDPALAAEAGKLARR
FT                   WLADRRSVPAEAAWPALEVAARTGDAALFDRVLAAARGARDRTDRARLLAILGRFERPA
FT                   LLDRALALVASGAEDLRDTAAILRVALAGRETRWRAWELLRTRWEAIAPRLRSDEGSWL
FT                   VAQAAGLACDPGRAGEVAAFLRPRAEAFDGAPRALARALEDADACRAARARNGPAVARF
FT                   LGR"
FT   sig_peptide     379534..379620
FT                   /locus_tag="Adeh_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.432 at
FT                   residue 29"
FT   gene            complement(382168..382620)
FT                   /locus_tag="Adeh_0325"
FT   CDS_pept        complement(382168..382620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0325"
FT                   /product="methionine-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80101"
FT                   /db_xref="GOA:Q2IMR6"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80101.1"
FT                   /translation="MGRSTAREARMDKLILSDAEWRDRLTPEQYQVLRGHGTEPPGTGC
FT                   FLGTHEPGTYVCAGCGNPLFRSGEKFESGTGWPSFTRPVSEEAVVEVHDRSYGMRRTEV
FT                   RCARCDGHLGHVFPDGPPPTGLRYCMNSAAMQHVPEGAPLDAPGGG"
FT   gene            complement(382699..384780)
FT                   /locus_tag="Adeh_0326"
FT   CDS_pept        complement(382699..384780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0326"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80102"
FT                   /db_xref="GOA:Q2IMS2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80102.1"
FT                   /translation="MLRSLPVSTKILGSSLLAAGATLAAGLAGWLAARGSLPGGAALAL
FT                   GAPAAVAAVIAGGGLFVSRVVGDALRAMRTESVRVRDAVRAGTLTVRGAEGRIDPEFQL
FT                   VIRTLNETLDAFSAPFAATAEAVERISRGDLPARMTAPFEGDFDRLRCAVNAVIEVVEQ
FT                   RNEDIRRLVEAATAGRLDVRADVTRYHGYNGAMIGRINLLLDTVIRPIEVATDRVVRLA
FT                   AGEVPPDVELPVQGRFLDLKRGVNALLEVVRLRNADLALLLRAAAEGRLDVRADPSRYP
FT                   GQNGELVRGMNALLDAVVAPLRAAAGALERLARGEAPAPIEETYRGEFDTLRRSVNACT
FT                   AAIRALVGEVDVAIEAGRAGDLGRRGDPARCEGDYRRVLAGVNEILDAVSAPVREASDV
FT                   LARLAARDLRARMGGRYQGDHARLQQVVNGTAGALDAALGQVVEAVGRISAAAAQIAST
FT                   SEAVAGGAAEQASAIGRTGATLEAVAGQARATSEHASAADGLTAAARDAAAEGAATVSR
FT                   MTATMAQVRGAAEQTAQIIKDIDEIAFQTNLLALNAAVEAARAGDAGRGFAVVAEEVRS
FT                   LALRSKAAASRTEALIHESVRQAADGDAITRAVAERLEVIRAGSDRLAALAAGISAAAR
FT                   EQAGGVERITGAVAEIDRVTQQNAASAEQSSAAAAELSSRSGELAELLGGFRLGGAAA"
FT   sig_peptide     complement(384706..384780)
FT                   /locus_tag="Adeh_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.507 at
FT                   residue 25"
FT   gene            385200..385688
FT                   /locus_tag="Adeh_0327"
FT   CDS_pept        385200..385688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0327"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80103"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80103.1"
FT                   /translation="MPFRPNARSRASRALEWTFAALLLGASAAILVAAGVSRADAHYQW
FT                   TRPAGDPARGAVTPAAVWERLRTVLDPELGIDVVDLGLVYDVTVPRDGRVAVVMTLTSA
FT                   GCPFSKQMIEDVRRAIFQHPAVREVALTVTRDPPWSWDRVSLEARKRIVEGSHAGAHR"
FT   sig_peptide     385200..385319
FT                   /locus_tag="Adeh_0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.424 at
FT                   residue 40"
FT   gene            385685..386311
FT                   /locus_tag="Adeh_0328"
FT   CDS_pept        385685..386311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80104"
FT                   /db_xref="GOA:Q2IMS0"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80104.1"
FT                   /translation="MTLLGPLSSGFLLGLGTGPLCFIGCIPLALPFALPEAGAGPRRGA
FT                   WGFLAKFLAGRLVAYSTVGVLTGLASSMAGPVQRRVVTVAWLALSVVLIVHGLGRGLPH
FT                   RGACGAVARVARSRAFPFLLGLAAALSVCPPFLLAVAYAMDRSGQVVGGLAFFLAFFAA
FT                   TTLYVVPVALLGYLPRRDLWQRVGRGASVIAGIALLVQGVRELLA"
FT   gene            386435..388357
FT                   /locus_tag="Adeh_0329"
FT   CDS_pept        386435..388357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0329"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80105"
FT                   /db_xref="GOA:Q2IMS3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80105.1"
FT                   /translation="MTKTDRYVLWGIGAAWVLDLAVFILSDYHIYAFLLLFVVAAVGLA
FT                   WWGLRFPVTAKLRRNAALSVSGFWTVALVLLFGPWPVPDKPDYIVGEVHRFSEMEHGFA
FT                   RGLTGVTGPNIAAGGLVYGDPADQGHMMSEWGWPPNFISGNPVSRALFGGTILMERLRG
FT                   ATTIGGEPANPLRYSWSNFEGEKRDKKLGWNSGDYLFGEVAKVMGTQKASYTPRENALM
FT                   IKSLAAWLGSPKIAIAAVDPRWFYSHDLSTWGTPLPLKDAKDLKYVIQLFTDQDWTRVH
FT                   NDSGTSWWSVSNSGQAYSTSAWIGIRMAQVLRDMGYTARVGFGGMNYENIETTVSVYSG
FT                   IGEYGRLSDAVVPTAGGLRFKSATIFTDFPMDVGEPNVGWGITRMCANCDRCARACPVN
FT                   AVPMGEPTVENGVNMWQVDKDKCTRFRTGNLNGNMCGACLAVCPYNKPDTPFHRVGNYI
FT                   IRHSPIATYLFGNIHGVGLEDWLDFEYSSEAGPYNVSRPARWIQEDPGWKAKFPYQVGQ
FT                   YIYTERDRSKNEEWASGVDPKMGKVGLSYKGTTWGKIPDRLVDANGRNRNVHWDYEAGE
FT                   LPPNLPLPGKLLTPEEATRLLLEGKAFSGASYTPDAEVFPPRDPKYEKQKLSYEQAARM
FT                   WAEEK"
FT   gene            388359..388610
FT                   /locus_tag="Adeh_0330"
FT   CDS_pept        388359..388610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80106"
FT                   /db_xref="GOA:Q2IMS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80106.1"
FT                   /translation="MDRLKQLKIQISLQWYELILIGVTAGLLAFGVWALIDTLLISSPV
FT                   AAWRFLALFVIWSLPGIAVLAFVRPRTAAEAAQEQPTP"
FT   sig_peptide     388359..388463
FT                   /locus_tag="Adeh_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.801) with cleavage site probability 0.794 at
FT                   residue 35"
FT   gene            388678..390153
FT                   /locus_tag="Adeh_0331"
FT   CDS_pept        388678..390153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0331"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80107"
FT                   /db_xref="GOA:Q2IMS5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80107.1"
FT                   /translation="MRWKARELGCVALAAAGAVAWAAMASAALVEREWRATWISVGAAL
FT                   ACAAVATGLVVARRRGALDGAVPRRVLRAALASAVALALALVLPSDRSFPDKRVGAATP
FT                   TTEYDASTQPGNDVLGKVERTRGGGSEDELTFTVYDVCSGKVAHRAARDGAPAPVAVEV
FT                   TEPAVLAAQIKDEARALGAQVTGITALHPQFVFRKDNDGRPVELRHRFAIVIGTGLDYR
FT                   LASPSAPLPWRDYYSAIPEEVAAVLSGRSDDPAVPIPAEVIQEYRDTLEFYAEGGRIAV
FT                   HLAKAIRSLGYPARAHFGRWSEVQVVPLAIEAGLGEVGKNGMLINDRFGPRGSFAVVTT
FT                   DIPLAVDRQRDLGVQEFCRVCNKCADACPVNAVPRGDAGAPAGGVSRWQVDGPKCWTYL
FT                   KLNPKCMACTGACPFNKKDLLAHRWAQALIARKSVVANHLLVWLDDLLGYGRAALRLRD
FT                   EARRALGEPAAAPPQAPDRPQAGGGASAPEARS"
FT   sig_peptide     388678..388761
FT                   /locus_tag="Adeh_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.552 at
FT                   residue 28"
FT   gene            390475..391929
FT                   /locus_tag="Adeh_0332"
FT   CDS_pept        390475..391929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80108"
FT                   /db_xref="GOA:Q2IMS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80108.1"
FT                   /translation="MTWAGPAALAVFVGGVVASLRGWIPQRVITLQALLLAIAGIALGL
FT                   TALAGQPIPWPQLLASANVHPVTSVIAGFLLAGALHAAGAFDAAARLLARLTRTRLGAP
FT                   FVILLVVNLPTILAMPCGRILVSPLMPLALMLGWALARERREPVLVAVTVFGLVVNAAA
FT                   SCGPSVIGGIGMLGEGMGRYPPGSFSNPAQIAILVITVATMALIRWGFGGTLRMRATPP
FT                   APVERPVPEHGYLALAMFVAVLLLVVLVRPPVPLQVTLTLGTACVMLVARLGLDDLLGG
FT                   VMLHPLSAMLAGFLVAGALSVAGAFDALLVLLVWAAEHTWLGYVGVSVVLAYVPVMLAM
FT                   PCGRIVSLALIPGVLLFGVRLAGVTGLERATPTLLSAFILAGAASCGPSAIGGIGSIGE
FT                   GRLRIRDAWSGQPQALGIFLGVPVTALLVSRLPLASVALDVRYFPVALALGALAGAVVN
FT                   LVYGYRVHHLGGLLGGLVTGALLVIL"
FT   sig_peptide     390475..390531
FT                   /locus_tag="Adeh_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.614) with cleavage site probability 0.516 at
FT                   residue 19"
FT   gene            391926..392417
FT                   /locus_tag="Adeh_0333"
FT   CDS_pept        391926..392417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80109"
FT                   /db_xref="GOA:Q2IMS9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80109.1"
FT                   /translation="MRRALVAVNALAVGLTLAYLGWLLGDALRAGQPWAVTCYDCKACT
FT                   ARCVLGLDPQGFVSAALAGSGDVYMYATNVRLRARHALEIDPGMLVTVGDRHPTAREAA
FT                   AELGPDAEVVTFRMRARDAARACFRCGACEKGCGLRLPLLRVITQLRGDASNEWASHAP
FT                   "
FT   sig_peptide     391926..391982
FT                   /locus_tag="Adeh_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.827) with cleavage site probability 0.668 at
FT                   residue 19"
FT   gene            392407..393036
FT                   /locus_tag="Adeh_0334"
FT   CDS_pept        392407..393036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0334"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80110.1"
FT                   /translation="MLRSPVFLSALTFLAVALGVRAAQAPWREQFPGSYPRVVAPAEAR
FT                   FEFLPDELRIHLSDQTRSGRIIVFAHVEGGSLLGLLKPIVDGTVTVRRGDLADYALAIH
FT                   GGEIGEHRLLKAMDRYVEREDMLERILEARAKGLRFGVQRCLYPICNRCLDGCKSVMRR
FT                   DYPISMRVGERGNVEPGFAKGSCPRCGKCFVWCPSGVLRDSGSLTN"
FT   sig_peptide     392407..392475
FT                   /locus_tag="Adeh_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 23"
FT   gene            393045..393410
FT                   /locus_tag="Adeh_0335"
FT   CDS_pept        393045..393410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0335"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80111"
FT                   /db_xref="GOA:Q2IMS7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80111.1"
FT                   /translation="MLEAMEIAVVMLPVVLVAGMLVRLVARGQAQVLLCMECELCMGAC
FT                   PLCAKRGEAFPGPKGILAAAKTGKVEAAIAAGALDCTSCGACTRVCPRGLAPQVEVERW
FT                   RAAAEREGTRGAARGPA"
FT   gene            393407..395356
FT                   /locus_tag="Adeh_0336"
FT   CDS_pept        393407..395356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0336"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80112"
FT                   /db_xref="GOA:Q2IMT3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80112.1"
FT                   /translation="MSARPPSAGRTAIALACAAGPALAPALASAQEPALPAVVLDEQVI
FT                   RLPRAEAEGRPPATITVVDRSTFEGEAKDVGQLVSAAPGVVVEEHGGMGQLTTVSIRGS
FT                   TPDGVKVLLDGLPLNTAFGGGVDLSTIPRAWVDAVEVVRGPEGARYGAGALGGALNVVT
FT                   RRPSAGSWSLETGGGSYDTARVAAELAAAVGPGSLMVAASADTTGGRFPFRLDPGLPGG
FT                   PTVAAMRENAEARRAGLLAKLARPLSRGRLDALVEVSGGHRGLPGFAASPTPWAWQDDA
FT                   RLLAMGRVARFGAIGPATLATRGHLRLDRLDARVTGPRDPPVRQRGSAAGLALDATGSH
FT                   AHGVLSASLEASGELIDADGLGRRRELLGVAAAVSEDLALAGGRFRLAPAVRAERAGRF
FT                   GGVSGTLGLGARLGPALRARASVGRTFRPPGVAELHLQQGLLVPNPDLRPETAVAVDAG
FT                   LVADGRAGLVAVTGHLTRYDDLVVYEPSDAFGRLKPFNSGRAMASGLEVEGATAPVGGP
FT                   LRASARGSYTFLATELLRGAPAEVGHWIPYRPRHRAVLRAALAPGPATAHVELHHLGRR
FT                   YRDRRGVNPIPPSTVWNAGLSARVARHPDVRIQLEVLNLADDRTLTDGLGDPLPPRTVM
FT                   ITLRAGSTPQENAP"
FT   sig_peptide     393407..393499
FT                   /locus_tag="Adeh_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 31"
FT   gene            395353..396843
FT                   /locus_tag="Adeh_0337"
FT   CDS_pept        395353..396843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80113"
FT                   /db_xref="InterPro:IPR006969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80113.1"
FT                   /translation="MRAATILGTLAVAALAACDSDATCPEGQVECAGRCVALATDPLNC
FT                   GACGVACGPGATCGAGACGCGPGTVLCGATCAQLESDPDHCGACGSACRDAQVCSSAGG
FT                   AAACADACGEGQVACGRACVELAFDRYHCGACGTVCQPGEACDAGTCRSLQVACFATDD
FT                   VRPIAPDLAAAGSPRPAGDGPIALAALGGDVWAAAALSGSVIRLPLDLSAPPVEHALHG
FT                   SDLEGIAAASDRLLVSNSGGGSVAVVDPVTGRVLDDVLIPGLPGANPRGIAVLDGKAYV
FT                   ALYGRDEASGGQGVAVLDLSRLAGCAAAPCATVERVVDLRGAADAGGLPFPGKAVAAGG
FT                   RAWITIANLARDTDPASWTYGYYVKPAGPGRLAALDGTSDAVQLVSLGDGCRNPGALAV
FT                   DGATLWVSCGAAGAAGLVPVDVSDPRAPVVGPVLATAFDAPGAVAICRGAGFVADQYTG
FT                   RVQRFDPVTRTSEETVTACPVGAQGWAWAADLLCAPAR"
FT   sig_peptide     395353..395406
FT                   /locus_tag="Adeh_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.872) with cleavage site probability 0.575 at
FT                   residue 18"
FT   gene            396911..398569
FT                   /locus_tag="Adeh_0338"
FT   CDS_pept        396911..398569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0338"
FT                   /product="sigma54 specific transcriptional regulator with
FT                   PAS sensor, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80114"
FT                   /db_xref="GOA:Q2IMT1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80114.1"
FT                   /translation="MKLHDIHLLDLFDVGTDQGWLSMHQQRMVLHSAAAVSIMRAQLVR
FT                   SLGHDAARAIVFRWGFAQGYFDAMMTSDHLASLEPVDRFVFGCTLHTMEGMVRVAPKVI
FT                   EANGPGKLHMEANWWHCAEADDHARVLPAGLTSSCWATLGYASGFATYVIGALILFKEL
FT                   SCRCSGAPCCSVMGNDMEGWGERAAEIEGRYTLAGETSFTQQWKEIHRECERARAARSA
FT                   AAAAHPAPTATLTSVSGPDRTTGPLNFVVCSQSMTELLALAERVAPLEINVLIEGESGT
FT                   GKEFLARYIHEKSLRGDAPMVAINCAALTEGLLESELFGHVRGAFTGAVRDKPGLFEHA
FT                   GSGTILLDEIGEMPLCLQAKLLRALETREFRRVGGEKVLRLGARVVASTNRDLRRQVQA
FT                   GAFREDLFYRLGGFVLTIPPLRERREEIPALAHYFLHSTARRWNKGVQTISPGAMRRLM
FT                   SYPWPGNVRELQHAIERATVVASQSVLTVKDLNPEIAATGAPAECDLDVEANERQLIEE
FT                   ALRRFHGNRKEAAAALRISPVTLWRRVRKYGLSIT"
FT   gene            complement(398562..399566)
FT                   /locus_tag="Adeh_0339"
FT   CDS_pept        complement(398562..399566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0339"
FT                   /product="FAD-binding molybdopterin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80115"
FT                   /db_xref="GOA:Q2IMT0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80115.1"
FT                   /translation="MIAPDTRRARARARGFPEWHLAGTLAEAAWRAYQGAVVVAGGVDV
FT                   SERLRLAPRAPATVVCIRGLAELHRVEVRHDGLCIGTLVTLQELAQSPVVLARFPEVAR
FT                   AAGMAATPAVRAAATVGGNLLQYPRCWSLRTEGRPCRRLGADRCPLEGRWAAEGALFDR
FT                   QACACAHPSSLAPVLIAHDARVEAHSISGMVRLPLDRLYPPRRTAGPRPACTTPADILT
FT                   CVHLRWPVAGEMAFFDARRVRDTITASVAGRVAVRGQLVTAARVVLGGVAPSPWRATEA
FT                   EARLLGARLSPAALRDAVRAELDRAVAPAASVSKHRALKAAALTALRAGAAVT"
FT   gene            399749..400327
FT                   /locus_tag="Adeh_0340"
FT   CDS_pept        399749..400327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80116"
FT                   /db_xref="GOA:Q2IMT7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80116.1"
FT                   /translation="MTPPTPAARRTSGRPRAGARRAPLLVAAVVLGVATLVIADRTLGG
FT                   SGAPRTDAPAPPLRVGAVSGGGEIDLARLRGRAVVVNFWAPWCAPCQAELPDLAAVKQD
FT                   LAGRCVELVGIAGDGTRTEVAQVAARQPYPIGFDERGDAMRAWRVESVPTTYLVDADGK
FT                   VRTVIPGAVGREELLEALRPIIPATCPAG"
FT   gene            400512..401399
FT                   /locus_tag="Adeh_0341"
FT   CDS_pept        400512..401399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80117"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80117.1"
FT                   /translation="MKPHPWKPILALLAAITLATPAAAKEGGDQYPVGVDGLAAGALPP
FT                   PGTYLLSMVALVHGDVQDADGHDAGVEANAQFGVLRLVHVTKLRVLGAQYAFGAILPYW
FT                   HQSAKIRTPAGKLELDADGPGDITLNPVYLNWHLPRNLHLLATVDLNLPTGRFRTDGGL
FT                   SQGVGYYSVSPAVAATWYAPGGFEASGKLLYNLKRENPVTGVRSGDELELDFAVAKLFG
FT                   PFEAGIGGYYAVQTTDDELDGQKVNAKAEGLALGLQAAYQAPFGTFIGMWHHDVTSDSR
FT                   LQADRVFLKFMLPL"
FT   sig_peptide     400512..400586
FT                   /locus_tag="Adeh_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(401470..402477)
FT                   /locus_tag="Adeh_0342"
FT   CDS_pept        complement(401470..402477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0342"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80118"
FT                   /db_xref="GOA:Q2IMT5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80118.1"
FT                   /translation="MGVSTPSPAPSGRSEELAAAGAIPAVSARSIWVDLLVYPTHSLPT
FT                   AAQPVLVGLGLAVHFGVLSPWPALVGLFGSWVIHVAGLFTDNHELLRLHPKLPEHPELV
FT                   HAVETGALRLATLRLAVVGCLLLALATAPYLYRIGGAPVLAFGVLGIVTSLSYNGGPWA
FT                   YARRGQADPLFVLMFGVVGVVGTYFIQAAAVQGAPQPWRLLASLPLPVYLVGLPVGALV
FT                   TAVLLVDDLRDHEFDRVKGWRTGAVLHGPGFNRVEIASLVAFAYLAPLGSWLLLGLGPW
FT                   MLLPLASAPMAAGALRTLFTVRERVRLIPLTPRMAAVGLVYAALLGLALALAPR"
FT   gene            402995..403936
FT                   /locus_tag="Adeh_0343"
FT   CDS_pept        402995..403936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80119"
FT                   /db_xref="GOA:Q2IMT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80119.1"
FT                   /translation="MSKRGLNAQGGAGPAQQRAGLDWGHLEFFLELVRTGSHARAARRL
FT                   GVDRNTVARRVAALEGALGLALFERGPQGWACTTTGQELAELASRVEQDVLALARHADT
FT                   RDRALDGTVRLTTASHLATHLFLPAVGVLRERHPGLVLEIAADQRAFDLTRREADLAVR
FT                   MGRPRDAGLVTRKLSDVAYGLYGGRAALGGRSRAVDFAADPFVGLDEGHAAVPQERWLE
FT                   RVAPARRIVFRCNSTTALIQAARLGLGVAVLPRFVADRDPALVRLDGPEPAPHELWLLV
FT                   HGDLRRTPRVRAVIDWLDGLVERARPALSGQA"
FT   gene            complement(403933..404667)
FT                   /locus_tag="Adeh_0344"
FT   CDS_pept        complement(403933..404667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80120"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80120.1"
FT                   /translation="MSPGARKGAAGAAQREDVGEAEVVREYGPFDGAPVHGVSFDGERV
FT                   WAATGARLVAFDPASGEPVRTLEVACDAGTAFDGRHLYQLAGDRILRVDPTTGAVLGSI
FT                   PAPEGAGGSGLCWAEGSLWLGRYGERRILRLDPATGAVLRTIESDRFVTGVTWVDGELW
FT                   HGTMEAGESELRRVDPDGGAVRARLAMPRGVLVSGLESDGAGLFFCGGAASGKVRAVRR
FT                   PGPAGRTASRARRAGPRGPRRR"
FT   gene            complement(404664..405914)
FT                   /locus_tag="Adeh_0345"
FT   CDS_pept        complement(404664..405914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80121"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80121.1"
FT                   /translation="MPAPPDAVAAAARALQAGDPLGALRQVALRRDATGLALRGIAMAQ
FT                   LGELDAARRLLRGAARAFGPAAPLARARCATAEAEIALAARGPAGPPGALDDAARALEA
FT                   GGDRANALHARLLAVRRLLLAGRVAEADRALGRLDLRGAPPALAAVAGLAALDVALRRG
FT                   RSAAAADAHARARRAAARAGIPALATEVQRAGDALASPAARLLSAGGEQPLRLEEVEAL
FT                   RRSDRLVVDGCRRTAGRGGAAVDLARRPVLFALLRALAEAWPGDAPRELLVRRAFGAAR
FT                   ATPSLRGRLRVEVARLRRAVRDLAAVRATPAGFALAPRAGAGVAVLAPPAAAGDADGPA
FT                   AALAALLADGQAWSSSALALALGASRRTVQRGLTVLAERRAVRALGRGRARRWVAAPVS
FT                   GFNPALLLPLPRTIGQG"
FT   gene            406061..407275
FT                   /locus_tag="Adeh_0346"
FT   CDS_pept        406061..407275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80122"
FT                   /db_xref="GOA:Q2IMU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80122.1"
FT                   /translation="MRSDRNLGTQARRDGVWPRTYRLEPRWRAALHGFGALALVAAVAA
FT                   SIASLRGGPPGLLVAVALGFGALSAYLVAVARVERLLLHADGVEVIAVGRAPRRLRTDQ
FT                   IAGRRTIPLQYGMEKLVLERRERGAKPLSLTFQFERDAALDAWLASIPDLDAADRAGAE
FT                   AALLASAELGADEAARRSALARSHQLARALKGVAIGVAGWGLLFPRPYPVVIAALAAIP
FT                   LATIALVVAGRGRYAVEERRNEVRPGVGVPVFAPGVVLMLRALLDYQVVDVSPMLAWTG
FT                   AGAVALTALLVRGDAALRRRWFVPVLIVALVAPYPWGALNAADVLLDRAPAEVHEVPVL
FT                   HKHVSSGKHTSYDLRLPPWGPIAEAQEVDVGRELYGAVEVGDVVCAHLRPGALGARWFV
FT                   VDVCD"
FT   gene            407377..407955
FT                   /locus_tag="Adeh_0347"
FT   CDS_pept        407377..407955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0347"
FT                   /product="peptidase C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80123"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80123.1"
FT                   /translation="MAKKILMLVGDYVEDYEVMVPFQALLAVGHAVHAACPGKKAGEKV
FT                   RTAIHDFEGDQTYSEKRGHDFALNATFDEVRALDYDALCIPGGRAPEYLRLDARVLEIV
FT                   RHFAEASKPIAAICHGAQILAAAGVVKGRLVSAYPACAPEVRLAGGEYAEIAIDAAAVD
FT                   RNLVTAPAWPAHPQWIAKFLQVLGTRITT"
FT   gene            complement(407945..408562)
FT                   /locus_tag="Adeh_0348"
FT   CDS_pept        complement(407945..408562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0348"
FT                   /product="Alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80124"
FT                   /db_xref="GOA:Q2IMT8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80124.1"
FT                   /translation="MIRPSLVFLPGAGGRSAFWAPVAERLADLGPALRLDYPGFGGCPP
FT                   DPAIRSTGDLFAWVLARLPPGRSHVVAQSMGGALAVRLALEHPERVDRLVLVATSGGVD
FT                   LRGTGAADWRPEYLASLPGVPRWFVEDRSDRTARLGEIAAPTLLLWSDADPVSPLAVGR
FT                   LLEARIPGATLQVFPGGTHAFANERPDDVAAAIRRHLAGATW"
FT   gene            408883..409716
FT                   /locus_tag="Adeh_0349"
FT   CDS_pept        408883..409716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0349"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80125"
FT                   /db_xref="GOA:Q2IMU3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80125.1"
FT                   /translation="MHAPPAPTAPAGVGPLLRAWRTARGKSQLALALEAGVSSRHLSYL
FT                   ENGRSTPSREMVLDLAEVLGVPLRERNALLQAAGYAAVFRETPLDAPDLAEVRRALLHV
FT                   LEASEPNPALLVNRRYDVLLANGAAVQLISHFAPAWRGRNNVALMLVSPDGLRPSVENW
FT                   AEVAGHVLHRMRDELSAMAARDPDDERLLRVALEAEPELRAAPGASPGPAILVPIRLRR
FT                   GDLSLDLFTTITTVGTPLDITLQELRIETLFPASAAAREALARVREAAEREEDAG"
FT   gene            409978..410403
FT                   /locus_tag="Adeh_0350"
FT   CDS_pept        409978..410403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80126"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80126.1"
FT                   /translation="MTPERPNRPGAPARATPSTPQPAASAADAAALRAERLERILLALF
FT                   RSVVREESTDPGLTGVDLVALRLSQDGAEARIGYALEVPRGERQGAEREAAEALARAAP
FT                   LLRARLAEVIELPTLPSLTFALERVREVPRAARAGAA"
FT   gene            complement(410420..411406)
FT                   /locus_tag="Adeh_0351"
FT   CDS_pept        complement(410420..411406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80127"
FT                   /db_xref="GOA:Q2IMU5"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80127.1"
FT                   /translation="MERPTSEPRTPPARSIASFLVPALGLACVALPHVSPALALTAGVA
FT                   LALSTGNPYAPTTRALARRLLPLSVVALGGAMDLRVVAHVGARGVGYTFVSIAACLALG
FT                   ALLARAARVEARTAALISVGTAICGGSAIAAVAPVVGADEHETSIALGAVFLLNSAALL
FT                   VFPLLGHAAGLGEPAFGLWAALGIHDTSSVVGATLAYGPQALAVGTTVKLARALWIVPV
FT                   TLAIGIVARRARGGGAATSARPPWFILGFVAVAALATFLPALRPAGLLAAEAGRRALVL
FT                   TLFLVGLGLSRQALRSVGAGALAMAVALWIAVGTATLAAVRTGLVHL"
FT   sig_peptide     complement(411287..411406)
FT                   /locus_tag="Adeh_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.906 at
FT                   residue 40"
FT   gene            complement(411483..412406)
FT                   /locus_tag="Adeh_0352"
FT   CDS_pept        complement(411483..412406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80128"
FT                   /db_xref="GOA:Q2IMU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80128.1"
FT                   /translation="MSRLDPRRLQSFREVALAGRISVAARTLHLSPSALSEQIRELERE
FT                   CGRPLLLRTAHGVHLTADGQRLLEHAQRVDEALRAAEASMDREAEEGGTLVLGASQTTA
FT                   AWVVPHLLAELRRARPGVAVRVDVGNTDAVLGWLAKGTVPLGLVEGLSRAPHVRLEPFA
FT                   QDEIVAAASSAAPAELLRLRHLAELDRVPIVWREVGSGTRAVVEKALRRAGVRRTRRHA
FT                   DLELGTNDAVKAAVQLGLGVGFLSRWAIRTELATGALRALPLDGLRIERAFSWALPAGG
FT                   VSGIAGRFLREAQRLAAGASRPAWFP"
FT   gene            complement(412443..412865)
FT                   /locus_tag="Adeh_0353"
FT   CDS_pept        complement(412443..412865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80129.1"
FT                   /translation="MPGLRRRRGALPGAARQPRDHAGSGSIQCEREAVLTWIGVPDGRE
FT                   GVLDALLSRLPIQGFERRTQACTVEGLAATCRVLRNATGKPPTVVGAEQVVRGTRLVVT
FT                   CVSFREGTEVSEICRPVLSLSAPAPAAAEPAAPAAR"
FT   gene            413372..414148
FT                   /locus_tag="Adeh_0354"
FT   CDS_pept        413372..414148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0354"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80130"
FT                   /db_xref="GOA:Q2IMU9"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80130.1"
FT                   /translation="MRTLLAIALALLPTVGLSDVTGEAETDLGQRVWVRPISKDAWLIR
FT                   SVSPIEGWGDVESNAVLVAGAAESVLIDTPATEAQTAPVLAWAADTLRRPVRHLVVTHW
FT                   HADRMGGIGLARPRGIRTYALGKTRALARRHGLVVPERELRPEERLVLAGVKVETWYPG
FT                   HGHTADNLVVWLPADRLLVGGCFVKAAEATTLGNLQEIDPVQWAKGVAATDRRYPEART
FT                   VVPGHGAAGGPELLRHTAALLRAHAGGRGNEGARGR"
FT   sig_peptide     413372..413428
FT                   /locus_tag="Adeh_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.835 at
FT                   residue 19"
FT   gene            414176..414895
FT                   /locus_tag="Adeh_0355"
FT   CDS_pept        414176..414895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80131"
FT                   /db_xref="InterPro:IPR025412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80131.1"
FT                   /translation="MRGCGRVHAPLHRQAAEAPRPRHRAGTRAAHHAPRRRATAKTPAQ
FT                   QLLDEVIRNGLAPMLKALGFRKAGRTFRSAAPRCVLVVNVQASHWSTRDALQFTVNVGA
FT                   FYIGLNDVLQRGTWPSPSTSGPTEYQCHVRQRLGRLTPAQRDVWWDLKVGAPWTQVSVE
FT                   VTEAVREHGLPWLRAMTDLDMARSHAEARSGPHIAAGLALLAGRRDEATRIVVVATESG
FT                   ADRGQLRLWARQADLIP"
FT   gene            complement(414904..415365)
FT                   /locus_tag="Adeh_0356"
FT   CDS_pept        complement(414904..415365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80132"
FT                   /db_xref="GOA:Q2IMU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80132.1"
FT                   /translation="MKLLPIDRTELRSTATPEELVTRLADLVTQGHTAPQRPFRGKLQG
FT                   RRFELVRNVGRPHAVVLGEIATAGGGSVVRLRFRLRWALAAFLGVWFAFFSYAAVANLR
FT                   GLASGVAGIVLALVAGTTTVGFAAALLTAPFRCDVRAALETLRAAIERG"
FT   gene            complement(415485..415560)
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Adeh_R0003"
FT   tRNA            complement(415485..415560)
FT                   /gene="tRNA-Gly3"
FT                   /locus_tag="Adeh_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(415640..417595)
FT                   /locus_tag="Adeh_0357"
FT   CDS_pept        complement(415640..417595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0357"
FT                   /product="sigma54 specific transcriptional regulator with
FT                   PAS sensor, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80133"
FT                   /db_xref="GOA:Q2IMV4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80133.1"
FT                   /translation="MTPADRRPIVWAFSTSRLRHVFESVAPLMADVAEVRVFDKGFEEA
FT                   LQVARELRQAGEEVDAFVAAGTNGAYLRDHADVPVVVVTASTVDALQALVQARKLSKRI
FT                   GVVNFRRTVAGLEGVHLIDDTVIEQRPYVTPEEGQAAVDDLSARGFKVIVGPGPICSVA
FT                   ERAGLRAVLLYGQDSLEEAIRQAAEVSRIARVEGSRRTHLQAMFQHLEVGMVAVDTEER
FT                   IQAINPALQRLLGVTAAEVHGRRLSAVAPELAIGPVLEGGPPEIETVQRIGVSAAVVSR
FT                   FPLHEHGVLRGAVLTCQPAPLIQRLERGLRSTHRPPRFVARYALSGLVGDSPAMVRLRE
FT                   LAGRYARTDATVLITGESGTGKEMVAQGIHGASRRRDRPFVAVNCAAFPETLLEAELFG
FT                   YEEGAFTGSRRGGRPGLFEAAHTGTLFLDEIGDVPVTLQTRLLRVLQERQVLRLGSNDP
FT                   TPVDVRVIAATHRDLRQAIARGEFREDLYYRLDILPLHLPPLRERGEADVELIASDLLK
FT                   RALLRHDAADAHRRALSMVLPRLRGHLWPGNVRELENVLERVAVLFADRDPRARVTDEE
FT                   LAAVMPEVSESAARAPAPVEPPAPAPIDLRAARAAQERALIERTVAECGGNQAEAARRL
FT                   GIGRTTLYRKLGRVRA"
FT   gene            417900..420287
FT                   /locus_tag="Adeh_0358"
FT   CDS_pept        417900..420287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0358"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80134"
FT                   /db_xref="GOA:Q2IMV3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80134.1"
FT                   /translation="MDRIERVAVLGSGVMGSTIAAHLANAGFGVLLLDIVPKEPNAEEK
FT                   AAGLGLDSPVVRNRLATAARAGLEKLKPAPLYLPAYASRIEVGNLEDDLPRLATCDWVV
FT                   EVVLENLEVKRQLLGRIAPHLKPTAVLTTNTSGLSVNAIADTLPEALRPRFLVTHFFNP
FT                   PRYMRLVEIVSSRHTDPAVAAGMAELIRVRLGKGIVTGKDTPNFVANRIGVFAMCNAIR
FT                   HMVELDLTVEEVDAIAGPPTARPKSATFRTADLVGLDTLLHVARNSYELLPGDSRREEF
FT                   KLPAFLEQMVAKGILGNKSKGGFFRKEKGEGGGLSFYDHRKGEYVPAAKPRSASVEATK
FT                   GIDDPAQRLRAALGGKDKAAEHAWRNLRDTLLYAFERIPEIADDVVNVDAAMRWGFGWD
FT                   LGPFEMLDAVGVPAFVARAEKDGVAVPERLRGIERFYVEEGGRRRYLDLAGGGGYRDVP
FT                   RPADQIDLAVLEKSGAVVERNAGASVLDLGDGVFCLEFHTKMNAIGPDVLAMVHKAVAR
FT                   AERDGQALVVANRGQPAFSAGANLMLIAVAIAEGAFDEIALTIRAFQKAMMALKYARVP
FT                   VVAAPHGLALGGGCEVCLHATAMNPLAETYMGLVEIGVGLLPAGGGTKEMALRAIRLAE
FT                   KYEVDASPFVFKHFNTVALAKVSASADELVAMGMLREGDAVTLSPDRLVHDAKQKALGL
FT                   AANFRPGTPATGLRAPGRGAAASIASQLWNMRMGGFITEYEEQLGRTIAGVMTGGDVPA
FT                   GTLVTEQDLLDLEREAFLKLCGERKTLERIQHMLKKGKPLRN"
FT   sig_peptide     417900..417980
FT                   /locus_tag="Adeh_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.809) with cleavage site probability 0.508 at
FT                   residue 27"
FT   gene            420333..421505
FT                   /locus_tag="Adeh_0359"
FT   CDS_pept        420333..421505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0359"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80135"
FT                   /db_xref="GOA:Q2IMV2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80135.1"
FT                   /translation="MSAAYVLAAVRTPGCKAKKGKLKDVRPDDLAAVAIRALLARTGVE
FT                   PGQVEDVILGCAFPEGEQGMNLGRVAALRAGLPVGVPGQTVNRFCASGLQSIATAAERI
FT                   MAGQADCIVAGGAESMSLVPMGGSHFSANPSLVASWPESFAAMGITAELVAARDHVSRE
FT                   DQDAFAVASHARAARAQAEGLFADELVPVEVEQVTVEKGKAVRRTEQVTADDGVRPGTS
FT                   LEALARLKPAFKIDGTVTAGNASQTTDGAAAALVVSEAFLSRTGLAPLARFVSYAVRGV
FT                   PPEIMGIGPVEAIPAALKRAGLRVEDVGQIELNEAFAAQSLACMRALGLDPAKVNPTGG
FT                   AIALGHPLGCTGAKLTATLLHGLRRTGARHGIVSMCVGGGMGAAAVFERA"
FT   gene            421550..423325
FT                   /locus_tag="Adeh_0360"
FT   CDS_pept        421550..423325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0360"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80136"
FT                   /db_xref="GOA:Q2IMV1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80136.1"
FT                   /translation="MAKLFKGAEYLISEATKDDVFTPEDFTEEQRQIAETAEQFAETEA
FT                   LPAEHALEQHEPGVAAALMRKAGDAGLLMIDAPEAYGGLALDKATSMLAAERMGMGGAF
FT                   SVSYAAHTGIGTLPLVYYGTDAQKDRYLTKLVTGEWAAAYCLTEPEAGSDAMGGKATAT
FT                   LSPDGKHYLLDGTKQFITNGSFANLFTVFAKVDRKHFTAFLVERTFPGVTVGPEEKKLG
FT                   IKGSSTTSVIFESAKVPVENVLGEIGKGHKIAFNVLNVGRFKLGAAVTGAAKLALATGA
FT                   AYANARKQFGTPIARFGAIREKLADQAAGVYASESLIYRLAGLIDDRLATIPAEQPGYY
FT                   EAYQQGIEEYAIECAIAKVFCSEVLADVVDEVVQIHGGYGFIQEYPAEKYYRDERINRI
FT                   FEGTNEINRLLVPGTILRRALKGELPLQREVMKAMDALMNPSLDEVDPAVPFAAEKATV
FT                   ANLKRAFLVVAGAAVQRYGEALKDEQEVLLALADVAIQAFAAESVVLRAEKTASTQPEA
FT                   RRALAAAAVKVHTFAAAEKAATAARRAAFYVGEGDTLTILLGGIRRFSKYDAAGLLQAK
FT                   RRLADAVLETEKYPF"
FT   gene            423407..424102
FT                   /locus_tag="Adeh_0361"
FT   CDS_pept        423407..424102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0361"
FT                   /product="molybdopterin-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80137"
FT                   /db_xref="GOA:Q2IMV8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80137.1"
FT                   /translation="MDDQQRRIAEGVALLRARFDEKMKATPSLADASPQGDGPANRHGM
FT                   PKEPPGQNVFEKHEWPVMDLGTGTPDVAPERWRLVVDGAVEAPLELSYADLLALPQVDE
FT                   EADFHCVTGWSILDVAFRGVRLETVLALARPTGAATHLMAHSADGYSTNLPLEEALKPD
FT                   VLLVHAVEGQPVARDHGGPVRLVVPQLYAWKGAKWLTRLEVMTQDRRGYWEIRGYSNTA
FT                   YPWRDDRTW"
FT   gene            complement(424130..424513)
FT                   /locus_tag="Adeh_0362"
FT   CDS_pept        complement(424130..424513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80138"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80138.1"
FT                   /translation="MDCPRCSVELNEIAHEDSAVQRCAECGGIWVGDAADLNKVLLHAN
FT                   LPALSALGGYVNADEISGMCPACNVDLVVVEGGEKRSLAYDTCESCGGIWVDGTEDEPA
FT                   AELDWKGATSQVVAFFKAFAKKK"
FT   gene            complement(424626..425291)
FT                   /locus_tag="Adeh_0363"
FT   CDS_pept        complement(424626..425291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0363"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80139"
FT                   /db_xref="GOA:Q2IMV6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80139.1"
FT                   /translation="MPGTSELITVAVPKGRLLQESSALFERALGVSPRKLLEGTRKLAA
FT                   DAPEAGLRFISIRAGDVASYVEHGAAEVGIVGLDVLREEPRDLYEPLDLGIGRCTVIVA
FT                   RPKGARPLPRGVAPRVATKYLSLAARHFAAKGVPAEIIPLHGSIEVAPSLGLADTIVDI
FT                   TETGETLRANGLVIEEKVLEVSARLVVNRVALKLHPERLRLLIEALRAAVAAADAEAR"
FT   gene            complement(425291..426559)
FT                   /locus_tag="Adeh_0364"
FT   CDS_pept        complement(425291..426559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0364"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80140"
FT                   /db_xref="GOA:Q2IMV5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80140.1"
FT                   /translation="MDKIVIEGGVPLRGSVDVSGAKNAALPVIAAALLAEGEHEVRNVP
FT                   DLADVRTLGKLLGHMGCEVVRGEGDRRTVRLRVPAAVTPEAPYELVKTMRASVLVLGPL
FT                   LARLGRARVSLPGGCAIGARPIDQHLKALTALGAEIRLEHGYVNASVPGGRLRGTVFTF
FT                   DAQTVTGTENVMMAAALAEGETVLRNCAREPEVKDLGDALVAMGALVEGAGTDEIWIEG
FT                   VPSLRPLSHAVIPDRIEAGTFLVAGALPGNDVTVRGCVAAHQEALVEKLRAVGAEVTKV
FT                   EGGLRVIGDGRPRPVDVRTAPHPGFPTDMQAQLMVLLCLADGTSRITETVFENRFMHVQ
FT                   ELIRLGAHVEVDGRVAMVKGVPELSGAPVMASDLRASAALVLAGLAATGTTEVLRVYHL
FT                   DRGYERIEEKLAPLGARIRRVRG"
FT   gene            complement(426640..427500)
FT                   /locus_tag="Adeh_0365"
FT   CDS_pept        complement(426640..427500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0365"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80141"
FT                   /db_xref="GOA:Q2IMV9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80141.1"
FT                   /translation="MSEGEAWTTLRLLAWTQEFFGRKGVDAPRLTAELLLAHALRCERM
FT                   RLYLDFDKPLGAPELAAFRELVRRRGEGEPTAYLTGRRDFYGRPFRVDARVLVPRPETE
FT                   LVLEAARDALPEGGAALDLCTGSGALGVSLALERAGARVVATDLSADALVVAEENARAL
FT                   GAAVDLRQGDLWAALREGERFDVIVSNPPYVPRGELDTLPREVRREPRLALDGGPDGLD
FT                   LLRRIVEGAPARLVPGGTLVLEMHERHLDVLPRLCREAGFERAEARPDLAGLPRLTVAR
FT                   LAGAA"
FT   gene            complement(427497..428609)
FT                   /locus_tag="Adeh_0366"
FT   CDS_pept        complement(427497..428609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0366"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80142"
FT                   /db_xref="GOA:Q2IMW2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80142.1"
FT                   /translation="MLSPDVLKKLEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERAS
FT                   IEQTVTALRAYRKLLDDVAGNEALLGDKDPELRELAKEELAQLRPQVEPAEEQLKLYLV
FT                   PKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVK
FT                   EATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPA
FT                   DVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLF
FT                   EIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQ
FT                   DVIDACRTFYAAQALREASRGDAGAAERRA"
FT   gene            428822..430345
FT                   /locus_tag="Adeh_0367"
FT   CDS_pept        428822..430345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0367"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80143"
FT                   /db_xref="GOA:Q2IMW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80143.1"
FT                   /translation="MRRLLRIPPPPALRPAVAYGLAVALPVACTFALLAAPGVLRARFV
FT                   PMLPAVLLAAWLGGAGPGVVATLLSALGVNLSVMGPATGWAPGGRELAATPAFLMVATL
FT                   LVLACAAIRTGYAERAARERAVRESEARFRTLVETIPQLVFTLAPDGRPDFHSPQFEAY
FT                   TGLDNEAILAAGWAAQFHPDDRARARADWEAGFAAGRAVSGEYRLRGRDGGHRWFLVSA
FT                   VPLRDAGGRVVKWFGTFTDIEAQKEVERRKSEAIAARDVFLSVASHELKTPVTAALLQA
FT                   QQALRSLDRDPADARRARGQLAAAAASVERLGRLVEALLDVSRLATGRAALERRRYDLS
FT                   DAVRQAAARLAEAAARVGSALELDVEPGLACEGDRLRIEQVLTNLASNALKYGAGRPIT
FT                   IGLRREGGRAVLRVRDRGIGIPPADLERIFGRFERAHEARHYGGLGLGLWIAREIVEGS
FT                   GGTICAESAPGEGATFTVSLPLAPPAAQAAAAPGGAGVSPAAPAPPRAP"
FT   sig_peptide     428822..428929
FT                   /locus_tag="Adeh_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.945 at
FT                   residue 36"
FT   gene            complement(430308..430889)
FT                   /locus_tag="Adeh_0368"
FT   CDS_pept        complement(430308..430889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0368"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80144"
FT                   /db_xref="GOA:Q2IMW0"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80144.1"
FT                   /translation="MTAAAQRAAAPTSHALQKADLAVADAVGALMELWGFRRQLGRIWA
FT                   VLFLSDRPLAAPDLCDRLQISTGLLSMSLAELRRWGVVRTVEVPGDRKEHFEAETNVWK
FT                   LVARVLREREKRAVEQALAAFERALAEVRAALADVDPAVKAQARFKARRLEVLSDLARA
FT                   ALTVLKLLVDSSRADVGPIKALSEALARRD"
FT   gene            complement(430903..431763)
FT                   /locus_tag="Adeh_0369"
FT   CDS_pept        complement(430903..431763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0369"
FT                   /product="4-hydroxybenzoate polyprenyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80145"
FT                   /db_xref="GOA:Q2IMW3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80145.1"
FT                   /translation="MTVAALARMVKLSHSLFALPFAAAAVALVAAEARLDPARLALVAL
FT                   AVVAARTAAMAMNRIADRAFDARNPRTQRRELVTGEVSAAAAWALLGGSAAAFVAAAAL
FT                   ISPVCGALALPVLAILLGYSYAKRFTWACHLWLGVAQAIAPVGVAIALTGTAPPASVVL
FT                   GLGVGAWIAGFDVFYSMQDMDYDRGAGLRSIPARFGVAGALRWARGLHLVAAAAIFAAG
FT                   ALAGRGAGWILGSVILAATLAAEHRYVAPGGALRPERINVAFFNYNAFASIAFALCALG
FT                   DLALR"
FT   sig_peptide     complement(431671..431763)
FT                   /locus_tag="Adeh_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.870 at
FT                   residue 31"
FT   gene            complement(431760..432998)
FT                   /locus_tag="Adeh_0370"
FT   CDS_pept        complement(431760..432998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0370"
FT                   /product="Amidohydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80146"
FT                   /db_xref="GOA:Q2IMW5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80146.1"
FT                   /translation="MIRVVAAPWVLPGAAPGAPAAAGRALADGAVALEGDTVRAVGPRA
FT                   EVEARFGRAEPLDAVLLPALVNAHLHLELSHMKGWVAGGEGLPAWIQLFVAARRRTREG
FT                   EPEEAMGMAAEDLARAGVAAVGDVTNTLDSLRPLAAAGIGGTIFHEVFGFTPGRFEEAR
FT                   AAARQAREAAAPPPGLRVVESPHAIYSTNAEGLRALLRAGPGSLHLAEDPAERAFCSTG
FT                   SAGAFGRMYASLGAELHALRITGRSPVDAVKDELRPHHLAVHCVDLDDEDVRVLAATGA
FT                   TVVLCPRSNRYILGALPRLEALLAAGIPLAVGTDSLASSPSLAPLAELALLRREVPAVP
FT                   AARLLPLAWNGAALGAPHVGRLAPGAAPGVLAAPLEGARPADPAEWLVSTFGAEERPFT
FT                   WLARQRPGPERPE"
FT   sig_peptide     complement(432915..432998)
FT                   /locus_tag="Adeh_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.685 at
FT                   residue 28"
FT   gene            complement(432995..434875)
FT                   /locus_tag="Adeh_0371"
FT   CDS_pept        complement(432995..434875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80147"
FT                   /db_xref="GOA:Q2IMW4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80147.1"
FT                   /translation="MPKKIRAAAVSFLNAWPLTAGLEGSERIELVQAEPSRCAAMLEAG
FT                   EVDLALVSVAALTKGQYDIVPGIAIGADGPVQTVVLAGEQSPAIWDEVFLDTASRTSHV
FT                   LAKLVLDAKGVHPRFTPMPAEEGLARAKGTKGALVIGDRGFGVRANHVLDLGREWTQLT
FT                   GLPMIFALWAARPGAVSPEDVQELTRAAQHGLGIRTELAQKFAALKGGDPEKYRRYLTQ
FT                   KIRYGLGPYELQGLEAFLERAATKGFLPPMPLRFVDDVVRTRRVRRAVSVDTALQKGAD
FT                   GERLDADEAATLDEHAPLLELGLAADARRRALHPGDLVTYIVSRNVNYTNVCTTACHFC
FT                   AFYRPRGHQESYVLTREELTQKIDETVALGGIEILLQGGLHPDLGVEWYEDLFRWVKQT
FT                   WPVINLHALSPEEIWHIARTSELGLEATIDRLIAAGMDSIPGGGAEILDDEVRRRIAPL
FT                   KCSTDEWLTVMKAAHRKGLKSTATMMFGVGEGPEHRVAHLMRLRELQDETHGFTAFICW
FT                   PFQSQNTRLEPGDGSAHAYLRTNALSRLVLDNVPNLQASWVTMGGGVAQAALHMGCNDF
FT                   GQVMIEENVVSAAGTTFKMDSEEVERHIRDAGFRAARRNMKYQLVEETRA"
FT   sig_peptide     complement(434813..434875)
FT                   /locus_tag="Adeh_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.747) with cleavage site probability 0.383 at
FT                   residue 21"
FT   gene            complement(434890..436056)
FT                   /locus_tag="Adeh_0372"
FT   CDS_pept        complement(434890..436056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80148"
FT                   /db_xref="GOA:Q2IMX0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80148.1"
FT                   /translation="MLSILANRALERDGLGPIRDKVLAGERLGDADGLRLFEAADLPAL
FT                   GALANHVREARHGALAFYNRNVHLNPTNVCVASCKFCSFARKDDQRASDGYTMSLDEAV
FT                   AKVLSRKPLGVTEVHIVSGLHPDLPFEYYTELLSRIRAAWPEVAIKAFTAIEIHFFAEK
FT                   FGMSYEQVLRRLMDAGLQTMPGGGAEIFAPRVRRKICDDKATADQWIEIHRTAHRLGVK
FT                   TNSTMLYGHIERLDERVDHMRRLRALQDETHGFQVFIPLAFHPEHNMIGKAFPKPTGYD
FT                   ALRTLAVARLYLDNFDHVKAYWVSLGERLAQTALSFGVDDLDGTVLEERIYHMAGSTVP
FT                   QALSERTLHQLIRAAGRVPAERDSLYRVLKVHDAPLPAEPPARLQVTA"
FT   gene            complement(436058..436645)
FT                   /locus_tag="Adeh_0373"
FT   CDS_pept        complement(436058..436645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0373"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80149"
FT                   /db_xref="GOA:Q2IMW9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80149.1"
FT                   /translation="MKLVVAVSGASGAPYARRLLDFLAANADLGVSADLVFTQTGKQVW
FT                   KQEIGAEPRYPFKIWKNQDFTAPFASGSSMYDAMVVVPCSAGALARIAYGISVDLVGRA
FT                   ADVMLKERKRLVLVLRETPISLVHARAMTQVIEAGAFVMPASPSFYSGPKTVDQVVDTV
FT                   VARVLDRLGIPNELMKRWDGLSPRAPEPVEEP"
FT   gene            complement(436642..437349)
FT                   /locus_tag="Adeh_0374"
FT   CDS_pept        complement(436642..437349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0374"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80150"
FT                   /db_xref="GOA:Q2IMW8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80150.1"
FT                   /translation="MSVNVPLPGEAHRASAVRAMFDRIAPRYDLLNRVMTLKVDQAWRR
FT                   RLLSDLAPKDGERMLDLCAGTMDVADLARRRAPGLRVTGADFSMQMLRRGVEKTALPAS
FT                   QADAMALPFLDARFDLATVTFGMRNLERYEVGLAELARVLRPGGRLGVLEFFRSESRGS
FT                   RFVHGAYNRLALPVLGRILSPDPEAYRYLVASMERFASRVEFEEAARRAGFRDVRGETL
FT                   FPGVCGLVTAVRA"
FT   gene            complement(437346..438899)
FT                   /locus_tag="Adeh_0375"
FT   CDS_pept        complement(437346..438899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0375"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80151"
FT                   /db_xref="GOA:Q2IMW7"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80151.1"
FT                   /translation="MKPQGTWGTDPRAMAYRSLREFLARLDEAGELVRITEPVHPVLEM
FT                   AALADRAAKQGGPALLFERPGTLPVAMNLFGTRRRASWALSCEDFEEHASELRALLRTA
FT                   PPQSFWDKLKMLPKLGKLAAMAPKHVSSGACQEVVDREPDLRTLPVLTTWPHDGGPFIT
FT                   LPQVITRDPETGIRNVGMYRLQVLGPRRLAMHWQLHKTATAHYRAYQQRGERMPVAIAL
FT                   GGDPALTYCASAPLPPNVDEYLFAGFLRGASVHTVTGVATGLDVPADADLVIEGFVDTA
FT                   APLVREGPFGDHTGFYSLADDYPALDVVAITRRKDAVYPATVVGPPPVEDQWLGKATER
FT                   MFLPLMQIVAPEIVDICMPVEGVFHNLCLVSIKKEHPGQAKKVIHGLWGSGQMAQTKTL
FT                   VVFDEDVDVQDVSQAAWRAFANVDVKRDLVIADGPVDVLDHAASGFAYGGKIGVDATRK
FT                   WREEGGREWPEVCVHPPEVIARMDALYDRLVPGAAPLRRPRIAPPPAASWTPRRGGILQ
FT                   "
FT   gene            439013..439288
FT                   /locus_tag="Adeh_0376"
FT   CDS_pept        439013..439288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80152.1"
FT                   /translation="MERRNRARDLIVLALAELDGELSTNQHRLCPEQLGTCRSRLQGYL
FT                   SALDGDALPPKRERAEDLGRLILDSWPYDVPLGQVILRAERAWRNA"
FT   gene            complement(439352..442216)
FT                   /locus_tag="Adeh_0377"
FT   CDS_pept        complement(439352..442216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0377"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80153"
FT                   /db_xref="GOA:Q2IMX5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80153.1"
FT                   /translation="MPSFALKSPVAVARAAIAPTLRPAPPGDCASRPPVHTCHSMRARF
FT                   AALAPLLLASCAFGRPRLSTPACATGAEALPSGIQLVAYALPHRPDTLVAASYRVGSAR
FT                   DPAGKEGLAHLVEHLSFRARHGGGRALSARLEAEGVEFDGRTSADATDFHAVGDPDQLD
FT                   ALLRIEADRLRDPLAGVDEAELRREREVVLQELALRGDPDALGSQVDWLTARALAGHPY
FT                   GRIATPESLRAITLEDVRAFARAHYRPENLLLLVAGPAPAGAVAARARAALGELATRPG
FT                   EPADPPVAPPELRASRPAALDVVRAPVERAWLLLTVPLPGDAAAGGARAYLALRALEAQ
FT                   VEQVLSGPDRDRALSVELLVHGMDGASLPVIRIGLRDPDDARPLVERLRAGLRFAGWQG
FT                   GPDPGAEELRDRLVLDAHVRLEAFDASEVARWIRLTGRTDYLTGMPAAVGAAVTPDRAA
FT                   FARRWLREERLVALAVVPGEAPRDEAPPRLAGASALDDDDPHGAAAAGEPAPARDAARA
FT                   MRPPHLDSARRRRLKNGVRVIVSPRPGYRVLSAHLVVRTAPAGPLERVFEVLALRAARC
FT                   ADRPATVGGDRLEFGARAPTELVDLALAQVACRAGDLAVDAAAFERERDAMADALRRRP
FT                   PTLHETAGQQLLELLYPGHPYSAEVTEARVRAFRAADAGKWLGLNVRPERAALVIAGDV
FT                   EATDALFERIEQRLGRWRPRGGDGTLPARPPAPLPGRRELVVVDRPGWRVAEVLVGVRV
FT                   PPRGARDEAAFRTLSWRLQHVLTARLREGEGLTYRVSLSMLEQSLGSALVLSTAVDRAR
FT                   AGEALAAVLAELAASARPLDPEALARARWRAVRRAGRALGTSWRNALRLTEMFVHGLPP
FT                   DEWDTFAARAAALDARALVAEAGRWALGREAIVVVGDAAVIAPALEAAGLPARVLPAIA
FT                   RRPPAETAAVGSAAAEPGPRASAP"
FT   gene            complement(442260..443309)
FT                   /locus_tag="Adeh_0378"
FT   CDS_pept        complement(442260..443309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0378"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80154"
FT                   /db_xref="GOA:Q2IMX4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80154.1"
FT                   /translation="MAAQEQAILSQLDASAQRGVRPERAQAALAGVPSLPESLLELEAQ
FT                   LTRATEDAEAKLQAAARHLVSAGGKRIRPMVTLLACGACGGEMRGAVPYAVAAELTHSA
FT                   TLLHDDVIDDGPVRRGQPASRVIWGNAVSVLSGDWLLTRALEIVSAEPARSAALPPLLA
FT                   TMRRLVEGEVLQLSLRGGFSATEQAYMDVVMGKTASLFGWAAAAGAWAAGEVGEIPAAL
FT                   VRFGEGIGVAFQLVDDALDYAADPGLLGKRLGTDLIEGKATLPLIRACEAEPSLRARLG
FT                   GVVDGTADVEAVAREVIEVVKRVGGVDAARALAREHTRSALEALEQVPDGVHRRALHAA
FT                   ALQLTERAF"
FT   gene            complement(443409..444938)
FT                   /locus_tag="Adeh_0379"
FT   CDS_pept        complement(443409..444938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80155"
FT                   /db_xref="GOA:Q2IMX3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80155.1"
FT                   /translation="MDPSRPARRPFLDAPRALAALAFALHAACGGRYGIFRDELYFVAC
FT                   GRRLAAGYVDQPPGIAVVARLASELFGTWVPGLRLPAWLASAATVLLAGRLAARLGGGT
FT                   AGAALASAATLACGVLLALGHYLTMNAFEPLLVLVLALVLVRLAEGGDPRLWVAAGAVA
FT                   GLGALFKYTSALVALALLAGVAATPARRALRTRWALAGAAVGLLAILPNVAWQLAHGLP
FT                   FLELVRNGQLHKNAPTSPPAFALGLLRDANPLLAPLWLGGLGWLLGRGDAPAARALGIG
FT                   AALYLALLAATGGKPYYAAPVLPLLLAAGGAAAAPLLRRPALRVAVPALALASLVPALP
FT                   LALPILPEPAFVRWQAALGLEPERMERTAYGVLPQIYADQHGWPELARAVAGAAATLAP
FT                   AERATAAVFGQNYGEAAAVEVYGAALGLPPAISGHNQYWLWGVPPGRGDPLIVISDADE
FT                   DCGGAFRERVLAARLPASPWVMPYEDARWIWICRGQRRPLAGLWPALRSYQ"
FT   gene            complement(444986..446059)
FT                   /locus_tag="Adeh_0380"
FT   CDS_pept        complement(444986..446059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80156"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80156.1"
FT                   /translation="MAAAERFEAALPGGAFAPDPVPDDGPFSDGGAFFASRNVTPPAAF
FT                   RASTPAGAGGWLTVESYTRRAGASTRDLAEVVPDPADPANHALRITSRAHTDATVLRPS
FT                   APLPARYRISVRVGFPSFGDGVAGGLNGYDGPADAGPWWPGEDATRQNGFYWLTILDRL
FT                   PRPHVNTWIHHHRKVVVDSDNHYPPWMEIWDGGRFVWSGEHPVMLFALDGTQPGAERTG
FT                   PPFLSYSDGAWQPSGAIRAVDAYLPDTWYRVTIERDGPRYTVEVSGRFRYGGEQTYRAT
FT                   IDAAAACVFHYPVDAAEAAGAARCVDEGAFASVGPAYPRWPAGGVWPDWFMLGDPHVNY
FT                   YEGSVLYDDLVLETWRD"
FT   gene            446244..447038
FT                   /locus_tag="Adeh_0381"
FT   CDS_pept        446244..447038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0381"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80157"
FT                   /db_xref="GOA:Q2IMX1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80157.1"
FT                   /translation="MPGPCASGRPAARAWYLRGVPVVKLVLEYDGTAYVGWQVQPNGPS
FT                   IQAEVERALATLHKAPRRVTAAGRTDAGVHARGQVASFREDRPLPVKAYVMGMNAVLPP
FT                   DVAVRAASLEPDGFDARRSARGKRYRYVIENLPTRAPLTRLQAWQHFHPLELANVREAA
FT                   AHLVGRHDFAAFQAADCACEHAVREVRRLEVLGEAGGRIEVVIEATAFVKHMVRNIVGT
FT                   LVEVGRGRRAPGSMLALLARGDRTEAGPTAPPQGLFLEEVFY"
FT   gene            447151..448239
FT                   /locus_tag="Adeh_0382"
FT   CDS_pept        447151..448239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0382"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80158"
FT                   /db_xref="GOA:Q2IMX6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80158.1"
FT                   /translation="MSQKKLKVGVLGATGMVGQRFVALLEHHPWYEVTLVAASANSAGQ
FT                   KYADAVKGRWALRSALPAATAGLTVKNASDVAAIAGEVDFVFCAVDMPKDETARLEEDY
FT                   AKHETPVVSNNSAHRGTADVPMMVPELNPEHAAVIEAQRRRLGTSRGFIAVKPNCSLQS
FT                   YVPAIHPLMKFGPKRIAVATYQAISGAGKTFESWPEMVDNLIPFIKGEEEKSEKEPMKI
FT                   WGRVEGGKIVAAQDPVITAQCIRVPASDGHMAAVFVSFERKPSKDDVLELWRSFSGKPQ
FT                   KLGLPSAPKPFLQYFEDESRPQTRLDRDAGNGMAVTIGRLRPDAIFDWRFVCLSHNTVR
FT                   GAAGGAVLTAELLTADGYIQAK"
FT   gene            448416..448859
FT                   /locus_tag="Adeh_0383"
FT   CDS_pept        448416..448859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0383"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80159"
FT                   /db_xref="GOA:Q2IMX9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80159.1"
FT                   /translation="MRFVDPTQIPELPLPFMNDDHAEEVRLLEALGEALEAHRARTGGL
FT                   DVVLERLSLLAVHTREHFLREEQVMRESGFPAYPQHKGEHDRVLAEMDGEARAFREGGD
FT                   PVRLHAYLFETVPAWFVQHIRTMDAMTARFVVSRPGAPGAAAV"
FT   gene            complement(448867..449700)
FT                   /locus_tag="Adeh_0384"
FT   CDS_pept        complement(448867..449700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80160"
FT                   /db_xref="GOA:Q2IMX8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80160.1"
FT                   /translation="MRPLGHAALAALVALAAACGGRAARTPPLAIDPPAFRPEALLPTG
FT                   ADAYGVALALSGRIENPNPVALPVAGFTYAFEVMGAPAGGGQVASELVLPAGGAVPVTV
FT                   PVRLRWADVPGFLEALATRPSLPVTVSGAARVRAGGGTVAVPYRMDGSVVLPRLPSVTL
FT                   ADAVVRESTLFHTVVELRVSVRNPNPFPLPTGRLSYDLSVSGVPVIQAAKSALDAVPPQ
FT                   GQATVVVPVRFSTVGAAAGALAGAVRGRADLSVSGRAGYGALEVGVDLRGALAAR"
FT   sig_peptide     complement(449626..449700)
FT                   /locus_tag="Adeh_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.853 at
FT                   residue 25"
FT   gene            complement(449830..452442)
FT                   /locus_tag="Adeh_0385"
FT   CDS_pept        complement(449830..452442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0385"
FT                   /product="AAA ATPase, ClpA/B"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80161"
FT                   /db_xref="GOA:Q2IMX7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80161.1"
FT                   /translation="MRMEKLTVKAQEVLAAAQGEARRRDHQAVDVEHLVLALLGQEEGI
FT                   ARPVLEKIGADPRLVASRVEDELRSLPKVSGAEPYPSNRLLKLFDRAEDDARKLKDEYV
FT                   STEHLLLAAAEDKGGAGEALRASGATPDRVRQAVQEVRGGARVTSPEAESQYRALEKYA
FT                   KDLTDLARKGKLDPVIGRDDEIRRVVQILSRRTKNNPVLVGDPGVGKTAIVEGLARRIV
FT                   DGDVPEGLKNKRLLALDLGALLAGAKFRGEFEERLKAVLKEVTGSEGQIILFIDEMHTI
FT                   VGAGAAEGAMDAGNMLKPALARGELHAVGATTVNEYRKHIEKDPALERRFQPVFVGEPS
FT                   LTDTISILRGLKDRYELHHKVRIQDAALVEAARLSSRYITDRFLPDKAIDLVDEAASRL
FT                   RIEIDSMPTEVDEVRRRIGQLEIERQGLRKEQDEASRARLAAVEKELAARNEEFTALKG
FT                   RWDAEKAVIQELSQARQELEALKVEQAAAERQADFQKAAEIKFGRLPELTRRVKAAEEK
FT                   LAEAQTRGAMLKEEVTPEEIGEVVSKWTGIPVSRLMEGEVEKLLGMEQRLHERVVGQEE
FT                   AVSAVSAAVRRARSGLQDPNRPIGSFIFLGPTGVGKTETARALAQFLFDDERAMVRLDM
FT                   SEYMEKHTVSRLIGAPPGYVGYEEGGQLTEAVRRRPYAVVLFDEIEKAHHDVFNVLLQI
FT                   LDDGRLTDGQGRTVDFRNTVIIMTSNIGSADIQRLAGRPGADMQQIREAALEHLRGEFR
FT                   PEFLNRVDEIVVFRPLGREDVGRIVEIQLARLRKLVEERHVTLELTEAAREAIADAGYD
FT                   PVYGARPLKRAIQRMVQDPLATRLLQGEFKAGDHVVVDEGKDGNIAFRKGERPAVTVH"
FT   gene            452703..454157
FT                   /locus_tag="Adeh_0386"
FT   CDS_pept        452703..454157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0386"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80162"
FT                   /db_xref="GOA:Q2IMY4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80162.1"
FT                   /translation="MASGGQGWKAMALAAALGGLGAPGAAGAGPKAAGAAAQAQAPAKA
FT                   KGPAGGGILRALDAALGEVIEKISPAVVQVTVSGYAPADETASGAIVRQRVLGSGVVVD
FT                   PDGYIVTNAHVVAGAQRVRILLPEGRGPAAHTARRIYDARVIGVEPEIDLALLKIDARN
FT                   LPVLALGRREVRPGQLVFAVGSPEGLASTVTMGVVSSVARQPDPARPVVYIQTDAPINP
FT                   GNSGGPLVDTDGNVVGINTFILTQGGGSEGLGFAIPSDVVKYVYESLRRHGRVEHSMIG
FT                   LAAQAITPGLASGLRLSQDWGVVVGDVAPGSPAEKAGVLAGDVIVSVDGRPIDGMPSLA
FT                   PAIYLHPADAPLSLVLRRGEEVLSVKVAGVEPRRPAERLADVADLARSTVPRLGVVAMD
FT                   LDEQARAAMPELRSPAGVVVVARVPEAGQAGAALEPGDVIHAVNRTPVASLTALKAAVA
FT                   ALPPGGPGVLRVERRGQLSWIELDLD"
FT   sig_peptide     452703..452789
FT                   /locus_tag="Adeh_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.789 at
FT                   residue 29"
FT   gene            454238..455347
FT                   /locus_tag="Adeh_0387"
FT   CDS_pept        454238..455347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0387"
FT                   /product="chalcone/stilbene synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80163"
FT                   /db_xref="GOA:Q2IMY3"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80163.1"
FT                   /translation="MGLVRAEAAVPSTIPHPEVLSVGRALPPNAADQETLIAALSAHWG
FT                   EAHHNTGRLADLHRATGVARRHLALPLDAYARLGGFGEANAAYARAGAELGEAAVRDAL
FT                   ARAGLAPADVAHLFYVTVTGVATPSLDARLVNRLALPRSVKRTPIFGLGCLAGAAGLAR
FT                   ASDALRAFPDEVAVLLSVELCSLTLQRDDTSMANVIATGLFGDGAAAVVLGGGARPASA
FT                   PRRGPAVVATASVLYPDTEWVMGWEVVDGGFKVLLSSKVPEVIAANLGADVDRFLGAHG
FT                   LDRGSIRHWVAHTGGPKVLEAVGGALGLPRAALERSWRSLHDLGNLSSASVLFVLGDLL
FT                   ESGEARPGDLGLLAAMGPGFAAELVLLRW"
FT   gene            455341..455646
FT                   /locus_tag="Adeh_0388"
FT   CDS_pept        455341..455646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80164"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80164.1"
FT                   /translation="MVTGRDAGAAAVGGGAEGRVAAEIVRIARDELRLDGASAALAEGR
FT                   DAPLADRLDSLARLSLVVAVEDRFRIALDDEGALAVRTLGDLARLVVARAAPELLP"
FT   gene            455643..457403
FT                   /locus_tag="Adeh_0389"
FT   CDS_pept        455643..457403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0389"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80165"
FT                   /db_xref="GOA:Q2IMY1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80165.1"
FT                   /translation="MRLRGPPQPPPRHPTLAHALAAAAGHPSGATFLDLHERETFLSWS
FT                   EVRARAERAAANLVHLGIRRGDRVAIVLRTEPAFLDAFLGAWLAGAVPVPLYPPVRLGR
FT                   LDAYAEDTGRMIRVAGARLVVSAGGTRRLLGGAVERGGPALGCVDVSALSALPARIARE
FT                   PEPDALGLVQFSSGTTVDPKPVALTHRALAAMADALVAATSAGPDDVLVSWLPLYHDMG
FT                   LIGCLLAAMSYPGPLVLIPPEHFLTRPALWLRALARKRGTISAAPSFAFAYAADRVRDA
FT                   DLAGLSLGTVRLLLDGAEPVSAVALRGFAERFARHGLDPGALVPVYGLSEAALAVTFAR
FT                   PGGRLGGLGVDAARLASEGVVAPGGREVVPVGTPVPGVEVELRGEGGMRVGEGRVGRVF
FT                   VRGPALMREYLGDPGATARALRGGWLDTGDLGFVVGGALYLHGRARDLVIVRGANHAPE
FT                   EFEAPLAALPGLRPGCAVALGFEPAGGAGEALLVLAERARDEAAPDAELEARVRRAVLA
FT                   ATGIAPHTVRLLAPGTLPRTSSGKLRRAEALRRFQAGTLAPPQPVSALRLALAAARSQL
FT                   AFGRSRRRGG"
FT   gene            457405..458511
FT                   /locus_tag="Adeh_0390"
FT   CDS_pept        457405..458511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0390"
FT                   /product="FAD-binding monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80166"
FT                   /db_xref="GOA:Q2IMY0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80166.1"
FT                   /translation="MARLRDAVVVGGGPAGLAFAAAAAARGLDVLVLERRRGPVDKACG
FT                   EGVLPAGVEALERLGVRARLGPALARPLRELRWVDPSGAVARLALPGPGGLGVRRVALE
FT                   AALRERAREAGAALEEGVEATDHRVLADRVRVRVAGGAAVEGRVLVAADGLGSPTRRRA
FT                   GLERRVRGPERFGVRRHADVADAGDAVEVHFGDGAEAYVTPVGPRQVGVAFLFERGAAR
FT                   SFEALLERFPALAARLEGAAFATPARGAGPLARAARARVADRLVLLGDAAGYLDAVTGE
FT                   GLSLAFGSAIDLAALLPGALSRGASARALAPYEAAWRRRWAPYARWTRLVLALARHPAV
FT                   RRRVIALAGAAPWPFERAVAAAVGAGAG"
FT   sig_peptide     457405..457482
FT                   /locus_tag="Adeh_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.551 at
FT                   residue 26"
FT   gene            458681..459643
FT                   /locus_tag="Adeh_0391"
FT   CDS_pept        458681..459643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0391"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80167"
FT                   /db_xref="GOA:Q2IMY7"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80167.1"
FT                   /translation="MRIRFALPAAAALVLQACATVSQPPVEVESPVPKAAQVAAQQQAA
FT                   APSAKRYKTKIAIARFTNETSYGRSLLNDADLDRIGKQASDMLASRLVMSGAFVVLERP
FT                   DLQKLEREQAISGGAGLVGADTVISGSVTEFGRSVGGKKGFLSSTKVQTARAKVDVRLV
FT                   DVKTGHAYFSALGAGEASTESGEIAGFGSRAEYDATLNDRAIAAAISDVIDRLVATLAA
FT                   RPWRSDILEVQGRQVFISGGRHQGVREGDLLAVMEAGNKVKSRQTGFEVALPPKRVGTL
FT                   KVLSLFGDGETSEGAVCELTSGTIEKASLPKLFVAEATP"
FT   sig_peptide     458681..458740
FT                   /locus_tag="Adeh_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.731 at
FT                   residue 20"
FT   gene            459652..459954
FT                   /locus_tag="Adeh_0392"
FT   CDS_pept        459652..459954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80168"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80168.1"
FT                   /translation="MRNVLFAAAAAALVAGCAMPQTVVKSVESRPSLAVVGAPAGAVLV
FT                   VDGQPVGEASAYDGNPAVLRVEPGTHQVEIRDPSGAAVYRQTVFVESELKTVRVH"
FT   sig_peptide     459652..459729
FT                   /locus_tag="Adeh_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.475 at
FT                   residue 26"
FT   gene            459956..460441
FT                   /locus_tag="Adeh_0393"
FT   CDS_pept        459956..460441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80169"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80169.1"
FT                   /translation="MRAPLRAILVLAASAALLQGCAGRSLYHWGEYDDALYAHYKNPQD
FT                   REAFVERLRVVIDGAEQAGEKVPPGCYAEYGYALYEEARYEDASRYFKLEREKWPESGV
FT                   LMQKMIGLADRRGGKEPVAPAPAKPAAAVPVKATKAPAKAPAKPAATHGPAGALERR"
FT   sig_peptide     459956..460024
FT                   /locus_tag="Adeh_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.401 at
FT                   residue 23"
FT   gene            460444..461139
FT                   /locus_tag="Adeh_0394"
FT   CDS_pept        460444..461139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0394"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80170"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80170.1"
FT                   /translation="MGRLGSLAGRLASPAGRLASLATLAALLSACGTAQVKKDYGAFNT
FT                   ARPRAILVVPVVNKSVEIDAPEYFLSTLPVPVAERGYYVFPVNLVKRVLEDDGLADASL
FT                   VHGADPVRLCSLFGADAVLLASVEKWEAKYMVVTTQVNVEFEYVLKDGKTGQTLWTERR
FT                   SMSYQPGNSGGGLIGALVNAAVTKASPNYMPLARQANAQAFAWPGPGFPAGPYRPEYGQ
FT                   DVQVMAAQP"
FT   sig_peptide     460444..460554
FT                   /locus_tag="Adeh_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.399 at
FT                   residue 37"
FT   gene            461204..461932
FT                   /locus_tag="Adeh_0395"
FT   CDS_pept        461204..461932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0395"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80171"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80171.1"
FT                   /translation="MSKLLLFYLLVQLTGSPLGALALLLAVWWLTDRMTVGVLPDPLRT
FT                   VARWRRRLQLARALEVNPHDRRARLELADLLLAGRRPARAAAVLRPNVEAGDEDAHTAF
FT                   LMGAALGRSGQADPAERALAVARAADPDFRAGEIDLELGRQRLGRGDAAGAREALERLL
FT                   VERPGSVEGRLWLARALDRLGDRDGARRRREEGWREYVSLPRFHRKHERPFAWRLQPWR
FT                   PTAVALGVVLVLAAVAAVAG"
FT   sig_peptide     461204..461272
FT                   /locus_tag="Adeh_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.900) with cleavage site probability 0.752 at
FT                   residue 23"
FT   gene            462057..463055
FT                   /locus_tag="Adeh_0396"
FT   CDS_pept        462057..463055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0396"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80172"
FT                   /db_xref="GOA:Q2IMY8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IMY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80172.1"
FT                   /translation="MRATVLGAGSWGTALASLLAGKGYTVTSWDKDAAVLDDIARNHRN
FT                   ERYLPGLHLPPTLHASAEVAKALEGAELVVLAVPSHAVRPVVIEAKRHVHAGTPIVCVA
FT                   KGIELDTLMTMTEVVEDVLPVPLHPYLAVLSGPSFAKEVAKGLPTAVTVAARWERIAKQ
FT                   VQDAFHTKTFRPYTSGDVVGCEIGGCVKNVVAIAAGISDGMGFGANAMAALVTRGLAEI
FT                   TRLAVRKGANPLTLSGLAGLGDLVLTCSSDLSRNRTVGRGLAEGKTADAIQRELGQVAE
FT                   GVRNARSARELAKRLGVEMPITEAIYRVLYEGLAPREAVTALMMRETKPEL"
FT   sig_peptide     462057..462119
FT                   /locus_tag="Adeh_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.808) with cleavage site probability 0.260 at
FT                   residue 21"
FT   gene            463168..465114
FT                   /locus_tag="Adeh_0397"
FT   CDS_pept        463168..465114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0397"
FT                   /product="Thimet oligopeptidase"
FT                   /EC_number="3.4.24.15"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80173"
FT                   /db_xref="GOA:Q2IMZ4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80173.1"
FT                   /translation="MSEPLRPEASRELTGTPAAFTEGCRRDMDRARAEAARARALGPAG
FT                   GLATLEAFDAAFAALSEAASRASLARNVHPDPALRDAAEAAEREVDALSTELSLDRGLY
FT                   DALAGLDPAGLDAATRHLVEKSLRDFRRAGVDRDDATRARVKALREELVRVGQEFGRNI
FT                   KDDVRRLEVEPAALDGLPEDWRRAHPPGPDGRVTLTTDNTDYVPFLTYARSAAAREALW
FT                   RLYRLRGHPRNLEVLSRMLARRADLARLLGYPSWAAYVTEDKMIGSEGAAADFIERIAR
FT                   AAEARMRRDHAQLLERKREERPDADRVEPWDSAWLQERVKAERYGFDSQSVRPYFEYAR
FT                   VKQGVLDVTGRIFGIAYRRAPDAPVWHPEVEAWDVVEDGALLGRVYLDMHPRDGKYKHY
FT                   AQFTLASGQAGRRLPEGVLVCNFPRPAPGAPALMEHGDVRTFFHEFGHLLHHVLGGHTR
FT                   WAGQSGVATEWDFVEAPSQMLEEWVWDPAVLATFARHVETGEPIPAELVARMKAADEYG
FT                   KGLMVRQQMFYAATSLELHRRDPAALDTTALVAELQERYTPFRHVPGTYFQESFGHLDG
FT                   YSAIYYTYMWSLVIAKDLFGPFREAGLLDPAPARRYRKAVLEPGGSKPAAELVKDFLGR
FT                   PHAFDAFAAWLEA"
FT   gene            465147..466142
FT                   /locus_tag="Adeh_0398"
FT   CDS_pept        465147..466142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0398"
FT                   /product="FAD/NAD(P)-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80174"
FT                   /db_xref="GOA:Q2IMZ3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80174.1"
FT                   /translation="MASIAAWRAGAAPPMSHRMSEPALETRVVRTAVPPEGEAVRTEVP
FT                   RRRIKDLEVMVADVIQETPDTTTLVLFTGNDRLDYLAGHFLTIDPRQFPALERWVAYLE
FT                   DLKGKREAPRAYSLASAPHERYLAITVKEETYQSGRTRYPPLLSPMLVRRTPRGSRFVI
FT                   TGFTGPYVLPPRVEEKTDHLVHVVAGSGSVPNWSILKHALREHPRLRHTFVYSNRTWDD
FT                   VIYREGLRQLEAEHPDRLRVVHTLTREPEPERHGPGVRRGRISAELLRELVPDPRAALY
FT                   YACGPAVGPIERAAAKERGETPAPRFLEAALGALDELGVPRDRVKRESYG"
FT   gene            466201..466998
FT                   /locus_tag="Adeh_0399"
FT   CDS_pept        466201..466998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0399"
FT                   /product="ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80175"
FT                   /db_xref="GOA:Q2IMZ2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80175.1"
FT                   /translation="MPRTLRAIPTLLKVGFAEAVAYRAEMVVWLLSTNMPLVMLALWTA
FT                   VARDAPVGRFGQRDFVAYYLATLVVRLLTGAWVIWELNYEIRQGTLAFRLLRPVHPLLA
FT                   YAAENLSALPVRMLVSLPIALGALLVVGRDRLTGDPLLLALFPVTVLGAWLITFLAMAI
FT                   IGALAFWIDQAGSLFEIWLGLFGVFSGYLVPLELFPHWVATAARFLPFRYMLAFPVEMI
FT                   IGMTPRPVALAELAVQWTFVVALALGARGAWALGLRRFAAFGG"
FT   gene            467003..467791
FT                   /locus_tag="Adeh_0400"
FT   CDS_pept        467003..467791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0400"
FT                   /product="protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80176"
FT                   /db_xref="GOA:Q2IMZ1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80176.1"
FT                   /translation="MGRYLRLLAVQFRASAAVAMQYRVEFLVEGALALFWTGWSLVPLL
FT                   VVYGSREAVAGWSFDEALVVMGWFTLMKGVLEGAVNPSLTTVVEHIRKGTLDFVLLKPA
FT                   DAQFLVSTAKFEPWRIIDVLGGLVIFAVAFHRMGRLPEAGGVLAACLLFAAATVILYSL
FT                   WIIVVAAAFFVVKVDNLSFLFVSIYDAARWPASVFRGALRVIFTFVVPLAVMTTFPAEA
FT                   LLGRLAPPRALLIAAGAVAFAGLARAVWLRSISRYTSASS"
FT   gene            468113..469030
FT                   /locus_tag="Adeh_0401"
FT   CDS_pept        468113..469030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0401"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80177"
FT                   /db_xref="GOA:Q2IMZ5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80177.1"
FT                   /translation="MLRLTFLGTSAAQPTIRRNLTGHAVRRERELFLVDCGEGTQRQLI
FT                   QFGAGFDVAAIFFTHFHADHYLGAIGFLRTLSMQNRAEPLDLYGPRPAKRLLETMLFTG
FT                   AERFSYEVRIHEVRAGEAVRRDGCAMVPFPTEHRTPSLGWALREDARPGRFHPEKAAAL
FT                   GVPKGPLFGALQRGEAVTLPDGRAVRPEEVVEPPRRGRALVITGDTRPCAATVEAARGA
FT                   DVLVHDCTFGDGEVERAEETLHSTARGAAQVAREAGVGRLVLTHLSTRYDRAWEPLVQQ
FT                   AREAWQGPLDVAHDGMVLEIPLPE"
FT   gene            469122..469826
FT                   /locus_tag="Adeh_0402"
FT   CDS_pept        469122..469826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0402"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80178"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80178.1"
FT                   /translation="MITVRKTEARGHFDHGWLDTRHTFSFADYHDEAHMGFRALRVVNE
FT                   DRVKPGEGFGTHGHRDMEILSYVLGGTLAHRDSTGGGGRLRPGEVQRMSAGTGVMHSEY
FT                   NGSDREEVHFLQIWLIPDRQGLKPSYEQREYPEAERRGKLRLVAAPDGAGGATTLHADA
FT                   RVYATLLAAGERVALPLAPGRHAWVQVARGEATVNGERLRAGDGAALSGEAEVALAGAG
FT                   EGTAEVLVFDLA"
FT   gene            469873..471063
FT                   /locus_tag="Adeh_0403"
FT   CDS_pept        469873..471063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0403"
FT                   /product="Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80179"
FT                   /db_xref="GOA:Q2IMZ8"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80179.1"
FT                   /translation="MPPNTPADDLARWVPRLLATWRAARKGPPRRGPRPPPDALLPEEL
FT                   REVGAAVARLSRGLTRDRELAGARYMDEERLLGAYLLFYWPVSYLQARGILSELPRRPR
FT                   AVLDLGSGPGPMAFAALDAGAAEVTAADRSARALAAARELARHAGEPLATREWNPARAG
FT                   LAALAGDRRFDLVSMGHVLNELWKGQDEDRRRAGLLEEALGLVAPGGSLLVVEPALRDT
FT                   SRALLRVRDLLVERGAAIRAPCLFRGPCPALLRETDWCHAERPVDPPPLVAQIAKAAGL
FT                   RREAVKMSYLLVAAPGEAWQAPPAGRVFRIVSEPLPSKGRLRYMGCGPEGRMGLSLQEK
FT                   HVRPGNRAFERLLRGDVVEVTGAEPRGDGLALGEASTVKVLAPAGRPVPPPRDEER"
FT   gene            complement(471068..472072)
FT                   /locus_tag="Adeh_0404"
FT   CDS_pept        complement(471068..472072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0404"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80180"
FT                   /db_xref="GOA:Q2IMZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80180.1"
FT                   /translation="MIQVHALAKHYRVARRPPGLAAAVRALFHRTYETVRAVDGIDFSV
FT                   GEGERVGFLGPNGAGKTTTLKMLSGLLHPTAGEVTVGGHVPRRREPAFLKAITLVMGQK
FT                   QQLIWDLPPAETFELNRAVYDIPRAQFQETVAELTELLELGPLVQKPTRQLSLGERMKC
FT                   ELAAALLHRPRVLFLDEPTIGLDVSMQATVRQFVKAYNERYGASVILTSHYMEDVLQLC
FT                   PRVVVIDHGRLIYDGDLRALAHRVRPDKRIVLRLASGNGAAPSGGELARFGQVVSAEPG
FT                   SATLQVAAEEVSAVVARVLAAMPVTDLTVEDPPLEEVFSELFRASRLAAEPAK"
FT   gene            472312..473121
FT                   /locus_tag="Adeh_0405"
FT   CDS_pept        472312..473121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0405"
FT                   /product="ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80181"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80181.1"
FT                   /translation="MLAAYREPLGGHPLLFVALPVEKVDRTAFQRDVSDAHVRKLTLAM
FT                   DKTRRYLDPIVAVREGERYLTPNGGHRLTALKELGARTVLALLVPEREVAYQILALNIE
FT                   KAHNLREKALEVVRMYRDLAGALDPKESEMALEFEEPALVTLGFAYEQRPRLSGGAYAP
FT                   ILRKVDALSDDRLSRALAERERRAGVVLAFDDAVGEAVARLKARGFDSPYLKNFVVARV
FT                   NPLRFMKGAAPPFDELFAQMTKRAQGMDPGKVKSEDVARSGGAPEAE"
FT   gene            complement(473130..473663)
FT                   /locus_tag="Adeh_0406"
FT   CDS_pept        complement(473130..473663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80182"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80182.1"
FT                   /translation="MEPAGALAHVRGAGHDSFMRRSRQLKPLSSEHHQAMLVAFQLKMG
FT                   LAGHPESAGAPKDLPGLLALARRFDEQVFRTHSRTEEDVLGRHLTGADLHRLGAEHAEL
FT                   TRLLDSARTARPPELRAALTAFAELLERHVRWEEREVFPYAEDHVDEETLATIGGELEL
FT                   RLVLARTEARAQRR"
FT   gene            473781..475088
FT                   /locus_tag="Adeh_0407"
FT   CDS_pept        473781..475088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0407"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80183"
FT                   /db_xref="GOA:Q2IN02"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80183.1"
FT                   /translation="MGMNGSPPPGRRAAVVAGLRTPFVKAGTDFKDLSATELGALLVNE
FT                   LVVRSGLPPNAFDSVVFGQVIPSPTVTLIGREMVLRTQLPRSVQAHTVARACATSIQAA
FT                   TDVADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLADRARILAGLRP
FT                   RDFTPTPPALKEPTTGLTMGESAEKMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDE
FT                   EVMHVPVPPRYDHVAARDNIVRKDTTVEALAKLRPVFDRRYGTITAGNASPLTDGAAAL
FT                   VLMSEERAKALGIRPLGFVKAYAYAALDPRDQLLQGPAYAAPVALERAGLRLADMDLVD
FT                   MHEAFAAQVLSNLQAFASKDFAERELGRSAPLGEVDPAKLNVNGGSIALGHPFAATGAR
FT                   MILQTLRELGRRGGQHALLTVCAAGGLGAAVVLERE"
FT   gene            475142..477316
FT                   /locus_tag="Adeh_0408"
FT   CDS_pept        475142..477316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0408"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80184"
FT                   /db_xref="GOA:Q2IN01"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80184.1"
FT                   /translation="MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAM
FT                   REFAAHLDRLEKDEAVKAIVVASGKPDVWVAGAKVELMQGAKDAAEAERLSRDGQALFD
FT                   RVERCRKPVVAAIHGACLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQR
FT                   LSRLIGIQPALDLILAGKTVKARKALKLGLVDEAVPPPLLLQVAQERAAALASGKLRRA
FT                   PRRAGGAVERVTRAALEENFLGREVLFRQARKLTLAKTKGHYPAPLRALEAVEYGYAKG
FT                   FEKGLEKEAELFGKLAMTPEARRLMEIFFATTALKKDNGVDDPAVKARPVSVVGVLGGG
FT                   LMGGGIAYVTVNAGLPVRLRERDDAAAARGVAAVRGVLDERVKRRSIDRLERAEKLRLL
FT                   TTTTDWSGLERVDVLVEAVFEDLSLKQEMVRAFEAVNPGGIFASNTSSIPIGRIAEASR
FT                   HPETVLGMHYFSPVNKMPLLEVIVTPRTAPEVTATAVALGKKQGKTVIVVRDGPGFYTS
FT                   RILAPYMNEAAHLLVEGAAIEDLDHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAF
FT                   GARMAPPAALHDVVKAGRLGRKNSKGFYTYGGKEKRVDETVYDLLPGGRRRKRVAADEI
FT                   QERLVLQLVNEAVRCLGEGILRSARDGDVGAVFGLGFPPFRGGPFRWADAVGTKALLER
FT                   MEKLRARHGDRFEPAPLLAELGRTGRPFHG"
FT   gene            complement(477439..479787)
FT                   /locus_tag="Adeh_0409"
FT   CDS_pept        complement(477439..479787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80185"
FT                   /db_xref="GOA:Q2IN00"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80185.1"
FT                   /translation="MQKLMRYSGALFFAGVLALAGCKGSDGSVGPQGPPGQDGTDGTNG
FT                   QNGQNGQDGKDAAAIAKPESCAVCHATAGTQHQAIYDNFADGLNPETTKLVISGITVAS
FT                   APGATEGTFNSVLTFDVTYNGAPYTAGIGALKQKRFTATQYDAALGFVTATAFSWGTPA
FT                   AVDGVPGRYTSTASGVAFAPESSNAFVYLYLGDKLILPAEGHYNLMDNVASAGVKYGTW
FT                   TYSSVANVSGCEKCHPAPYAKHGYRQATVAGLEDMVACKACHTDQREGTDFVFQILGDD
FT                   PAAAAALTVDAEGETIYSAEQQTKYAYVATIVNDTHMSHAMEFPYPQTMANCVMCHEGK
FT                   LDRILTQQYFTLKTCKSCHPVVGTEANAPALSAIVPHNIDYYTYTGDCSECHRDVNGIA
FT                   PKFSQIHLGYDPKIYASAGVKHSASFTTAIDGVTFTAATNVLTVDFSVAGAAANALVKP
FT                   TVVVSLYGYDTKDFIVSGHGSTGGLRNLEWTEAATNNSPRLAVAPLATAGNTAWTATAD
FT                   LSTWADLIASGVVKRVEVVVLPVVGLDQTAAVSDTNPEIAVAGVSKTVDLAAGALVADD
FT                   AAYGRDIVATSGCNNCHDALATSFHHPAYGAAGVVGCRACHVVGSGGSHLEMQSRSIDS
FT                   YVHAIHSFQAFDIRNVDFADPVAAMEYEHHVGSTYPNFTILNCRSCHEAGKFEVPDQQL
FT                   SMPSLLSASATITGKDRAIGTVPMYVTGPGSRACGSCHRAQMINADAAGDLASFNAHTA
FT                   TFGTMVETSSATSSTDFLDAVTKLFAQFQ"
FT   sig_peptide     complement(479704..479787)
FT                   /locus_tag="Adeh_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.818) with cleavage site probability 0.381 at
FT                   residue 28"
FT   gene            480509..481411
FT                   /locus_tag="Adeh_0410"
FT   CDS_pept        480509..481411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0410"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80186"
FT                   /db_xref="GOA:Q2IN08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80186.1"
FT                   /translation="MKLRHVLPLIIGFVFVPAALMLTVGILILVYGSVARDYLFGILIV
FT                   SLVGTTIIGSAATLAVLFREARVAKLQTDFVNKVSHELRTPLTSIRMFVETLQLGRLQD
FT                   PQRQREALEIVAEETARLSGLINRLLDWARMESGRRVYELSRQPLGPILDAALAAFEPQ
FT                   QLHHPVQLELDLPSRLPSVMADRSALVEAVLNLLNNAFKYTGAEKRIRLSAVASGPTVT
FT                   IAVTDNGPGIPQRDQKHVFDKFYRASDPLKRTVEGTGLGLAMVKHIVIGHGGKVSVESE
FT                   PGRGATFVIALPVAGGTHG"
FT   gene            481404..482096
FT                   /locus_tag="Adeh_0411"
FT   CDS_pept        481404..482096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0411"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80187"
FT                   /db_xref="GOA:Q2IN07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80187.1"
FT                   /translation="MAERILVIEDDPSILRGLQLNLGMEGYTVRSASDGETGLQLARTE
FT                   QPDLVVVDVMLPRMGGLEVIREIRKEDPELPILILSAKNQETDKVAGLQLGADDYLGKP
FT                   FGLKELLARIDALLRRRRSRGEGAQPKAIRRAGEIELDLDARRALVDGRALELTSREFD
FT                   LLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDDAEQPRHLETVR
FT                   GIGYRFNV"
FT   gene            complement(482153..483628)
FT                   /locus_tag="Adeh_0412"
FT   CDS_pept        complement(482153..483628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0412"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80188"
FT                   /db_xref="GOA:Q2IN06"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80188.1"
FT                   /translation="MTTPKFSPGPAGSALRGLPRTDRLVDAADRAGLVETLGRGPVLEA
FT                   VRAELDRHRAAVLAGEPCPSPEAIEAGLLDRLREDARGSLRPVVNATGVVIHTNLGRAP
FT                   LSEAAIAAMGRAARGYANLEYDLAEGERGDRYGHAEAPLCRLTGAEAAVAVNNNASAVM
FT                   LALAALMDAPPDRSGGGEAGVRPLAAPGRGEAEPGLPEVIVSRGQLVEIGGGFRIPDVL
FT                   RRSGAALVEVGTTNRTYLRDHEAAVGPRTRILLAVHRSNFRLSGFVHDTPLEELVDLGR
FT                   RRALWVVDDLGSGTLLETAPFGLGAEPTVQERIRAGADLVCFSGDKLLGGPQAGILCGT
FT                   REAIARVKRHPLMRALRVDKVTLAALSATLAHYERGEALEQVPVWRAIAAAPEALEARA
FT                   RGWLAALGPAGAGCAVRPSRSAVGGGSLPEVTLPTSVLSLPGAPDALAARLRRADPPVI
FT                   GRIEEDRVVLDARTVMPGEDEALIAAVRTALAG"
FT   gene            483709..485739
FT                   /locus_tag="Adeh_0413"
FT   CDS_pept        483709..485739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0413"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80189"
FT                   /db_xref="GOA:Q2IN05"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80189.1"
FT                   /translation="MPSIVPSPAAAESYLWAIILFPLAGAIVNGLTGRRLGRGNVTVIA
FT                   IGVMVGAFLVSSVAFYHALTGTVLRFRGEPWIQVTGADGRTIVSIGWGLLVDRLSATMI
FT                   MVVTGVGTLIHVYSASYMSHEDDAGYARFFTYLNLFVAAMLTLVLGDSLILTFVGWEGV
FT                   GLCSYLLIGFWYTDPAKAYAGRKAFVTNRIGDFGFLIGVFALFSIFGTVGYADLQSLAH
FT                   GVDPAAAIQTGVFAGRTYQAAVTFALIGLFVGACGKSAQLPLYVWLPDAMAGPTPVSAL
FT                   IHAATMVTAGVYLVARNAYLFSLAPAAMATVTIVGAATALFAALIAFVQTDIKKVLAYS
FT                   TVSQLGFMFIGVGVGAWWAGVLHLVTHAFFKACLFLGAGSVMHGMHEDTDIRNMGGLAR
FT                   KMPHTAATFGIATLAITGFVPLSGFFSKDAILGNALFSHNPAWHQVGQIAYVLGSLAAL
FT                   GTAFYMSRLFFLTFTGKPRTAAAAHAHESSPVMYVPLWVLAILSIVALLLGLPGHGPLA
FT                   EVFARFTEPVFAAGTERLHEVGHLHAGAHPAWPFAAAWALAAVGTLVAYLMYAGALRAA
FT                   PAALARTFPRLYQFAVDKFRVDELYQMVVIEPLKTAAYLLWRIVDVFAIDGLVVNGVAR
FT                   LVGYAGSVLRLAQNGDVQRYAAIMVVAAAVILWTVVGAGGR"
FT   gene            485743..487371
FT                   /locus_tag="Adeh_0414"
FT   CDS_pept        485743..487371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0414"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80190"
FT                   /db_xref="GOA:Q2IN04"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80190.1"
FT                   /translation="MNLLTVVTFLPLLGALAMVLVPRDEPSQHRALALVVSLVTFALSL
FT                   GLWFGFDASPGAPEFQFELMIPWMPTIGIGFHVGLDGVALLLFMLTTVLMPVVVLSAWK
FT                   AVGDRVKEFMIALLVLESAMLGTFIALDLVLFYVFWEAMLIPMYLLIGIWGSQNRLYAT
FT                   VKFFVYTFAASVLMLLAILYVYFHDGGTFDYVEARRALAVTPGAASWLFLAFALAFAVK
FT                   VPMFPLHTWLPDAHTEAPTAGSVILAGVLLKMGTFGFFRYALPLFPEAALQHRNLVAVL
FT                   AVIGIIYGALMSLVQTDMKRLVAYSSVSHLGFVMLGLMALSAEGMTGSVYQMLNHGVST
FT                   GALFLLVGMLYERRHTRLISEYGGIAKRVPVIAAAFVIVTLSSIGLPGTNGFVGEFLIL
FT                   SGTWLSRLGGSAVFATVAALGVILGAVYMLLLVEKVFFGPNQNAANHHLPDLSVREGFV
FT                   LAPMIALIVVMGLLPGPFLAPAKPAVDRLIQRFQVAEARLGKGPQVGTAVPAVMVRAPA
FT                   PAPAAEPAPLPAPAPVPLQQPGGNY"
FT   gene            487373..488848
FT                   /locus_tag="Adeh_0415"
FT   CDS_pept        487373..488848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0415"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80191"
FT                   /db_xref="GOA:Q2IN13"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80191.1"
FT                   /translation="MSGFPTQDFVALVPVAILTMGALVLLMTEVFLTSGRRAYQAYLTM
FT                   VFAAAAAAYAAWMPVPGNVFGRQAVVDSFSAFVTVVLCAGLALSALVGQSWLNARNSER
FT                   GEFYALALFGTAGMVLLGMATDLLIAFIAVEVMSLSTYCLAAFLRRGKKPAEAAFKYVV
FT                   LGSISSALLLYGSALLYGASGSTLFSLLPRGQGSALYLAGIALVAGGVAFKIAAVPFHA
FT                   WTPDVYEGAPTPVTAFMAAGVKTAAFAVLVRLFLATESGSAAMSTSLGTVLSALAVLTM
FT                   IFGNLLALPQRSVKRMLAYSSIGHAGYLLVGVVSAVVAGARDKALAGLLFYLAAYTATV
FT                   IGAFAVVGALERRTRGDFEPADAWDLDRFAGLARRRPALAFAMAVFLFSLAGVPPTAGF
FT                   IGKFYIFKAAMGAGLYGLAVLGVLTSVLGAYYYLRVVLYMYFLPSKDEAGEVVLSAPSL
FT                   TIALAAAVAVVVLLGVVADPMVRLAQAASAIIL"
FT   gene            complement(488961..489302)
FT                   /locus_tag="Adeh_0416"
FT   CDS_pept        complement(488961..489302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0416"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80192"
FT                   /db_xref="GOA:Q2IN12"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80192.1"
FT                   /translation="MAQCFLLVDADRNFREALAIALRLDGHRVEVCVGADEALARLAAG
FT                   GVDCCLVDAHMPGADEVLAAATAAGARPVMTGPYADVLEQAARRHPAATALPKPFRAAE
FT                   LADAGRAAH"
FT   gene            complement(489616..491040)
FT                   /locus_tag="Adeh_0417"
FT   CDS_pept        complement(489616..491040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0417"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80193"
FT                   /db_xref="GOA:Q2IN11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80193.1"
FT                   /translation="MVVPDPQEDPRAPRIAEPPPGGKVLVVDDQKNMRATTAILLRQAG
FT                   HAVEEAEDGASATQRVQHESFDVVLTDLRMPTVDGMEVLRAVQQASPETQVIVMTAYGT
FT                   IESAVEAIRRGAYDFLAKPFKESEVLLRVSKALEKRRLLGEVNLFAEEFRKRYGLEHIV
FT                   GRSPAMRDVLDRVLRVAPTDATVLITGESGTGKELVARALHVTSRRSDKPFVPVNCAAI
FT                   TDTLLESELFGHARGAFTGATRARRGLFEEANGGSLFIDEIGETSPGFQAKLLRALQEG
FT                   EIRRVGESSPVQVNVRIIAATNQDLRRAIAERRFREDLFYRLNVVPLRIPPLRERREDV
FT                   PLLAAHFLQRFVQRTGSERVLTPEAVASLVAHDWPGNVRELENIIEQAAALCTGREIRA
FT                   ADVQVEARAAPAAGAGVTLADAVEDTERRAITAALVRCGNDLGRVARDLGISGTTLWRK
FT                   MKRLGIEAGEHTSAGP"
FT   gene            complement(491054..495637)
FT                   /locus_tag="Adeh_0418"
FT   CDS_pept        complement(491054..495637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0418"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80194"
FT                   /db_xref="GOA:Q2IN10"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80194.1"
FT                   /translation="MAERFQGGSLVVRDRKVVYASEGAAALAGRTVPTMVGLDVLDLIA
FT                   PEDMARVVERHERRLRGEAAPAEYEVGVLLPDGTRRAVELRVRVHGRDVLVEVRDATAQ
FT                   ATRRPRLEALAELGAALQREPSEAAVLERLRGAAGELSALVLLARPEGDGLRVDWSALP
FT                   PPAAARLERALERPLDGQLGRWPPMFRLAWDAGAAYSDDLPAEAAAFVPEPRAAATREA
FT                   IAAIGIARAVVVRVEARAGPALGLLVAARWLRSEDVGALRLFGAQLAAALDAARTIADL
FT                   SRHNADLALLNRVGRLAGDAPDLDAFFAEVTTVLTAATGCAVVAVYLVDEGGRELVRTF
FT                   ASGTSPEVQARLERVPVTARIGEVLRDRAARAVPVDAAESGAEALRAEGIRAGIWVPLV
FT                   ARGRAVGVMVAAFRDELEAVRPWLGLLGAVGPHVASAVETQGLLGALRRRVAELTLIND
FT                   VAMGSAQLDPVLLLDTSLRRVVETFQADTGAAFVREGERLALVAGHGLSAETLRRASRL
FT                   GLGESLPGLAVKRCGPARYPDDADPTAFQVARTEGLQAAMAVPLLAKGQAAVGSIVLGR
FT                   RTARPFAEREVTLLSAMAVQIGVAVENARLFADVRRRLSDLEAVHALALRIFGNAPGDV
FT                   PALLDDGCREVTSALSCRGAAVLLVDPQERCLRGVGGWGGPLRAEALRIPAGQDLLAED
FT                   ALRRGAPAWTEDASRDPRSALCGREGLPPTALLVVPLTSRQATRGVLFLFDDAGRSFSD
FT                   PELALANALAGELAVGLENAELYAEASRRVEDLSLLNEMSRTVAGSLDLDHVLSEGVDA
FT                   ARRLLGAAVGVVHLYDPVHLALRAAAISQGGAAALERASAALATGEGLSWRSVRERRTF
FT                   VVEDADAEAEGLNRLLVEHHRARAAIVAPLLLRGEPLGVLVVVDTARPRRFTPAEVERV
FT                   TAVANQLAVAIENARLYAEARGRLHELSTVIDVARVVSSSLDLEEVLSAGAEHLKQTLQ
FT                   GSDCTILLDDYRRRELRRAATRGAPIGPAAVPVADRSLARDALEARTPVAGRLAEPGVP
FT                   DRALLAVPLHVRDHPVGVALVAAASMDRTFSPGELSRAMAIASQLAVAVDNARLYSETR
FT                   RRAEELGLLHEVGRSLVATLDFEQVLDAGVRNLARIVDAPRAAIALCAPGREQLQVRAA
FT                   WGLPQAAVGVDVPVEAAAPRLAAMVFERREPIAIEDAARDPRVREDVASDPSIRAMLGL
FT                   PLLVRDRYIGAAVIVETRGPRRFSPAEIERGAAIANQLAVAAENARLYEDLRRSYAELA
FT                   HAQRQLIQQERLAALGELSAVVAHEVRNPLGVIFNSLGSLRRMLRPQGDARMLLDIVGE
FT                   EADRLNRIVGDLLDFARPSTPEVRPEPLDRVVEEALATALAQNGQPIEILREVDPALPQ
FT                   VPMDARLVRQAVVNVAVNAVQAMPRGGRLTVRLRRDGDAAVLELEDTGAGIPEEVRGRI
FT                   FEPFFTTKASGTGLGLAVVRRIVEGHGGEVAVTSRPGAGTAFALRFPLTPLAGEGGGPV
FT                   EKEAGIG"
FT   gene            complement(495637..497586)
FT                   /locus_tag="Adeh_0419"
FT   CDS_pept        complement(495637..497586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0419"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80195"
FT                   /db_xref="GOA:Q2IN09"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80195.1"
FT                   /translation="MKRVVIGTAGHIDHGKTSLVRALTGIDTDRLRDEKRRGITIELGF
FT                   AHLALPDGSVAGVVDVPGHERFVRSMAAGAGGIDLVVLVIAADEGVMPQTREHLDICRL
FT                   LGVPRGLVAVTKADLLPELGADWLPLLEQDVREVTRGTFLEGAPIVPVSSATGEGLDAL
FT                   RAALGALAAEVPERPADGPLFLPVDRAFSMKGFGTVVTGTLLSGQIAEGDAAALLPASA
FT                   GGEGLRVRSVQVHGKPTPRALAGQRTAVNLPGIEPAAIRRGQVLVHPGVVPASSIIDAE
FT                   LTLLAAAPKPLRHRAKLLLHVGTTQVPAVISLLDRAELAPGATAHAQLRLAEPAAALPG
FT                   QRFILRGFAVLEGRGKTVGGGRVLAVAAPKRRRGRPESLAQLAALAGPDPEARLATVLA
FT                   MAGPAGLDLPALVGRTALSPKAAQGTLDRLGARGGAVLFDRERRAYVAGPVAQELTRRM
FT                   AAAVAAFHRDHPLAAGMGREALRGKLPPVTDPRLFQRLLAQAAERGELVVEGDVVREKG
FT                   HAAASGESAGGALKEKVAAALAKGGLTPPWLAELPGAVGASAPDVQAVLKLLAAEGRAL
FT                   RVSSELYFDAAAVKALEAKLVAWLRERRQITTQEFKDLVGATRKHVIPLAEYFDREKVT
FT                   LRVGEKRVLRGEGR"
FT   gene            complement(497610..498371)
FT                   /locus_tag="Adeh_0420"
FT   CDS_pept        complement(497610..498371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0420"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80196"
FT                   /db_xref="GOA:Q2IN17"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80196.1"
FT                   /translation="MVDFGRPVTGRSRPESRRDTIASAKKRKTVRRRPPARGKAARAGA
FT                   PAPRKAAPRKRAAPRARVKRRPEQPLGMGVADGFAMDRLAAPAQLRRAPKKAMREIGWA
FT                   AFGEVARGLAARIHESFRPDVVVGIAKGGVFVGGALAAALGAEFQPVRIEKRRRDAGGP
FT                   GGPASELPALTGRRVLVVDDVAATGATLAKARAVARKAGAREVRTAVLVVRPSGARPDF
FT                   HAFETDELILFAWDYQLDQLGAAVDPGEVGV"
FT   gene            complement(498393..499280)
FT                   /locus_tag="Adeh_0421"
FT   CDS_pept        complement(498393..499280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0421"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80197"
FT                   /db_xref="GOA:Q2IN16"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80197.1"
FT                   /translation="MTDRLCRGLLPQRGLRAVFVRVGDTARMARVLHGLYPTSAHLFAQ
FT                   GLAAGALLGALQKEQGRVNFQIECDGPVGGLFVDADRDGNVRGYVRRPAVHFPGDPDRA
FT                   ARAALGGSGFLSVLRDPGSGQYYRSAVELEALDVAEDLRRWFAASEQVETALDLAVVGR
FT                   DGEPLAEVGGLLLQKLPDGDAAAIGAARERLAAGALRAALARGATAQEVIRDVAGDGFE
FT                   LLADEEVAYRCGCSPERARAAVSALGREGIEQVLAEEKQAVISCEFCRQRYVIGEAELR
FT                   DIARRLAERDAQGG"
FT   gene            complement(499461..500063)
FT                   /locus_tag="Adeh_0422"
FT   CDS_pept        complement(499461..500063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80198"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80198.1"
FT                   /translation="MRVARRYRRPMRTPALLRLSVLCAGLLAAAAARAQDVPFEPSGEV
FT                   RILAWGTMGTSAAFDEGRIVGPTVNLTRREDGTWAGDLAGRNVSLEIREGRLSGANVNL
FT                   VLTQKGTATHGEGLFYGVRFRFDLDGKRLSARFGDCTVDAKRLKAPGQLRGDAACLRRG
FT                   ASFPSSSRATVQLIGDAANEPPPLPQLALALLATMAG"
FT   sig_peptide     complement(499959..500063)
FT                   /locus_tag="Adeh_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            complement(500060..500977)
FT                   /locus_tag="Adeh_0423"
FT   CDS_pept        complement(500060..500977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0423"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80199"
FT                   /db_xref="GOA:Q2IN14"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80199.1"
FT                   /translation="MPRTVLVTGISGNLGRALAKHLHTEAQVVGLDRRAFPGKPKDIDH
FT                   HQADLRKARSEDAFRRRRVDAVIHMGIMHDPRMPFSEAHSFNVVGTQRLLELCVRHGVK
FT                   KVVVLSSANVYGPRPQNSNFLPEETPLMGADRASDVRDLVEVDMYAQSFMWRHPELETV
FT                   IVRPVNIVGPTVRNAPSNYLRLESPLTVMGFDPMLQLIHEEDVCRALVLALRPGLRGVF
FT                   NVSGPGEVPLSAVLRELGRGPVPIPHPIIRPLVRRLFDARLTSFPPDEVDHIQYLCVVD
FT                   GSRFAREAGWAPRFSMRETIRSVL"
FT   gene            complement(501013..501867)
FT                   /locus_tag="Adeh_0424"
FT   CDS_pept        complement(501013..501867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0424"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80200"
FT                   /db_xref="GOA:Q2IN22"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80200.1"
FT                   /translation="MAELSEAIKARLRAWTFALGGPGTRSRLEKLTPPRNEYGVDPYGF
FT                   DSEYAVAAIAPLLWLYRKYFRVQVHGLEHLPTEGRVVLVSNHSGQLPFDAAMIEVACLI
FT                   ELDPPRAVRALVERWVPTLPFVSTFMARCGQIVGTPENCRRLLAADEAILVFPEGVRGL
FT                   NKPFSQRYQLQRFGAGFLRLALESGAPVVPIGVVGAEEQAPALFDLKPLAKLLSFPAFP
FT                   ITPTVLPFPLPSRYHIHFGAPMRFQGSPDEEDEALERKVAQVEAAVRGLLARGLAEREH
FT                   VYW"
FT   gene            502009..505428
FT                   /locus_tag="Adeh_0425"
FT   CDS_pept        502009..505428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0425"
FT                   /product="zinc finger/thioredoxin putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80201"
FT                   /db_xref="GOA:Q2IN21"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80201.1"
FT                   /translation="MRVTCPHCNAAYKIDDARVTPAGVKVRCPRCHQSFPVRRPDEEGA
FT                   AVPLPGGAAAAAGVPLPAPAAPPPAAATGIPLPPPPGTGSIPLPPPDPAPGGEDSPFAF
FT                   GPAPEAPSPFALGPAQEPEPAFTGASGARAPVELPGPAAADDAPLGFGEVDFPEPPAAP
FT                   PPGATPERFDAGPAPVDDADIVVDEPGEPDPFVAAASEPAFDAAPAGGPAFGGPSGAAR
FT                   AGASEELEMLFGEGARPADAAAGDGYRVRRRSGKVFGPFTEAQIAEMLAKGELLGNEDV
FT                   SADGATFEALSAVPAFAAELERLAAQEAAHAPPPAAARPPGAQPFGDRMAAAKVVEGER
FT                   EPLARRLAKPLAAGLAVAAVLAVGLGAGLTGHGWFFTGHLRRGDSKVAVQKLAGARAAL
FT                   ARGDHASERSALDLAAQAVAADAGSAEAAALHAMAVAALERRHAAPRPALDQARRAAEA
FT                   LERDDPGSLPALEARLAVALATTPGAGTAAAETALAAALAKARPDPQAFALLGEAALAR
FT                   GDAVKAAAAFQRLGGLEQGPRAPMGLARAALLRGKPEEARSVLEKVAAADAAYLPARLE
FT                   LAALAEAAGDVDGARTQLAPVLADAAQPRLAPLERARARMVEAALLDRSAATAADAEKA
FT                   LLAALEADPRLAAARAALVRQRLRRGDAAGAVAASDPVAAEAASDPALAAARVRALALA
FT                   GRALDAARLADQALGVAPGTPALLVAKAVALSAAGKPQEAAAAYAEALARDAGAVEPRV
FT                   ALGRLALARGDLPAAREALAQAVEKGPRDPAAHAALGELRAAEGDAAGAEAAFRAALAL
FT                   DAEHAAAVLGLARLAQARGDVAGARAGLVRALALEPRSAEAQLALGTLEWSARDLEKAD
FT                   AALAAAVDLQPRNAAALTRLGAVKLERGDAEAAVKLLGAATSEAPGAADAQLWFGRALL
FT                   ARGETPAALVRLRKAVDLSPGAPEPRLQLGQALERSGALQEAIEAYQAAAAAAPALPDP
FT                   HERTALLYTANGRCDLALAPLARAIELAPRATRLRVELGECQGRLGKHAEAVRTLRAAQ
FT                   RADPAAAQVLYPLAREVHQAEGVRAALPLYERAVRDDPKNAMPHYFLGYAYKERGQRER
FT                   AVQAFRAFLALKPDAPERRDIEAEIEDLGGAR"
FT   gene            505510..506052
FT                   /locus_tag="Adeh_0426"
FT   CDS_pept        505510..506052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0426"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80202"
FT                   /db_xref="GOA:Q2IN20"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80202.1"
FT                   /translation="MRSTPARSGPAADARRVRELLVRLSRHGSLRDPIGGSGHGLDLSP
FT                   VQVHALLWLGMGGALTMGELARHVAVTEKTITGVVDRLERDELVQRARSRDDRRVVRVS
FT                   LAARGEAAWRALDAEISARLEGLLALLEPRDRRDLVRILARLDERLRPAADAAPGPARA
FT                   RAARGAGGRQHERREDA"
FT   gene            506049..507416
FT                   /locus_tag="Adeh_0427"
FT   CDS_pept        506049..507416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0427"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80203"
FT                   /db_xref="GOA:Q2IN19"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80203.1"
FT                   /translation="MNALITAALALALAQAPETPSTPTSPPAPEGAPAAAPGQPAPGAL
FT                   PVLTLDDALATAAAQNLDLKAAQARLRQADELSWKAWSGYLPQVTASGTYTRNETEAVL
FT                   PAGSLGPGSPKITIQAQDQLNGLVEATQALLAPQLLFAIPNANRGEEIARLNVETARRE
FT                   VLFGVAQAYYGAASLRRAMEVSERLLEIAARQEKDARVRYQAGAIAKVGLLRAEIDRAR
FT                   AEQDVKRSQNAFASARIALATLLDRRPDFDVVDPPEPVLAGDADALVAAALRDRPDVQA
FT                   ARVNVELQRGVRNQAVARYLPNLGAFGRYTLANEAGFTGTNHAWAAGLALQWKVLDGGL
FT                   RESDIREANAKIDEANASSASAELKARQEVEQAYLDMESARANAAKAKEQRDLAAENQR
FT                   LVDVAFRAGTATAVEQADATAQLRTAEVGQITESLTAQLAALRVLKAAGAFHPTRR"
FT   gene            complement(507601..508872)
FT                   /locus_tag="Adeh_0428"
FT   CDS_pept        complement(507601..508872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0428"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80204"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80204.1"
FT                   /translation="MRSHDARAAAMGGTGHAGGVIHVPAVADEPSPAPADLASLTQAQR
FT                   AERALAEGRREREIPIERAFLQAALDFRQTLRVLVSAVVPKFADWCFVDLIDGDGIPRR
FT                   VEVAHGDPAKAPLAQEMRSIAFGPGWATPGAQTIRDRAPRLFRQVTTEVMEWATHGERH
FT                   LAVLRAIKPNSLLSVPLVARDRVIGSITLIRSNMLPGLDEADMVFAEALAEPAALALDN
FT                   ARWYQAEKAGRGAALEEADRERHDRVEAQRGVLRLRRIESVSASLASVLAPQAIARVAV
FT                   ENGLSVLEPATAMVVRAAPGASVLEVLHCQGWADDLTIDLRELRADAPALLAEAYRIQT
FT                   AIWVSSPEALAHSYPNAAELALRVGDRAWAAVPLRCDGRTVGALGLGFPHPRDLDADEK
FT                   RFVLTVAQIVAQALERARLRDEAR"
FT   gene            complement(508991..510007)
FT                   /locus_tag="Adeh_0429"
FT   CDS_pept        complement(508991..510007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0429"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80205"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80205.1"
FT                   /translation="MRVESAPGAGGHLPVEQRSERTWTTLPSTPCAAGRRHAFLLVLAG
FT                   PQLGEIYPLAPDRELVIGRRDDCDLPIRDDGVSRRHAAIRVEGEGAVLRDLGSANGTYV
FT                   DGARAEGEVRLADGGRVSLGGATVLKFAWADELEARWQMKLAEIALLDPLTGVFNRRHL
FT                   DDRLAAELAAAQRHGRSMSVLLVDVDRFRAVNEAHGQAAGDEALKMVAFVLRGALRRED
FT                   VLARAGGASFAVIARETTLAGGRALGERIRRAVARSRCAWQPEGGGEAASIGVKVSVGV
FT                   AEVAEGRTQREVMESAGRALQLAKQAGRNTVVAIPMAPAEGRPDPAQAAMTRGGAAP"
FT   gene            510076..510972
FT                   /locus_tag="Adeh_0430"
FT   CDS_pept        510076..510972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0430"
FT                   /product="protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80206"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80206.1"
FT                   /translation="MIRYGPAGWEYRDWAGVVYPPGEGKRFDRLAYLARWFSTVEVDAT
FT                   FYRPFPAPVAARWCERVREVPTFRFGAKIWRRFTHEREAYGAEDVAQARAALDRLHEEG
FT                   RLGAALLQFPWSFKRSEASEEWLRGLFRAFAGLPLALEVRHASWDDPEVLEELTAAGVA
FT                   LVNVDQPRFQRSLAPAARVTAPVAYVRVHGRNYRDWFRKGAPRDARYDYLYGADELAPW
FT                   AGRIAEMAASPRAPDVYVVTNNHFRGQAPANAKMLEAMVEHRRVAVPPPLLAAYEAALA
FT                   PFAAPGDGAGNSATTGA"
FT   gene            complement(510900..511688)
FT                   /locus_tag="Adeh_0431"
FT   CDS_pept        complement(510900..511688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0431"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80207"
FT                   /db_xref="GOA:Q2IN25"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80207.1"
FT                   /translation="MKIGTWNVNGIRAREAQVGEFIAREGPDVVCLQEIKAPPSKVPPS
FT                   LCELEGYWCLWHGETAYSGVALLVRKAIAPERPAFVHPPFDLETRVATCELGGVTVASI
FT                   YVPNGGKDLAAKLRFLEAMERFAADAQASGRPLVLCGDLNVARTDMDVHPKERKAGAIG
FT                   QLPEERALFERILAHGLVDVGRALDPANEGLFTWWAPWRNLRQRNIGWRIDYVLASAPL
FT                   AASATRCRVLADFGTSDHAPVVAEFPAPSPGAANGASAAS"
FT   gene            511905..513875
FT                   /locus_tag="Adeh_0432"
FT   CDS_pept        511905..513875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0432"
FT                   /product="Inositol
FT                   monophosphatase/ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80208"
FT                   /db_xref="GOA:Q2IN24"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80208.1"
FT                   /translation="MCPARRRHRVPRDGPHANGRRYEIPPPDLAALDTHGGVTELARAL
FT                   EAALRAARAAADLLRAELFRAGGPRGEPGHCPADEEAEDLIRAILDAVFPGDGFVGEER
FT                   PERNRPPALPGGRCWLVDPNDGTADFQRGHRGASVSIGLVKDGVPVLGVVLAHTAPHGG
FT                   EDLLAWAEGEGPVLRNGAPLPPISRAPLQAGDVVLVSSSAAKRARGNAEALQPARFRPL
FT                   TSIAYRLAMIATGEARGAVSLHRPRALDVAAGHALVRGAGGVLLDEAGREVRYGPSGEG
FT                   RVAFCFGGAPAVAERLATRSWVEAQAYGPGAPGLCAPLAGRAVRDDGLLRRGQGALLGQ
FT                   LAGDALGGQVEFSGRARIAAAHPQGVRDLADGGHWSTLAGQPTDDSELALALARTVIAF
FT                   GRFDAARVAEAYADWLGSEPFDVGRTVDAALRPALRARAAGGGAEQVAEAARAAAPRGS
FT                   LANGALMRVSPLGIAGHAAPAAEVAAWARADAALTHPAPPCQDASAVFAATVAFAIASG
FT                   APAAEVADRGEALAGELGCGPEVREALAAARAGPPEDFEASAGLVTIALQNAFFQLRHA
FT                   PDLEAGLVDTVGRGGDTDTNAAIAGALLGAAHGVLAVPERWRRAVLSCWPVEGAPGVRR
FT                   PRPPVCWPGDALILAERLLGL"
FT   gene            complement(514450..518187)
FT                   /locus_tag="Adeh_0433"
FT   CDS_pept        complement(514450..518187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0433"
FT                   /product="exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80209"
FT                   /db_xref="GOA:Q2IN23"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80209.1"
FT                   /translation="MRILAIRGENLASLYGKFELRLDRAPIAGAGIFSIAGPTGSGKST
FT                   LLDALCLALYGKTPRLRDRAAGKRVMVGWSEEGETLDMNDVRALVSRGTAGASAEVEYQ
FT                   GMDGRRYLARWRVRRARDRVEGAFQAQAMTVEDLDTGEVLAEKVTQAVARNEAAIGFTF
FT                   DELKRAVVLPQFEFTNFLRADADVRAAILERVTGTAVYGRLSQAAHQRLGRELAARAAL
FT                   EAELGGVQVLDAEARAALQARQAELARALDEARAAVRAAEAEVRWHAQDAELRAGLERS
FT                   EAERARAARAVEDGAALRAELDEVEAAEPHRAALAEAVRAEQARAGADARAAAAQGALG
FT                   RAEVDAAAAARGEADARAALDAAAGAEARARPELAEARRRDEALAAARRAEADAGAALA
FT                   TARAEQAQAAAGADAAARAREAAATARDAAEAWLAAHAAEAPLAAEWNRWAARLAEHAA
FT                   ECAGAAQADAGLRGAREAEAEAARALAAEARGAEAAARRLEAAGAALADAARTAAGADA
FT                   AALTAEVARLGDLRALLGEACKAAQAAAVAAARREQARTEAAAAGAEQVAAQRTHAAAE
FT                   AAVQAAEAGAAQARAALRRVELTLGLADRRADLVDGEPCPLCGAAEHPYAHGAPLPALL
FT                   EAQRAAAAEAEEAVRAATREREAVAARASELAARVEAERRAEAQAEVDRAHHAAEYDAL
FT                   RARLAAPAAGGVELPGRAEEAAAAVEARGRDAKAALEAAKAALEAARGAAEAERAARAE
FT                   VDAAREAHEAARARQRALEKARDDAAAAVTAHEAAAARHAAALGRIEAELAPALGFLPD
FT                   WPEAARRGPEAFRAGCAARAEAHAAQVRARDAAAADVAARAAGAEKAAALAAERAGRAA
FT                   RAEEAAAGARAARERAEAERRGVLAGKPADEVEGALREALDRARAAHERARAARADADR
FT                   AHAAAAEAARAAADARDGAAAEAARAGEALAAALAALGVGRSALEARLARGHAWAARAR
FT                   ADLEARAGGAQAAAAVRDERRRQVEAHAAGRPAGDAERARARHAEAEREAARLGDEHSQ
FT                   VTLELRRDEDARARHAEVSGALEAARAAADRWERLAKVIGSADGSRFRRYAQGLALDGL
FT                   LEAANVHLRDLARRYELMRVPGADLEIQVVDHDLGDEVRTVNGLSGGELFLVSLALALG
FT                   LASLSTRAAHARTLFIDEGFGTLDRDTLEHAMAALEGLRQTGRTVGVISHVPELHERIG
FT                   VQVTVERVSAGRSRLVVPER"
FT   gene            complement(518184..519470)
FT                   /locus_tag="Adeh_0434"
FT   CDS_pept        complement(518184..519470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0434"
FT                   /product="Exodeoxyribonuclease I subunit D"
FT                   /EC_number="3.1.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80210"
FT                   /db_xref="GOA:Q2IN32"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80210.1"
FT                   /translation="MSDRRVSSMASVALRILHTADWHLGHALHGVDRGPEHERFVAWLL
FT                   DTAEAEAVDAVIVAGDVFDAANPPAGAQALWYRFLAEAWRRLPRLQLVVVGGNHDSASR
FT                   LDAVDPLLREMGRLHVVGGVPRGGAGAPDLEKLLVPLEDAAGRRAAWVAAVPYLRAADL
FT                   GAGAADADAAEATRRFYAAALERARARRAPGEALLATGHLYAVGGKTSELSERRLAVGN
FT                   QAAVPADAFPADLAYVALGHLHLAQAVGGRETVRYSGSALPLSFGERGYRHGVVVADLD
FT                   GEAVRAQRVLRVPRFVELVSVPDGEAPAPLPEVLAALEALPARGEGPDALRPLLEVKVR
FT                   LERPEPALRALLDQALAGKEARLVRIATTLAGTGRALGDGERRALGDLVPEDVFRRKYD
FT                   ADYGGPPPDALLEAFRALLQEVESEEGAR"
FT   gene            519675..519950
FT                   /locus_tag="Adeh_0435"
FT   CDS_pept        519675..519950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80211"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80211.1"
FT                   /translation="MGARARTRSERLRRRLQAERVHLVIDYVTLADGSWAALCGMPEAM
FT                   AVGATYAEARERLCAVLGEQMGRAALEAATVVEDVPFGAEELGMAY"
FT   gene            complement(519987..520337)
FT                   /locus_tag="Adeh_0436"
FT   CDS_pept        complement(519987..520337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0436"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80212"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80212.1"
FT                   /translation="MKLPWWFPFGSVPELSAVELNDRLRGRPAPQLVDVRTPAEFSQGR
FT                   IRGAVNVPIGELRGRLATLKLDPARPVVAVCLSGHRSVPAVRLLERGGFEAAQLAGGML
FT                   AWRGARLPEVKG"
FT   gene            520480..521730
FT                   /locus_tag="Adeh_0437"
FT   CDS_pept        520480..521730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0437"
FT                   /product="Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80213"
FT                   /db_xref="GOA:Q2IN29"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80213.1"
FT                   /translation="MPLSRRPRPTLPALARASAWLGLTGFGGGLSVLGTMHDLLVERRR
FT                   WLTEREFTVTATVSQMLPGGAAANALAYTGLRFHGPAGAIAAYAAFIAPGAIVVTLLAA
FT                   LYVRLGVTPTAAPLLAGLNAAVVGIVASITLQMLRAGVQRAWQMGVAAATLLFSLGAAA
FT                   SAGEMAALGIGAGLVLDLGVKRMRLLRFQRRARRPSPPVALPDEGTPLPPPVREGEDEA
FT                   PADPAGPPRLPALALLSAPALGALGAMALLFLRAGLGAYGGGFAIIPHLQASVLAEHWI
FT                   GPRQFADAVAIGKLTPGPVLLMATFIGYLVHGIAGAAVATAAVFAGPLALVLAVGAWLA
FT                   RVRSRRPVRAALRGLTPAVVGLMAAAALALGRSLEGRVELAIAAASLLTLARFRVNPVL
FT                   VMALGGGIRLALSLAGL"
FT   gene            521811..522323
FT                   /locus_tag="Adeh_0438"
FT   CDS_pept        521811..522323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0438"
FT                   /product="NosL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80214"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80214.1"
FT                   /translation="MSPLRPLVLIATFASLATLAAPAAAGPGAPAAPAAAAAPAPGPKD
FT                   RCAVCGMLVAKFPQWVTSIRYRDGEVAFFDGVKDLLAYWHDLPRHAPGRAQGDVAAIFV
FT                   TDYYSARPIDGRGAFYVIGGDVRGPMGAELVAFAREGDAKAFLAEHRGERILRFDDATP
FT                   AVLEALR"
FT   sig_peptide     521811..521888
FT                   /locus_tag="Adeh_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.403 at
FT                   residue 26"
FT   gene            522320..522604
FT                   /locus_tag="Adeh_0439"
FT   CDS_pept        522320..522604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80215.1"
FT                   /translation="MSLRRSDRFLAALAVAAALGAAALADARARRSAARPAAEEQARLV
FT                   ARLGLTDPCLFNDARYTRHLSQADRFAPFQDHPRALEHFPSGSLTAGAR"
FT   sig_peptide     522320..522397
FT                   /locus_tag="Adeh_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            522601..523749
FT                   /locus_tag="Adeh_0440"
FT   CDS_pept        522601..523749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0440"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80216"
FT                   /db_xref="GOA:Q2IN35"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80216.1"
FT                   /translation="MTLRGALERQRSLLDFALGALGRRRGKTAALVAVHALLVFALASV
FT                   LLFTGGLREQVRAALRGAPDVVVQRMAAGRHEQVPAGWVETLGTLRGVSGARGRLWGYY
FT                   FEPVSGANLTVMVPDGGWASPGGAVAGPGVARVLGLKQGDRLPLRTYDGEALDLGVAAI
FT                   ASPAVELVASDLLLVSESDYRALFGAEPGRFTDVAVAVPNPDEVTRLAEKIVRMFPDAR
FT                   VVTRAEMIRTYDAVLDWRSGLAAAVLAGAVLAFAILAWDRASGLSAEERHELGILKALG
FT                   WDTRDVLAAKAWEGAAVSVSAFAIGALAAYAHVFLGGAVLLRPILEGWAALYPDLRPAP
FT                   PVQPLALATLLFLTVIPYVAATVVPCWRAATVDPDALMRGDA"
FT   gene            523746..524432
FT                   /locus_tag="Adeh_0441"
FT   CDS_pept        523746..524432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0441"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80217"
FT                   /db_xref="GOA:Q2IN34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80217.1"
FT                   /translation="MIQLREVTKVFDEGRPGALAAVDRVTLEVAGGAVTVLVGPSGSGK
FT                   TTLLTLLGAMARPTEGRIFLDGRELTSLPERFLAALRRRTFGFVFQQFHLVPALSALEN
FT                   VMLPALPSGEPRRDVEARARAALARLGVEGRAGVRAGRLSGGEAQRVALARALVDDPKV
FT                   IVADEPTAHLDSARARALMEIVRGLKAEGKTVVVASHDPLVYAADCVDRVVRMRDGRIV
FT                   APGAEP"
FT   gene            524429..525421
FT                   /locus_tag="Adeh_0442"
FT   CDS_pept        524429..525421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0442"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80218"
FT                   /db_xref="GOA:Q2IN33"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80218.1"
FT                   /translation="MILSPPVLALQAGAAASSGFLLYALRWAAPVVRRWDPSSGSRAQL
FT                   RLERRALLVGVLVRTALAVQLASLALFVHASDALAPMFTGAMCAAGTLSASPYGWPALA
FT                   VQLAATVLAGAWLALDRADGLAPDQPLVRVKHALLPAVAIPVVAGAALQAAHFLALRPE
FT                   IITSCCGSLFGREGRGGWAGLAWLPPRAAGALLYAVPGAAAVAALVLRRTGRGAWAVAG
FT                   LSALAGPAAAAGVIAWVSPYVYEAPGHRCPFCLLQPEQGWVGYPLHAALLAGCVAGVAV
FT                   GVLQPFRRVPSLAGPLPALQRRLAGAAALAWIALLAGAAALVAASGLRA"
FT   sig_peptide     524429..524515
FT                   /locus_tag="Adeh_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.788) with cleavage site probability 0.702 at
FT                   residue 29"
FT   gene            complement(526334..526864)
FT                   /locus_tag="Adeh_0443"
FT   CDS_pept        complement(526334..526864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0443"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80219"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80219.1"
FT                   /translation="MTQHVKAAIEGLAAAVTAEPHRARATFRATTISEGAGLATRSVVR
FT                   GFEVPLDEPRELGGTDTGPNPVEAVLAALGSCQAIVYRALAAAQGLQLERVEVVATGVL
FT                   DVRGFLGAAPVSPGFERVTFRTRLTSPEPLERLRALARQVEAQCPVLDVLQRPLDVRGE
FT                   LELVSIPAAGRAA"
FT   gene            526912..528018
FT                   /locus_tag="Adeh_0444"
FT   CDS_pept        526912..528018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0444"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80220"
FT                   /db_xref="GOA:Q2IN39"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80220.1"
FT                   /translation="MNVRYGGRGGGGPGAWRYTPAPMHLEDLGPWKHGHAFGTAVEASG
FT                   ERRTRWVVALTLAMMVGEIAAGMMFGSMALLADGWHMGTHAAALGVAAFAYAYARRHAA
FT                   DPRYSFGTGKVGALGGFASAVGLAVVALLVLGESAVRLASPVAIRFDQAIGVAVLGLLV
FT                   NLFSAFLLRDEDHGHAHGHGDHDHDHDHDDHDHGHHGHHAHHDGEHAHAHPDHGHAEHR
FT                   DHNLRAAYLHVLADALTSVLAIVALLAGRVLGWTWMDPVMGIVGALVIARWSVGLLRDT
FT                   GAVLLDAEVGEGRRTAIRAALEQGEDRVADLHLWRVGPRHLAAIVSVVSTAPRAPAEYK
FT                   ERLRAFPDVVHLTVEVHACELPGARAAR"
FT   gene            complement(528038..528577)
FT                   /locus_tag="Adeh_0445"
FT   CDS_pept        complement(528038..528577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80221"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80221.1"
FT                   /translation="MTAQEAGPRDAGPISRFLSDDHLRLHGLLARAVADPAAIDRGPYD
FT                   AFRGGLLRHIALEEKVLLPAAREAQGGEPLPLARRLRVEHGAIASLLVPTPTHALVAEI
FT                   RKILDPHNLLEEAPDGLYATCDGLLAARADELVARMAAYPAVKVAAYNDGPRVLRTAEA
FT                   ALEQSAKQAEARSGPR"
FT   gene            complement(528574..529053)
FT                   /locus_tag="Adeh_0446"
FT   CDS_pept        complement(528574..529053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80222"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80222.1"
FT                   /translation="MPTPAAEIVTRYAAGAATHPSGKPLAPDAAAAWAALGRPDAGRLG
FT                   AARVRDSARREWLLEAHRELARGRFVVLRPAHGDNEPFRASADGYRPEAYLPITEQEWL
FT                   LLALLAAGHDGDAGRDDPELAGAVFPLVDRMVRDAQHRQLMGEASDEDDDDEEAP"
FT   gene            complement(529118..529828)
FT                   /locus_tag="Adeh_0447"
FT   CDS_pept        complement(529118..529828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80223"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80223.1"
FT                   /translation="MNPKKLLAPLSLALAALLLPTGARAHCDTLDGPVVVAAKAALDSG
FT                   KLSPVLAWVQPADEAEIKAAFAKARAARKAGGDAREVADTWFLETLVRVHRAGEGAPFT
FT                   GLKPAGGDLDPAVAAMDRAIAKGDPAEVERLLQAAVHQGLEKHWTRLAAEKAPADDVNA
FT                   GRRWVAAYVPLVHWAEGVNAAATKGGAHAGHAQAGAADPHAAHAAPAADPHAAHGRAPA
FT                   KAPVKPAADAKHAH"
FT   sig_peptide     complement(529751..529828)
FT                   /locus_tag="Adeh_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(529834..530505)
FT                   /locus_tag="Adeh_0448"
FT   CDS_pept        complement(529834..530505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0448"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80224"
FT                   /db_xref="GOA:Q2IN43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80224.1"
FT                   /translation="MPRSSTPRSARKPAPDRRREIADAALRVIAAQGAAHFTSLAIARE
FT                   VGVSDAALFRHFPTKDAIAAAAIDRMEELLFEGFPPEAADPVARLGAFFRQRVAVIRAN
FT                   PAIARVFASDDVGLVGDGAGAARLEAFRRRSTAFVRGCLVEASLAGALSPAAAIEETQV
FT                   LVLGALLALAHSPGAASRPPELVERVWRTLETFMRRPDGRAPAAERRPPRAPRTRRTGE
FT                   R"
FT   gene            complement(530605..531312)
FT                   /locus_tag="Adeh_0449"
FT   CDS_pept        complement(530605..531312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80225"
FT                   /db_xref="GOA:Q2IN42"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80225.1"
FT                   /translation="MWEAVAITFRESFQRLAVNAARLVPGLLATLVFALLSLALAWACA
FT                   RLVRRILKAVQLDRLLRRWAPAEDRARLPSLVTYATRFAFWLVFAIGLALSLTSVESRW
FT                   TSALAERVLAYAPSVIVAGVLFAAAVALSRWVEASVLVSAVNMQIRSARLLATGARWLV
FT                   TVLGGAMALQHLGVGGALVTISFSILFGGIVLALALAVGLGSREVVTRSWERRLRDRDE
FT                   AHHDEEPPRIAHL"
FT   gene            531515..533686
FT                   /locus_tag="Adeh_0450"
FT   CDS_pept        531515..533686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0450"
FT                   /product="trehalose 6-phosphatase / trehalose 6-phosphate
FT                   synthase"
FT                   /EC_number="2.4.1.15"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80226"
FT                   /db_xref="GOA:Q2IN41"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80226.1"
FT                   /translation="MSRVVIVSNRLPVTVERVEDGVRVVPSVGGLATGLRRPHEQGGGP
FT                   WVGWPGDLGGLEPEQVARVEARLSDLRLVPVHLTQEEVQRYYQDYSNGLLWPVFHSFLG
FT                   EVPLEMGGAAEYERVNARFADAVAATARPGDVIWIHDYQLLRLPALLRERLPDARIGFF
FT                   LHIPFPSSDVFRVLPNREALLEGMLGADLIGFHTASYMRHFSSSVLRVLGAWTDVDRIR
FT                   WRGREVRIGVFPMGVDAADFAGTAHTAEVEEEFRGLRQDGTHLLVGIDRLDYTKGIPRR
FT                   LLAYERLLREHPELRGKVRLVQVAVPSRTEVGAYQQFREQVDGLVGRIHGAFATPTWSP
FT                   IHYLSRGLSRPQVVALYRAADVMLVTPIRDGMNLVAKEFVAVRGDGDGVLVLSEFTGAA
FT                   AELAEAVQVNPYDAEGTAAAILRALEMPEDERRTRMAGLRRRVTRYDVHWWARTFLDRL
FT                   RAPAAATPPHGLEVSARPAVEGARARLRAAPHATLLLDYDGTLVPFAPTPELARPDREL
FT                   RDLLRELARHPGYSVHLVTGRQRDTVDRWFGDLGIGLHAEHGYWSKLPGTAWQLAASVS
FT                   TAWREPARAILEEFAARTPGSLVEEKSAGFAWHYRTADPDFGAAQAHDLMLHLSTVLSN
FT                   APVEILPGALVVEVRPQGVDKGKVVARAAAASPEGSLLAAFGDDRTDEDMFAALPPGAI
FT                   SIHVGPAPSRATLRLAGVPESRAFLRGLL"
FT   gene            533905..534768
FT                   /locus_tag="Adeh_0451"
FT   CDS_pept        533905..534768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80227"
FT                   /db_xref="GOA:Q2IN49"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80227.1"
FT                   /translation="MLYPELFRSLERARWSLEDDVPWASFDPAALSDEQALTVKMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSIWFYEEQKHALVLMEYLRRFRPDLVPTEDELHA
FT                   VRFEFDPAPALETLALHFCGEIRLTQWYRRAAEWHTEPVLKHVYGLISQDEGRHGGAYL
FT                   RYMRQALERHGDAARAAFAKLGVLMASSGRSGKPLHPTNLHVNQQLFPRDTVQSRLPDP
FT                   GWLDRWLDGQIRFDVACERRVVRTMLRSLSALLGESFETVRDLNRYRKSLAGASAPPAS
FT                   SAALPA"
FT   gene            complement(534779..535744)
FT                   /locus_tag="Adeh_0452"
FT   CDS_pept        complement(534779..535744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0452"
FT                   /product="Aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80228"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80228.1"
FT                   /translation="MTSSIPQRRRLGATDLSVFPVCLGGNVFGWTADRAASVAVLDAYR
FT                   EAGGNFVDTADVYSSWVPGHRGGESEEVVGAWLRERRCRDELVIATKVGMGGPDAAAGL
FT                   SAEKILRACDGSLRRLGVERIDLYYAHRDDAATPLEETLEAFDRLVRAGKVRHLGASNY
FT                   AAPRLAAALDLSARAGWAPFAVLQPEYNLVARGGYEGALADLCAARGLGVCTYYALASG
FT                   FLTGKYGPGLPPPTARAGKVNALLADAGAMAVLAAAREVARAHGATVAQVALAWQLQSP
FT                   RVTAPIASATSAAQVRELASAVRVALTAEDVARLEGAGGR"
FT   gene            complement(535825..536499)
FT                   /locus_tag="Adeh_0453"
FT   CDS_pept        complement(535825..536499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0453"
FT                   /product="Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80229"
FT                   /db_xref="GOA:Q2IN47"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80229.1"
FT                   /translation="MPPRAARRRPARSIDPSATATSARRASPDAPGRFDAAYYRRHYRG
FT                   KDRVHSAAEIARLASGVCGLAGWLGVEVRSVLDVGAGTGLWRSWLRRHRPAVAYRSVDV
FT                   SPYACARYGHELRDISRWRARERFDLVVCHGVLHYLDDRAAARAIDNLGAMCRGLLYLE
FT                   VITRGDLETVVDLERTDTAMHRRTGAWYRRRLARHFVQVGAGLWAARRAGLPFYELEAA
FT                   RG"
FT   gene            536847..537638
FT                   /locus_tag="Adeh_0454"
FT   CDS_pept        536847..537638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80230"
FT                   /db_xref="GOA:Q2IN46"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80230.1"
FT                   /translation="MPEPTQPERRPLRGGDVAAIVLALAVAGAIAYFWFHRQRALPPPS
FT                   PAVPEQAAPEAKPPDAALPAAVQADPAQVKSLLEAASADPEYRRWLAAGGDLVRLWAVL
FT                   TDNLAEGVSPRKQLPFLVPEQPFSVAEQGGRQVIAPASYARYDRFADAVASIDPKATAA
FT                   AYRALRPAVETAYRLLGYPDAVLDRVTARALHRLEAAPRPAGPVAVVPHAEAGAGWAYA
FT                   DPVLEHLGAVEKHLLRMGPRNAGKVQAKAREIREALGLRER"
FT   gene            537820..539316
FT                   /locus_tag="Adeh_0455"
FT   CDS_pept        537820..539316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0455"
FT                   /product="ABC phosphonate transporter, ATPase subunit/LysR
FT                   type substrate-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80231"
FT                   /db_xref="GOA:Q2IN45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IN45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80231.1"
FT                   /translation="MPQRPEAARAGPVAGPDAASKPAPGPALTLRGAGRAYGPVRALRP
FT                   LTLEIRRGERVALLGPSGAGKSTLLRLLDTSLAPSEGTVEVLGQPVADTDARRLRALRA
FT                   RIGTVHQQLLLVPQATAMQNVVAGRLGRTSLARTLAALVSRREAARVRAVLDEVGIGDK
FT                   IFERVDRLSGGEQQRVAIARTLYQDPELILADEPLASVDPARAADIAALLARAFAGRTL
FT                   VVSTHRIEPLLAHVDRVVALREGALAFDKPAAALTLRDLGELYEARRGAADPARAPAAR
FT                   PPSDPVVAPGGTLRIGASSTPGEHLLPSIVRAFARAYPGTRVSLSLSDSAAVTAAVRDG
FT                   ALDLGFVGARDDDPALAYEDVARDEIVLVAAPVLELPPEPITLEVAARLPRVDREPGSG
FT                   TRAVVEQHLANMGAALDPAAVVLEAGALVALKAAVVSGMGVAFVSRRAVEDDLRGGHVR
FT                   TVRVEGLSIPRHVFAVLRRSPVPSAAARAFLEVARAEVPP"
FT   gene            539313..541043
FT                   /locus_tag="Adeh_0456"
FT   CDS_pept        539313..541043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0456"
FT                   /product="ABC phosphonate transporter, fused inner membrane
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80232"
FT                   /db_xref="GOA:Q2IN53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80232.1"
FT                   /translation="MSAAALHERPPLPLLLRWPGLLLAAVLGIAWRLSEGNLGALLAPE
FT                   ARSAVADFARGFWPPAHSPEFLRFLVRPLAETVAIAFAGMTLALVLAAPLAWLATAPGV
FT                   ARADGDAPGTLRRAAWIGARTVLNLMRSVPELVWALVFVRALGLGPAAGVAAIGIGYAG
FT                   VVGKVFAEIWESSPCAPARALAAAGAPPRRAFALAVLPGSAPLLASYALYRLDCALRAS
FT                   AVLGLVGAGGMGVQLELSLKMFAYDEVATLVLALFAVVAAVDLLSAWARRRLAESRGLF
FT                   PAGPGALRWRAAILGTWLALAAGAAAYLELPLGELFSGGTLRSAAGFFGSMFPPDVSPG
FT                   FLRALVPAAAETLAVSILGSAIASVLGLGLALAAVHPGARGLAGAPGESRLRSGARLAL
FT                   TAGARGAMNLLRTLPELLWALLVIFAVGLGPFAGALALGIHNAGVLGRLYAEALEEVPP
FT                   GPVAALRSAGGRPLAATLLGALPQAWPQLVAYTLYRWEVAVRASAVLGVVGAGGIGALL
FT                   HVSLNLFQHHRTLTLVAAIVLLVTAVDLFSGWLRARILAGPASRAAPRAACAPGLANAT
FT                   "
FT   gene            541082..541933
FT                   /locus_tag="Adeh_0457"
FT   CDS_pept        541082..541933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0457"
FT                   /product="ABC phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80233"
FT                   /db_xref="GOA:Q2IN52"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80233.1"
FT                   /translation="MHRLAALAVAAVLLLPPAARALDALRVSAIPDESPTELQRKFEPL
FT                   GKYLGKQIGIPVKFVPVTDYAATVEGLAAGKLDMVWYGGFTFVQARRRTGNAIPLVQRA
FT                   EDARFHSKFIVPASSKAQSLKDLKGASFAFGSVSSTSGHLMPRYFLLQAGIDPDKDFAK
FT                   VAYSGAHDVTAKWVEAGKVDAGVVNESIWQRLVDEKKIDTSKVRVLWTTPEYQDYNWTV
FT                   RGDLDPKLVEKLRAAFLALDPAKPEDKAILDLQRASRFIPTSPDAYKNIEQAAKSAGLI
FT                   KD"
FT   sig_peptide     541082..541147
FT                   /locus_tag="Adeh_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(541973..542617)
FT                   /locus_tag="Adeh_0458"
FT   CDS_pept        complement(541973..542617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80234"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80234.1"
FT                   /translation="MACYADSGTVSRQGRSHPSPLVTNNSSAGERQTMRFDLDVQWCPA
FT                   GLAPGASPRGARFQVTAPSDAHVSEFLASLVVAVATSQPIACVAENAFVRTTGVARRLA
FT                   SHAIAVAGDGFVVAEGSVSALAMLLDTWQAEAVWMAFGGEERIDVLEAAVRGPRWWALD
FT                   RAHGPLDTAGAQLGCVMRVALSHASLEAFADVHTVLRFLDYARGRIEVPAR"
FT   gene            542815..543483
FT                   /locus_tag="Adeh_0459"
FT   CDS_pept        542815..543483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0459"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80235"
FT                   /db_xref="GOA:Q2IN50"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80235.1"
FT                   /translation="MARVPRFALVERDSSNHCTWRAHDLEFVFEEPGARDKFLELVGRY
FT                   KDRYGVEIRSYCLMGTHPHVTCTCRQEQVQFSRFWQVVNGQFARWYNKVRNRRGQVVME
FT                   RMRTPRIQEGGAHQLTVMRYGDLNPVRAGLVKSPKDWKWSSYRHYAFGEPNPLITDAPE
FT                   YLALGKTAQERRKAYQALFALPLSESLRTRRVELVSFPFVGDATWVMRRLEAAGLSPPD
FT                   "
FT   gene            complement(543645..544220)
FT                   /locus_tag="Adeh_0460"
FT   CDS_pept        complement(543645..544220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80236"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80236.1"
FT                   /translation="MVPLENTATVLLADYRNAPVRYILDTAAGLVTEARAVDPAAAEAG
FT                   ALQRGVVGFGAWQKLHFRQRRRVFMAVYSTGEQLVLRIGTFEVRWPDPELRVRRSAVFA
FT                   HVKRFRVYRADQLILSFLYPFLDWDAFPDNGDILTYAESMTRTPNVTMRTILRFKVIST
FT                   GIDPMSERYVEEVAAALHEADRRTGKEP"
FT   gene            complement(544371..544865)
FT                   /locus_tag="Adeh_0461"
FT   CDS_pept        complement(544371..544865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80237"
FT                   /db_xref="GOA:Q2IN57"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80237.1"
FT                   /translation="MRRGEDGLQYIVPTLLIGASYSHLPCASPCRSRSGRGRCTRRMMP
FT                   PPRRRCRRSTKGRDMPNEVTLVQEAGKLVLLGGVVAAIGVAAFRSSVRAFRDPVGTTEA
FT                   RRRNLEARGVPRYTVWVPRDARNWAGMVRWSAAWGAVFGAVLALAGFTGFAVGLYLELM
FT                   R"
FT   gene            544919..545518
FT                   /locus_tag="Adeh_0462"
FT   CDS_pept        544919..545518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80238"
FT                   /db_xref="GOA:Q2IN56"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80238.1"
FT                   /translation="MTVALTAAGFGALHAVSGPDHLLSVAPLSVGRRRQAWRIGLVWGL
FT                   GHAAGTAVAAAVLLALLSGAGLHVVDAWAERAAGLALVAMGAANLLALRRRRGMAAAGA
FT                   RDVRPAVFSVGLVHGVTGAAALLLVVPAVNAGASVKVLAILGFVAGSTAAMAALTAAIA
FT                   ALSAAAAPRLALATWRLPALASVVSVAVGIGWAIAA"
FT   gene            545938..547662
FT                   /locus_tag="Adeh_0463"
FT   CDS_pept        545938..547662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0463"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80239"
FT                   /db_xref="GOA:Q2IN55"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80239.1"
FT                   /translation="MTTKAIKPTLTNPLDPPEKVEFNIPGEIARATGGYEEAMQEGWEL
FT                   IQRPIRSVPVDQIEKQHIKKRMTVWERIRVLSDKEPMVLYQNWGKNLDGASLVTAILNI
FT                   GGRDVAVYGHDFTVRAGSMDATNGSKLARLFRMAGEKGIPLIGMNDSAGAYVPAGVGGL
FT                   DGYAEAFTALRRISGVVPSIMCMFGFNAGGGSYLPRQGSFVIQPADTFFGLTGPGVVKS
FT                   VLGEEISPEDLGGPKVHGASGVADLTVIDELAALRQAVRLLNYVPDNNRTMAPFQQTSD
FT                   PLDRKTWEINTLLKKAFNSPTGFNTPFDVSIIIQQVCDYGDFFEIQPDRAREVVTAFGR
FT                   LGGHVVGFVANNSAIGSGQIDCDTALKIARFVRFCNIYNIPIIFMEDTTGFLPGREQEA
FT                   RGIVQAGRSMLDAIVDVRTPRILLILRNAFGGAYASYNNYPTGADVVLALPTTRLAVMG
FT                   PAGKEFVYKDELRKMRGAAAERAKKGAQQRVAAGMEGEAARKDAEKEAAEWLKGEEAAL
FT                   GRRYEKELMNPKEGLALGSISSLVMPTDLRKVLGQNLHFLLRHYTPSPMSGPQREFH"
FT   gene            547702..550680
FT                   /locus_tag="Adeh_0464"
FT   CDS_pept        547702..550680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0464"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80240"
FT                   /db_xref="GOA:Q2IN54"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80240.1"
FT                   /translation="MASNVDHYRNNPLIHRDRRLGSSPSAWVSSFACEDLKPLIVCRGP
FT                   IRKEAMDVFAEMGMTHVGILLSEKDSIVYANALAPELRQIADHARVHRVPDYTGATKEE
FT                   RVERMNQIVQIALDNGYDAVFAGYGFMAEDEEFVATIERAGLKFIGPNSTTQARAGKKD
FT                   EAKRTALEVKVSVTPGVNDVAARTLLAKHGTRKQLLALVEAEGLACDAKVLADAKVELP
FT                   ALAEHVLQASYAKGIDLFTIDELGAQVQVEVAEMFRKYPRSRVRLKAIGGGGGKGQRIL
FT                   GASLLTAKDPDEKAVAAAAAEAPAMVREVLAEVKATGVGDNKNVLIELNIEQTRHNEIQ
FT                   LLGNGEWCVSLGGRDCSLQMHEQKLLEVSVTQEALAATIERAKKNGKPVRAKALEVDLE
FT                   ILKRMEDDAARFGQAVGLDSASTFECIVDRDRYYFMEVNTRIQVEHRVSELCYSLEFAN
FT                   PDDPSDTFVVESLVEAMALLARHKQRLPKPRRIPRFGAAVEARLNATDASLSPHAGGVI
FT                   RYWSKPIEGEIRDDQGISMPNPDTRMFMRYKVAGAYDSNIALLLTKGDRRLESYKHLAR
FT                   VLARMELRGTTLATNMEFHYGLVNWFLGQSVNAKPTTRFVVPYLTLVGMLKDEANKLDT
FT                   AYAFGEMKKHYAKLMATENPGDAAAQKAMVEVLDRKVTLLTRVIDRFLDDPHLFAGWLS
FT                   MNRRHYRIENGKLLWIRNPLGVLNDAYAYLNMAFHPRRPAAQVMWEHDHELLTKSLRFY
FT                   VALRERFGLKREEYYKLNEILQKEEPQDGFDAETWTKIRSAHLGYEAGNELLGLLFMVA
FT                   ESVRFFDFKVEDDLEVTIPEHLHDPELQARMKKVLCPPPATKADELVAPFGGMFYRQEA
FT                   PGRPPFVEEGQHFDKGQPLYIIEVMKMFNTVRAPFSGTIEKVLMQGADGTVVQKGQPLF
FT                   KITPDEKFVPVDPKAVERERRTRTQKHLEGVLMTFAEKFTTVEPVRFEEPEEEVAWAGV
FT                   EAV"
FT   gene            complement(550755..551216)
FT                   /locus_tag="Adeh_0465"
FT   CDS_pept        complement(550755..551216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80241"
FT                   /db_xref="GOA:Q2IN63"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80241.1"
FT                   /translation="MADREEIHGTAPAYWALRIALGVVPIVAGLDKFTNLLADWAGYLS
FT                   PLAVRLLPVSPAAFMRAAGVIEVIVGIGILAGRARTFGWIAMAWLAAIALNLVASGAFL
FT                   DVAARDAVMAVAAFALARLAAVHEPHRARRPAGAVEPQPTAAHAAPTRT"
FT   gene            551316..552005
FT                   /locus_tag="Adeh_0466"
FT   CDS_pept        551316..552005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0466"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80242"
FT                   /db_xref="GOA:Q2IN62"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80242.1"
FT                   /translation="MTVQASSVRGVPARAPSDSDVVARVLEGDVALFEVLMRRHNPRLY
FT                   RAIRSVLRNEAEVEDAMQQAYLQAYAHLGDFQGHAAFSTWLVRIGVNEALMRLRGRERL
FT                   VPLLDEREDGGIGREEERVADPSPEDAAAAREARVLLEQAVDRLPLHLRTVYVLREIEQ
FT                   LSTAEVAAALDLGEEAVKVRLHRARLALRGLIAERVGQGAPEAFGFLAPRCDRVVAAVL
FT                   AAIAARS"
FT   gene            complement(552071..552571)
FT                   /locus_tag="Adeh_0467"
FT   CDS_pept        complement(552071..552571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0467"
FT                   /product="Blue (type 1) copper domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80243"
FT                   /db_xref="GOA:Q2IN61"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80243.1"
FT                   /translation="MGHGRIWWMGAAAAIAGAACGGSDNGGDSGASTRPTAAGYYIEIS
FT                   GMKFSPLDLKVPAGATVTVINDDSMAHSVTSEATPGAYTPGGVDGVTFDTHAFNGVRTF
FT                   TIPAAAAQGTVIPYYCSTHLGGMVTPNGSITIDPAAQPGPPPPPPGGGGGGGGGGGGGG
FT                   GGY"
FT   sig_peptide     complement(552506..552571)
FT                   /locus_tag="Adeh_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.879) with cleavage site probability 0.425 at
FT                   residue 22"
FT   gene            complement(552707..555376)
FT                   /locus_tag="Adeh_0468"
FT   CDS_pept        complement(552707..555376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0468"
FT                   /product="Cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80244"
FT                   /db_xref="GOA:Q2IN60"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80244.1"
FT                   /translation="MANVPEWHALPAADALARLGSGPAGLDPAEAARRLAEHGPNELAR
FT                   ARRAPALALLAAQLENVLAVILMVAIALSLSLGHDLEAATIGAILVFTVVLGFVQEHRA
FT                   ENALAALRRMAAPLATVIRGGAERKVPAREVVAGDLLVVHAGDRIPADARVVEAVNLQA
FT                   DEAALTGESVPVTKTSGPLPAGPVAIGDRTDMLFGGTAATYGRGRAVVVATGAGTELGA
FT                   IARMLAEVKPARTPLQVELDRVGKQLARAAVVVVVLLAGLGLLRGQPFLEMVVFAIALA
FT                   VAVVPEALPAVVTIALALGVQRLARRNALVRRLAAAETLGSTTVICSDKTGTLTRDEMT
FT                   VRALHVDGRTLEVTGSGFRVEGGFRCDGAPVDSPPALLALLGGAVLASDASVERTPSGD
FT                   LTVSGDPTEAALVVAALKAGLDRAELDARAPRVGEIPFTSESKRMTTLHRTARGPVAFA
FT                   KGAPEVIVPACSRVASGDGERPLDEAGRAALLEVVRGMAERALRVLAVARGSGASLAEA
FT                   DRDLTLLGLVAMIDPPRPEAGAALERCAAAGIRVVMITGDHPVTARAIAAELGLLRTGT
FT                   VVTGAELARLGDAELAARVEDIEVYARVSPADKLRIVTALQARGEVVAMTGDGVNDAPA
FT                   LKKADIGVAMGITGTDVTREAAAMTLTDDNFASIVGAVEEGRGIFANVKKYLMYLLSSN
FT                   VGEIGLMAAATLLGLPLPLTAVQILYVNLATDGLPALALAVDPPERDLMRLPPRDPRQG
FT                   IFTRPVVALIATGGAWSTLVNLGLFAWARASGRSDAEAMTMCFMSLVLVQFAKAFAFRS
FT                   ERHSVLRRPFANRWLDLAVAWELALLLLVVYLPPLRAAFGTYALPAADWLLVTGAALTV
FT                   LPVLELAKLAVRRAAPSA"
FT   gene            555489..556682
FT                   /locus_tag="Adeh_0469"
FT   CDS_pept        555489..556682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80245"
FT                   /db_xref="GOA:Q2IN59"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80245.1"
FT                   /translation="MSAPASAPVLLGYGTRPLPFPAGVPARVLAAPPAPAVADLPAALD
FT                   AALAHPEGARPLPEVAGPRTRVLVIVSDASRDEPRAELFAAVRRALAVVPDDHLTLAVA
FT                   NGTHGPGPLEALGLPDDVLRRHRVVNHDARDEASMVEMGRTSRGTRLRVNRCVAESDLV
FT                   VTTGRVKPHYFAGWGGGAKGIFPGLGHDDDIRQNHKLKADPASSLGRADGNPCREDLEE
FT                   AVRRLGRDTYMLNVVEAGGVVMGAVAGDVLYAHRAGVRMARPWCEVAAEPADVVVVSAP
FT                   LPVSGSLYQASKLVPPAGMLLREGGVVVVCAECPGGVGPLRTVNEGIFQLGVRRFLPER
FT                   YTLLLVSGMPEATVRETYAAFAPSLEAALASAREIVGKPEPDVLVLPDAGDLVPRRR"
FT   gene            556717..558015
FT                   /locus_tag="Adeh_0470"
FT   CDS_pept        556717..558015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0470"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80246"
FT                   /db_xref="GOA:Q2IN67"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80246.1"
FT                   /translation="MTDEPIPQGGKLSSFRQVPRTGVIYATSEATKLGFSMQDPDWCNL
FT                   GQGQPETGPLPGAPDRVHAVAVSVDDQEYAPVAGLWELREEVAGLYNRLYRRGLPSQYK
FT                   AENVSISGGGRTSLTRAAASLGRVNMGHFLPDYTAYEELLDLFRTFTPIPILLEGERGY
FT                   AFTVDDLRREVTGRGLSALLLSNPCNPTGKLVQGEELARWVELARELECAMLMDEFYSH
FT                   YVWTAPPGRLPVESAARYVEDVDRDPIVLFDGLTKNWRYPGWRVTWTVGPRKVIDAVAS
FT                   AGSFLDGGGSKPLQRAAIPLLAEEAVRQETEAIHRTFGEKRRHMLDALETMGVRIDRAP
FT                   DGTFYCWGNLANLPAPLNDGMGFFREALRRKVIVVPGEFFDVNPGKRRARHVARFRSYV
FT                   RFSFGPSLETLEKAFERLAAMIQERSSATASVG"
FT   gene            complement(558088..558933)
FT                   /locus_tag="Adeh_0471"
FT   CDS_pept        complement(558088..558933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0471"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80247"
FT                   /db_xref="GOA:Q2IN66"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80247.1"
FT                   /translation="MCTTCGCGDPELVPVELHEKILAGNDRAARHNREHFLEAGVLALN
FT                   IMGSPGAGKTGVLEATAKAAASKGWRLGAVSADLATDNDARRLEKAGIPSKAITTGQAC
FT                   HLDAELVHRSLHDFPWRDTDVFFIENVGNLVCPAIYDLGQAANVVVLSVTEGEDKPLKY
FT                   PVMFKAADLVLVSKVDLVPHLDVDLPKLRDAIAHVMPTAKVIELSARTGEGMDRWIAWL
FT                   EELRRPIVKPAQPRTHAHGHDHGHEHTHADGTTHAHAHDAGDHAHGHAHGHGHDHGHRH
FT                   "
FT   gene            complement(558933..559277)
FT                   /locus_tag="Adeh_0472"
FT   CDS_pept        complement(558933..559277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0472"
FT                   /product="Hydrogenase expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80248"
FT                   /db_xref="GOA:Q2IN65"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80248.1"
FT                   /translation="MHEYSLVEALVRRVEQEARRRQALAIRGLTVSVGELSGVDPELFR
FT                   TAYETFRAGSLCAETPLTLKRLEARWSCPACRAPIARGAVLRCPTCDVPARLDEGSDAL
FT                   TLDSIDMEVP"
FT   gene            complement(559291..560316)
FT                   /locus_tag="Adeh_0473"
FT   CDS_pept        complement(559291..560316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0473"
FT                   /product="Hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80249"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80249.1"
FT                   /translation="MDSKVQQKIGLKHGSGGRAMRQLIEDVFLSLASPVDGIGLSALDD
FT                   GAAIRVGDRWLVITTDSHVVHPIFFPGGDIGRISVSGTVNDLAMMGATEPVGLTCAVII
FT                   EEGFPRADLERVVASMRETAKEAGAPFVTGDTKVMGKGQVDGLVLNTTGVALADRVVSD
FT                   AGLRAGDLLVVTGSIGDHGMAVMARRHDLRLEGDLRSDVAPINGLVRAALAAGGEDVVA
FT                   MKDPTRGGVAGVLHEMAAKGGVGIVVDEPSLPINDEVRAAGEMIGIDPLLVANEGKAVI
FT                   GVRARSADKVLAALRAHPLGARATVFARAIAERPGAVILDTGFGKRMLAEPEGELLPRI
FT                   C"
FT   gene            complement(560333..561469)
FT                   /locus_tag="Adeh_0474"
FT   CDS_pept        complement(560333..561469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0474"
FT                   /product="Hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80250"
FT                   /db_xref="GOA:Q2IN68"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80250.1"
FT                   /translation="MSNDDLFRQLKFRDPARARALAEALRHNMDAIGREVSVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALAMQGVRVCTYGDMLRLPG
FT                   TARSLADAQADGGKVEVVYSISQAVELAQAHPEEQVVFLASGFETTAVATAAVALASPP
FT                   PNFSILSVHKYVPAAMEIVAASKETHIEGYVAAGHAAIITGWAIFEPFAARTGAPVVVA
FT                   GFEPLDILAALVKLTELIREGRPEVANVYPRCVTKEGNLPAQRSLWRAFRTVTGRWRGI
FT                   ADVPGGNLELVPELAALDARKRFRIDTAGVRDAAAEEEAKGCICGRIMLGLATPEHCAL
FT                   FGTTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVG"
FT   gene            complement(561481..561768)
FT                   /locus_tag="Adeh_0475"
FT   CDS_pept        complement(561481..561768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0475"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80251"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80251.1"
FT                   /translation="MCLGVPGKVIAIDGLDATVDFFGVRKSLRLDIVDEPVQVGDYVLN
FT                   HVGFAIRRIPPEEVQETLALFDQILEVSGAKEDLMAADVRGEMAAGKDQK"
FT   gene            complement(561796..564117)
FT                   /locus_tag="Adeh_0476"
FT   CDS_pept        complement(561796..564117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0476"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80252"
FT                   /db_xref="GOA:Q2IN71"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80252.1"
FT                   /translation="MTTQRTTDGGPDRAGEGRRIAVSGTVQGVGFRPFVYRLAHQTGVT
FT                   GRVRNDAAGVTIEAFGPRAALDAFQARLVSDRPPASSIAALRAEPIPAEPAARFEIVES
FT                   GGAAERRVAIPPDLATCPECLRELSDPADRRHRYPFTNCTACGPRFTIALGVPYDRPAT
FT                   TMAGFRMCPACAREYGDPLDRRFHAQPNACPACGPKVSLRDAAGAPLPSADPIRDCAAA
FT                   LRSGGIAAVKGLGGYHLACDASAPAAVRTLRERKRREEKPLAVMVADLDAARALAELSP
FT                   EEAALLAAPERPIVLCRRRPDAALAPELAPGSPIVGLMLAYAPLHHLLLADAGVPLVMT
FT                   SANLSDEPIAFEDEEALARLGGIADLYLVHDRPIASRCDDSVARVVAGRPMVMRRSRGF
FT                   VPRPVRTARRFARPVLAAGAQLKNACCLARGEEATLGPHVGDLDGLETYEAFEAAVARL
FT                   EAFLAFRPELLACDLHPLYLSTRWARERAGALSLPLVEVQHHHAHAAACMAEHGLEGPV
FT                   LALCWDGTGLGADGASWGGELLLAEAARFERLATFRPVALAGGDRAIRDPWRIALAALL
FT                   DAFGDDAPLDRLPLFAGVPARELEVVRRMLAAGLNAPPAHGAGRAFDAAGALALCRPSA
FT                   RFEGQVALALDAAAHGHEAPPYPFDLDASGPVEALDLRPLWRALAADVLAARPAGELSA
FT                   RFHAALAAAGAEQVRRAARRTGRLPVVLTGGCFQNARLAEAIRARLDGEFAVYQHGEVP
FT                   PGDGGIALGQAVVADAVARA"
FT   gene            complement(564262..564789)
FT                   /locus_tag="Adeh_0477"
FT   CDS_pept        complement(564262..564789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0477"
FT                   /product="peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80253"
FT                   /db_xref="GOA:Q2IN70"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80253.1"
FT                   /translation="MARIAVFGIGNVLTGDDAVGPYVVKVLEARWELPGVEVVDAGTPG
FT                   LDLTAYFAGLDAAILVDAVKARAAPGELRTYSREDLVKRSPVLAVSPHEPGLREAVMNA
FT                   EFMGVCPATVRLVGVVAERTDLGCALSPSVQAAVPAAVEQVLSELRALGVAPRPRDPPV
FT                   EPDLWWEKGRAG"
FT   gene            complement(564883..566616)
FT                   /locus_tag="Adeh_0478"
FT   CDS_pept        complement(564883..566616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0478"
FT                   /product="Nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80254"
FT                   /db_xref="GOA:Q2IN69"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80254.1"
FT                   /translation="MSKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWIFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNLIVTAHTLHDH
FT                   IVHFYQLSALDWVDVTSALKADPVKAAQLAESISSWPGNSKHELAAVKARLEGFVKAGQ
FT                   MGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALEIQRKANMAVAILGSKTPNIQNLAVGG
FT                   VANAINLDSPAALNMEKLYQVKTLIDEVATFVQQCYLPDVAAIGGFYPDWFKYGAGVTN
FT                   YLSVPELPLDEKMSKFDIPGGVLWNGKLELAHKLAGWNDDYLKQNVTESIAHAHYDGAW
FT                   AKGPWEEDDKPKFAGEWKHETPAPDRYTWVKAPRLEGKPVQVGPLACVLVGLASGHEPT
FT                   TRWATAAIGAVKAIHKIDLTPAHLHSTLGRHAARAIRAAMMAEMAQKQWKLLVENIGKG
FT                   DTRIWVDPMANLKPGIYKGVGFHEAPRGTLSHWCVIEADKKGMKLKNYQCVVPSTWNAG
FT                   PRDASGTLGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGDEIARVKV
FT                   L"
FT   gene            complement(566628..567875)
FT                   /locus_tag="Adeh_0479"
FT   CDS_pept        complement(566628..567875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0479"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80255"
FT                   /db_xref="GOA:Q2IN75"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80255.1"
FT                   /translation="MSGHDHPQAIGGKMLDPLMKILLAVFGVSALVMAYRFVTGIGSVS
FT                   NMTDGFTWGIWEPINVVVFTGIGAGAYGVGLLCYLLNKGQYHGLVRPAVLLGAIAYTLG
FT                   GSSIMIALGRYWNAVTLPIVPWWNLSSALLEVAVCVMMYVMVLWIEVLPAIFDGAAQSK
FT                   SPRWSAIGKRWGARMAKAMPYIIALAILLPTMHQSSLGGLYLIAGPKLHPLWHTALLPT
FT                   LFLVSCLSMGYGAVVVLVNILRLNWNAKQDQALFASMSKVNAGFLLLYVVLRLGDIVLH
FT                   GKLRFLGADFATFLFVVEMALFIAPAVMFVMPGVQRNRGKLFGAALLAILAGAVYRADT
FT                   YMTMYRPAGWTADGKSIAAGWDYFPSVGETIVTVGMAAVGMAIFVFISRLFPVVVVDQG
FT                   KKSTIGRGEVRAASGH"
FT   gene            complement(567872..568825)
FT                   /locus_tag="Adeh_0480"
FT   CDS_pept        complement(567872..568825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0480"
FT                   /product="Fe-S-cluster-containing hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80256"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80256.1"
FT                   /translation="MTISRRDLLKGAVAAGAAVAIPATAEARHEIEPLPDAVGMLFDST
FT                   LCVGCRACQSACKVANKLPEDKVEANGGVYDAPNDLNSTTKNVIKAFPAGDTQHYMKQQ
FT                   CMHCVDPSCVSVCMLGALHKEGEGKRDFKGEKKGTGIVLWDKWTCVGCRYCQIGCAFNV
FT                   PKFEWFEAFPAIVKCELCRHRRDEQKSGPLAVANPACCEVCPREAVVFGYRKDLLAEAK
FT                   RRVAADPQRYNPHVYGEHDGGGTQVLYLAAAGVQFHDLGLPDLPERSQAEFSESVSHAP
FT                   YLYGVTPIALYAAMAFVINRNKKKEEAAEHGEEGKR"
FT   sig_peptide     complement(568748..568825)
FT                   /locus_tag="Adeh_0480"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.871 at
FT                   residue 26"
FT   gene            complement(568831..569955)
FT                   /locus_tag="Adeh_0481"
FT   CDS_pept        complement(568831..569955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0481"
FT                   /product="hydrogenase (NiFe) small subunit (hydA)"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80257"
FT                   /db_xref="GOA:Q2IN73"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80257.1"
FT                   /translation="MDNIGSQMISGPETKGVSRRDFIKVCSVAAAAVGLPAWAGEKMAE
FT                   NVGKKKPSVVWLHFQECTGCTESLLRTSHPDVGALILDLVSVDYHETLFAAAGKQIEEA
FT                   LESAKKAGGYVLVVEGAIPKKDDGIYCMVGGKTAVDSLVECAEKAAAVICIGSCSSWGG
FT                   VPSAAPNPTQAVGAPEILREKGIKKPVVTLPGCPANPYNLLGTVLQFATFGTLPKLDEK
FT                   GRPAFAYGRVIHEDCPRRPHFDAGRFAQAYGDEGHRNGWCLYKIGCKGPQTHANCSLLS
FT                   FCEVPGAWPIGIGHPCVGCTEQGIVFNVPINQNLPIEHPTAPMAYPAIHPEHGVVGGSP
FT                   VAVGLGGAVIGALVGAGVVASRKMAAADDADGKE"
FT   sig_peptide     complement(569836..569955)
FT                   /locus_tag="Adeh_0481"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.601) with cleavage site probability 0.601 at
FT                   residue 40"
FT   gene            complement(570417..570905)
FT                   /locus_tag="Adeh_0482"
FT   CDS_pept        complement(570417..570905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0482"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80258"
FT                   /db_xref="GOA:Q2IN79"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80258.1"
FT                   /translation="MPLPDPSIGLLVLAARQGIREVVGPRASRLRLTVQQYWALYWLLH
FT                   EPGLAPGALASAMLLDPPAGSRLVSELVKRKLVEARPDREDRRRARLFLSAKGEPLARR
FT                   VAEDAARYHAESLRGMEPAEVEALRSGLRRLIENLAALGVAPADAGAGRRTGRAARAG"
FT   gene            571036..572733
FT                   /locus_tag="Adeh_0483"
FT   CDS_pept        571036..572733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0483"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80259"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80259.1"
FT                   /translation="MNASCFPYASLLASIAVLTAAAPGPARAAEAAPPGVASLRRAEAR
FT                   FAPVDLKVDLSKLPASERTALARLVEAGRIMDALFLRQVWAGNEALLLRLVEDRSPLGE
FT                   ARLRLFLRNKGPWDRLEEDRAFLPGIPEKPQQASFYPAGATKDEVERWAAGLAPEEKDR
FT                   AMGFFTTVRRDAAGKLVAVPYSLEYQGELARAAALLREAAAATQDAGLRTFLEARAAAF
FT                   VGNAYRDSDVAWMRLDSAVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDDAETAKVARFA
FT                   AELQGIEDALPIDAAFKNPKIGALAPIRVINEVYAGGDAAKGVQTAAYNLPNDEWVTRT
FT                   MGSKRVMLKNVQEAKFQKVLQPVARRLLSPADRAHVAFDPFFTHILMHELVHGLGPHHA
FT                   TVNGQEVTVRAALAETYSALEEAKADVAGLFALEKLLDDGKLDRRMRDTLYPTFLCGAF
FT                   RSIRFGLNEAHGKGMAIQINWLLDHGAIVARKDGTFAVDGAKMRDAVAGLTREIMTIQA
FT                   KGDRAAAKAMLEKLGVVRPEVARALARIEDLPVDIAPRFVTADALTAR"
FT   sig_peptide     571036..571122
FT                   /locus_tag="Adeh_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(572788..574896)
FT                   /locus_tag="Adeh_0484"
FT   CDS_pept        complement(572788..574896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0484"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80260"
FT                   /db_xref="GOA:Q2IN77"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80260.1"
FT                   /translation="MSLNWKLARLVAALTLLPAPGAAEEPAAEPRTEVLLEEIVVKSRR
FT                   EPRADGLEVREVRETPARDLGEALEQALGVGKVRKAGIASDVVLRGLKRDDVNVLVDGT
FT                   RTHGACPSRMDPPAFHLDWAEVDGVEVRRGPFDVSQPGGLGGVVDVRTRGARPGPGAEV
FT                   NVGAGSFGAAESSAVASYGGGRASLLLGGAFKRSDPYLAGDGRNITEIIPATSTGRYRD
FT                   TSDHQTAYDVRSGWAKVGLVPAEGQQLELAYTRQEADDVLYPYLLMDGIRDDTDRVNAT
FT                   WRAGAIGPLASARAQLYWTRVAHDMDDRDRCSSAADPAACAGGLAEAWSMRTEARTRTL
FT                   GAKLEASLGGGDAALDARLGADLVVRNWDNETIRVRRAMPGQPYVGEASIPDVTQTTGG
FT                   VYAELRRALAPSLRATAGARLDVAESYAGVDRRDFYATWRPGSSPERSRTDLLLAGNVQ
FT                   LDWEAARGLTLFAGYGHGTRLPDPQERYMALAGLMGKPAWVGDPSLRPTRSDELDAGLR
FT                   FTADRLLAKAQVFHAWLADEITLVPLALPGGATAKTYAGVSARRVGGEASARLALPLRL
FT                   YAGAAVAYVWARNETAGTPLAEIPPLRASASLRWDDGRFFAEAEEQWAARQDRVDPALG
FT                   ERPTAAWFITNLRAGAEWRGLKAFVGVRNLLDKTYAEHLSYLRDPFAAGVKVPEPGRTL
FT                   YANVQYAF"
FT   sig_peptide     complement(574825..574896)
FT                   /locus_tag="Adeh_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.912 at
FT                   residue 24"
FT   gene            complement(575001..575492)
FT                   /locus_tag="Adeh_0485"
FT   CDS_pept        complement(575001..575492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80261.1"
FT                   /translation="MLAAAAGRPAARVAAALLALALSGGVRLLPARPVSGPHRCSCRAH
FT                   GEDHLCACAICNAQARRARKAARPEDLPPCHRDAARRAAAQEEERARRAALPGLLPTCG
FT                   DPEGGLAAPGALDPFSVPARPALALAEWRTPCPTPAAVAPERAPRPAVPPPRPPAARAL
FT                   "
FT   gene            complement(575598..579899)
FT                   /locus_tag="Adeh_0486"
FT   CDS_pept        complement(575598..579899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80262"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80262.1"
FT                   /translation="MTLRLLPALAAASLSLLAARAGAAGAPWEGAPFSADPKAMLAAAQ
FT                   ALAPPRAAGVDVLLEEGRFRYDARGALTLEHRLVFRLLTAEAARSWSRVERSYAPWQQA
FT                   RPELRARVITAQGEVHELDPATLTEQGVADRADLMYSDRRVVAGPLPAVRVGSLVEELI
FT                   VVRDTAPSFDGGTSARFFLAQALPARRIRVEVAAPAELPLRWVVRGTDAAPKETKERGE
FT                   RRLVIDRRDVPGWTAVEPGAPRDTPPAPYLAFGWGRSWADVSARYAASWERQLAGSGLA
FT                   AAAREALGEGQAPDRAEAVRRVVAWVHRNVRYTGLELGEAALVPAAPDEVLKRRYGDCK
FT                   DLSLLVAGMLRAAGHDARLALVRTDWHEVNPELPGISQFDHVVVRVEGSPAIWVDATDP
FT                   YTPPGVLPPAVEGRLALVTPGGRELVRTPERGAADNRVRIVRELFMAESGRGRIRETRE
FT                   LVGALAATERAFRERIPPERRDEVAEHYAKEVLRAAEVLSASTEGLDDPSAPLRLVVDA
FT                   KETDAVRTADDEAELPVTPDQVFDALPGFLTGDPEGHGAAPPAKRTADLLLVVPYQWEV
FT                   TYRIHVPDGFEPRPLPASTTERFGPATYAQTYARAPDGTVTATFRFDTGGRRLSAADAA
FT                   ALGKRAREVVRGSSPVVALDRTAAALLAAGKVPEALGEMRRLAALHPKEALHHVQLAAA
FT                   LVRLGFSEQAATEVRQAIALEPDSAWAHRILGWILQHDAVGRYQGPGHDRAGALAAYRK
FT                   AKDLDPDHAGGRAALAELLAREANGAPAATIGEAVEEFEAIRADLHEQAFDGPYLRTLF
FT                   DAGRDAGAEKLARDMPRGRERDGLLLAAVAMQRGAPAAEEESRGMGDGRRDALRDAARL
FT                   MVGRRSYAAAAALASAAAQGAPNAAEIRQQADLFQGLKPWETLAPQGTEAARLVKRLFV
FT                   AAIRSPAPARELPGMVARDRLGPELVRIADQGLGGPIAGARRTLHEQGIPPDVLLDLVL
FT                   SRVEMLEDGDPRAAVRVRVQFPFTPGDGRSAVFVVREGKEPKVLATDTAWPILGAEALR
FT                   LAGAGDLAGARRWLDWARETLPGAESDPSTPAGVLARLWRPGAEAGAPEVRRAAAAVLA
FT                   WADEAGRSIPTLSEARARATDPAERRALGFALAQAYRAAGKREDQLRVARELLQDDPAS
FT                   REAFALGAVALADLKRPAELEALAAGVLQRLPDDPEVLGLLGNLRLGAGNVDEAAKAFR
FT                   RLIDGGKASPLVLNNAAWLELFRATPGKDALDWARRAVEGERGQNHPSLNTLAAIYAAS
FT                   GQPAEAREVFLRSLDVSGDALEPADWFVFGRIAEAWGVPEAARAAYARVAPDPLDPTAP
FT                   HTLAQRRLALLGPAPAPASPGGAKPAPGDAPAVPPARPLPAAAPAPAAAPPATPAAPAR
FT                   PEGGQPGKKAPARRKPAPPAPKAPAAGARPA"
FT   sig_peptide     complement(579828..579899)
FT                   /locus_tag="Adeh_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.899 at
FT                   residue 24"
FT   gene            complement(579997..580695)
FT                   /locus_tag="Adeh_0487"
FT   CDS_pept        complement(579997..580695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0487"
FT                   /product="MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80263"
FT                   /db_xref="GOA:Q2IN82"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80263.1"
FT                   /translation="MTPAFDAENLRILGHLCVALVVGGAIGIERSYHGRPAGFRTHALV
FT                   CLASSLLMLLTLYQQRWFPSAETVRLDPTRMAQGIMTGIGFLGAGVIFKEGITVRGLTT
FT                   AASIWITSAIGVMVGSGMYFPALAATVLTLGVLSGFRLIEARLPAHQYAAHRLRFDRGE
FT                   ALGEEAVRALLARHGCKLSSMSWRLTDEGRCVEYRMTVRTSDARNFSRLAATLQDLPVV
FT                   REFVLSPAGD"
FT   gene            complement(580777..581394)
FT                   /locus_tag="Adeh_0488"
FT   CDS_pept        complement(580777..581394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0488"
FT                   /product="protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80264"
FT                   /db_xref="GOA:Q2IN81"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80264.1"
FT                   /translation="MTLPRRSGIRALPARGPTMESILGSFLLVAASEMGDKTQLLAFSL
FT                   ATRFRKPWPIMAGILVATLANHGLASSLGAWISANVPARMLAGVLALTFLMFGLWTLRP
FT                   DSLEASKGPERFGAFLTTTVLFFLAEMGDKTQLATVALAARYGDVIRVTAGTTLGMLAA
FT                   DGLAVFLGEKLAARVSSARIRWAAAGLFFLFGLISAWAAIFG"
FT   gene            581438..582970
FT                   /locus_tag="Adeh_0489"
FT   CDS_pept        581438..582970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80265"
FT                   /db_xref="InterPro:IPR025079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80265.1"
FT                   /translation="MRGSAVPARRVLIAACLALAWPQPDAAAERGPAPPAAGGQAATAA
FT                   PVPALADAPAATAATLPASVLPPRPPPSLSPRPLPPGANVFIPAAESAAVTLVMMGWNR
FT                   WVGEAPWADISGESIGRNLRSPWVLDDDQFWINQFGHPYQGMWSMTAARSAGLGFWRST
FT                   PYTFASSLVWEIAGETEPPSINDQITTPIGGIVLGEVLFRLAGILRGDGRNPWRELGAG
FT                   LLSPMDALNHGLLHDGHDELDEPRAWTLSAGPVAARLAWDAAGPSPGWETSPEVAFRMV
FT                   HGLAWHPAFRFERPFDHFELQAAYAGRSNPDATLILRGLLAGATYGDAGGWRGVYGLYG
FT                   SFDLDTPGVFRVSTSALGLGTSGGRLLAHDLLVEGTAIVSGILMGGGGQVARDAEGKGR
FT                   DYRLGPGGQSVLELQLTAAERAAVRLGLRQYLLFGAGTIGGDELIGAGDAALVVRIAGE
FT                   HGVGIEGTLHTRTLWPEVGGREAFTGRSVRVFWEMNGFHAPATPLDPALLGP"
FT   sig_peptide     581438..581521
FT                   /locus_tag="Adeh_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.757 at
FT                   residue 28"
FT   gene            583150..583986
FT                   /locus_tag="Adeh_0490"
FT   CDS_pept        583150..583986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80266"
FT                   /db_xref="GOA:Q2IN84"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80266.1"
FT                   /translation="MPSQPIIAQARQGPQAPAAAPAKRRSMLPHEHGAWGQLAMPLLTA
FT                   LAIARPGAAAWLLTAAVVLAFVAHEPLLVVLGQRGRRAVAEDGARARRWLAALGGLAAA
FT                   TGIAGIALAPPVARLALLLPAALAALVGVLVWRRLEKTVAGEITVAAALASAGYAVALA
FT                   AGAEHPAALAALLAWILAFGAATLAVQVILVRVRSKGAADPGRRHAVLAGLLAVAAVAL
FT                   SAAGLPGALALATLPTALFSIVVCLVRVSPKRLRELGWALVGSSAVTLVILVVGLR"
FT   gene            584027..584791
FT                   /locus_tag="Adeh_0491"
FT   CDS_pept        584027..584791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80267"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80267.1"
FT                   /translation="MIPPRPPLLALCCLALALAAPSDARARRGRSARAAAEGRVVLDGE
FT                   AAAVRWTDGDTFRLLSGPRAGQRARLAGVNTLETYGPVHRWGGWRPEALLAVARAAGPR
FT                   AAAGSWDCRSVRGRGGRDRYGRLLVECPELSRALVREGLATVFAMDGPAEPALLAAQRE
FT                   AQRAGAGMWAEGVPDVIVSSAHSAGEAGLGRRGAYDRLVDAHTGAATARPHARTYRACE
FT                   EVCAGEGRGRSCLVYVPYERRFRDRPPCLVRR"
FT   sig_peptide     584027..584101
FT                   /locus_tag="Adeh_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.456 at
FT                   residue 25"
FT   gene            584961..585395
FT                   /locus_tag="Adeh_0492"
FT   CDS_pept        584961..585395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0492"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80268"
FT                   /db_xref="GOA:Q2IN86"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80268.1"
FT                   /translation="MIEAHAWNEKLDLGHEAMDHEHHLQIALVTALTEAIEQARPWMAR
FT                   QLSAQLLSYSGVHFGSEEMLMQASAFDGLADHASEHRTLLEAMREIQAALERGEDDLAL
FT                   AFAVELRAGLAGHMAGSDRRLADHVRPAHPAGAVVIPIRS"
FT   gene            complement(585413..586201)
FT                   /locus_tag="Adeh_0493"
FT   CDS_pept        complement(585413..586201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0493"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80269"
FT                   /db_xref="GOA:Q2IN85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80269.1"
FT                   /translation="MEFEVDVRRMELRGRPVLRDVRFSVAAGERVVLLGVNGCGKTTLL
FT                   KLMDGLAFPQEGAVRWRGRPLEPAALAGAAFRRAFRGEVGLLFQNVDAMLFNPSVADEI
FT                   AFGPRQLGVPEAEVEARVARWAGAFGLTALQERPPFELSGGEKKRVAMAALMAVGPKVL
FT                   LLDEPTAGLDPASAGRLVDFLAGLEGTTVVTSTHHLTLAEELGTRAVLLGPDRPGVLHD
FT                   GPTGALVRDERALVESGLAHRHVHAHGAEVHAHFHVHDTE"
FT   gene            complement(586204..586770)
FT                   /locus_tag="Adeh_0494"
FT   CDS_pept        complement(586204..586770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80270"
FT                   /db_xref="GOA:Q2IN90"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80270.1"
FT                   /translation="MASPDPRRERLLLAGWLAAAFALSAVTDLRALGLAALAAAVAFRR
FT                   GMARALARVARLVLPVTLAMSALSWAFLRLGAPAAPPLQPFLALAARTLLLAFLAFSVL
FT                   ARVNLLRALAPWPAATRLVVVALAQIHALRLLATESADGLRSRLPRRPGPLDVVRNASG
FT                   ITAALLVLAVRNAREVSDAMRSRGF"
FT   sig_peptide     complement(586693..586770)
FT                   /locus_tag="Adeh_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.612 at
FT                   residue 26"
FT   gene            complement(586757..587389)
FT                   /locus_tag="Adeh_0495"
FT   CDS_pept        complement(586757..587389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0495"
FT                   /product="Cobalamin (vitamin B12) biosynthesis CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80271"
FT                   /db_xref="GOA:Q2IN89"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80271.1"
FT                   /translation="MHVPDGFLSPAITLPAYAAAAPLWALAARRHLGRDAADALPVVGA
FT                   LTALAFVVQTIAIPVPGGTSTHLVGVTLLALLHGPLLAFLCESLVLLLQALFFGAGGVT
FT                   VLAVNALAMGLLGPLAGWAVHRLLRRRAQRAAAFLGAWISMQVAAGAVALVLGLQHRIA
FT                   PEYFPVPFAVSATALLVPSLAVTGLVEGLYTVLALALLRKADLRGVA"
FT   sig_peptide     complement(587327..587389)
FT                   /locus_tag="Adeh_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.842 at
FT                   residue 21"
FT   gene            complement(587425..587865)
FT                   /locus_tag="Adeh_0496"
FT   CDS_pept        complement(587425..587865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80272"
FT                   /db_xref="GOA:Q2IN88"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80272.1"
FT                   /translation="MRAVLALLPLLLVPAAARGHEVLHELVPGHAAGLRVYESDGEPLA
FT                   DRAYELWSPSDARTPWQSGRTDRAGWIAFVPDAPGAWRVKVVDPGGHGLDTTVQVAGAQ
FT                   AVPAGPPPAGAGFALRPLVGAAVIAAIFAALFVYQRRRGARP"
FT   sig_peptide     complement(587806..587865)
FT                   /locus_tag="Adeh_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(587990..588409)
FT                   /locus_tag="Adeh_0497"
FT   CDS_pept        complement(587990..588409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0497"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80273"
FT                   /db_xref="GOA:Q2IN94"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IN94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80273.1"
FT                   /translation="MLERIGISLEDGLLEQFDKLIAEKGYVNRSEAVRDLIRDALVQRA
FT                   FTESSGREERVAVVTLVYDHDSSSLAQKLAHIQHENHRAVVSALHVHMDAHNCLEVLVL
FT                   RGRGKDVVAMGESLVATKGVKYGKLVPATAGHDLR"
FT   gene            588517..589374
FT                   /locus_tag="Adeh_0498"
FT   CDS_pept        588517..589374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0498"
FT                   /product="Carbohydrate kinase, PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80274"
FT                   /db_xref="GOA:Q2IN93"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80274.1"
FT                   /translation="MTPPARPPLRLAVVGHVEHVTIGRVPALPRAGEIAHLQAPRWFPG
FT                   GGGGVAFWQLARSPAEVLLFTALGGDEAGAQVERALAASGPRVRVHAARRAGPHTRDLV
FT                   LLTPDGERTIVVVGEPLHPRADDALPWGALAGCDAAYFTAQDPAALRAARAARLLVVTA
FT                   RRREALARSGVAADVVVGSRLDAREVSARADYPVPPGALVLTEGAAGGTIETAAGVERF
FT                   PAPPSPDGIGGAYGAGDSFAGALVYLLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLP
FT                   LEAP"
FT   gene            589371..589979
FT                   /locus_tag="Adeh_0499"
FT   CDS_pept        589371..589979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80275"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80275.1"
FT                   /translation="MSRARRARPRVLLAPGAGAASTSAWMERWAGHLSAIGEVGRFDYP
FT                   YRLAGRRSPDRLPVLLEAHRAALRALRGRSRQPVVLAGKSMGSRVGCHLALEEDVAALV
FT                   CLGYPLRGASGALRDEVLLALRTPVLFVQGTRDPLCPLDALEAVRRRMRAPSALHVVED
FT                   GNHSLEAGVRALAARGTTQAEVEARALEAVRAFLAGHLR"
FT   sig_peptide     589371..589445
FT                   /locus_tag="Adeh_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.872) with cleavage site probability 0.615 at
FT                   residue 25"
FT   gene            590065..590853
FT                   /locus_tag="Adeh_0500"
FT   CDS_pept        590065..590853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80276"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80276.1"
FT                   /translation="MRHAGCSGIGSSRMSRRREDTMKRWIIGAAAALLASGAARAQTTP
FT                   TTDPVQQQDRDRLHDGSGAGDQVRQHDRLHDGSGIGDQVREMAKDPAHRADPTAMGDQV
FT                   RQMAQDRDRLNDRTGTGTGDQTHARMHDQVRAEMHEAMMQHAPTGAGHPELPGQAMQGM
FT                   AQRSAAEAREAQATRAAERHALRHQAGQAATQRPEGPQGQHGAGHGAGMNGAGECGEAA
FT                   GAHHLMEMHGGTMGGHGGTGGMDGGSGTGGGMGGGSGGMH"
FT   sig_peptide     590065..590190
FT                   /locus_tag="Adeh_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            591006..591473
FT                   /locus_tag="Adeh_0501"
FT   CDS_pept        591006..591473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80277"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80277.1"
FT                   /translation="MGDPDARPYAGATLVKLGRPEEALEAFGTGAAAGGDALIAYYRAL
FT                   ACYDARLYLCADAQLAGVGGRSGPRVAGEAARLRAEIARALRGEPSTAAVDFYLARCEA
FT                   LGRERRPAAAAAFCREAEGLAGRRRDGYRRDEARKLLAGLTARADAAEARP"
FT   gene            591470..592873
FT                   /locus_tag="Adeh_0502"
FT   CDS_pept        591470..592873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0502"
FT                   /product="tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80278"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80278.1"
FT                   /translation="MIAALLLAAAAAATSPCAPVSPAGAADPSAAAEYRAVAEAALRSG
FT                   DRDTAAAAFRAAAERDPADARSRAELTKLCAAGPAAADPFEEGLRLLDAGETRRAAEAF
FT                   AAARAAGAGESAALLEGICRYDLGEDDAARPLLREAERVPAHRELARLYLGLVALRAGE
FT                   GSQAASLFEAATANPALARMATDLSRLASRDGRLVLSAWAESGWDSNVTLAPPGSAGSG
FT                   DADGIWAVGAAGLWRPRGAVGPYLRAGGAANEQFQLGGYDLAALDGAAGWQARAGAVSL
FT                   LAEYAYGYRTLAGDPYLSAHRLLASAGVPLGRAVLSATAFVRLESYSGAYDPFSGVLAR
FT                   GEAKLAFPVGLAWLGLAYGAGRDAADVGYLSWVEHGPRAELRLPLGARARLAAEAGVSF
FT                   RAYDAQDPVLLDTRRDTYLDAALLGELDLGRRLTARLGLQARRALSSIPSLEYDKLVPT
FT                   VGLQWTAGY"
FT   sig_peptide     591470..591547
FT                   /locus_tag="Adeh_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            592873..594117
FT                   /locus_tag="Adeh_0503"
FT   CDS_pept        592873..594117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0503"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80279"
FT                   /db_xref="GOA:Q2IN95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80279.1"
FT                   /translation="MARALAPLLAGLLGLAGALGATLALHRAASAALDRVLEERLAGAG
FT                   ATAAELLGRAGADPAALRAVMAANGLEGAYVVDRDLRVLADATGAAGGRADLLRVDPAR
FT                   VARALRGEPSVAFAYAVGNLPVATGYFPVRGPDGAPAAALALEAGQGFAAARAGLRRAL
FT                   WLGVALSALAAVALALAAAGFARAERRSAAAAARAARGEALATMAAMVAHEIRNPLGVI
FT                   RGAAELVRARSGAALAPRDVEALGDVLGEVERLRRLTDDFLDLARDPAIAAEPADLAEL
FT                   AAEAARALGRAHPAVEVALSVPPLRVRADAARVRQVLANLLENAALAGARRVAVTAGPA
FT                   GPMARVEVRDDGPGVDADLRARLFEPFASGRARGAGLGLAISRRIAERHGGALELADPG
FT                   PPGAAFALTLPLEPG"
FT   sig_peptide     592873..592968
FT                   /locus_tag="Adeh_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.546 at
FT                   residue 32"
FT   gene            594127..595458
FT                   /locus_tag="Adeh_0504"
FT   CDS_pept        594127..595458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0504"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80280"
FT                   /db_xref="GOA:Q2INA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80280.1"
FT                   /translation="MSRVLVVDDEPKLGRFVQEMLELDGHEVVRAGGGAEALARLGEGA
FT                   FDVVVTDLRMPQVDGLAVLRAARARTPPPEVVMMTAHGSAESAVEAMKAGAADYVTKPF
FT                   PMDELRLRVRRLAEQRAAAARSAGLVARLAPDLVAESAGMRAAVAAAEQVAATDATVLL
FT                   LGESGTGKSQLARLVHWRSRRAAGPLVEVHCAALPDTLLEGELFGHERGAFTGAAQRRP
FT                   GHLAAADGGTLFLDEIGEIPPSTQVKLLRFLQDRSFVPLGATAPRTVDARVVAATNRDL
FT                   AAAVGEGAFREDLYYRLDVFAIRVPPLRERREDVLPIAERHLAGHGVPPERLGPAARAR
FT                   LLERPWPGNVRELENALERALILAGEGEIRAEHVAPGAAPRAGGRAAELLVEGFGLDAF
FT                   EREVIEAALERAGGNKTRAARLLGVTRRRLYSLLASHGLAVEGE"
FT   gene            complement(595623..596858)
FT                   /locus_tag="Adeh_0505"
FT   CDS_pept        complement(595623..596858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0505"
FT                   /product="Vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80281"
FT                   /db_xref="GOA:Q2INA1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80281.1"
FT                   /translation="MGHAGRQDGRATSGYHPPVPAPHVPDTSRGKQPDRGGTSARSRAL
FT                   ELAILLLALAGAGLAAELTLLHGRAHAGGASSFCAISERVNCDKVALSAWSSLLGVPLA
FT                   AWGLLAYLVIAALAASALRRPRAEAGWPAGLLLAASGFMAAGAVFLAAISELVIGSLCI
FT                   VCAGSWLVSFALAGCAFVLARRAGGPAAAIRADLAALRARPLASASAALVLLAASGGLF
FT                   AFYAGPPPAGTGTGAPAAAAPAAKLGPPGSIVLYEYSDYECPFCAKSHEANKPILASRP
FT                   DVKVVRRHFPLDDTCNPKLTRPFHVGACDLARAAICAEAQGRFEQMDDALFRNQAEKAP
FT                   VRELARRVGLDLPRFDACLSSPDTERRLADDIESAIQAGVRGTPSYVYGGKVYPGDLAT
FT                   LLGAKPATTSGG"
FT   gene            complement(596861..598012)
FT                   /locus_tag="Adeh_0506"
FT   CDS_pept        complement(596861..598012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0506"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80282"
FT                   /db_xref="GOA:Q2INA0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80282.1"
FT                   /translation="MSDPNDHRPPPGGPGHLQEQGQLLRLLVDSVKEYAIFMLDPAGHV
FT                   LTWNPGAERIKGYPAHEIVGRHFAVFFTPEDVRRGKPDAELREAAEQGSSEDEGWRVRR
FT                   DGTRFFASVVVTALRGPDGALRGFAKITRDLTERRRGEEARRNLAEAREAVRSRDDFLA
FT                   VASHELRTPLTCVQLVTQSLARQTHEGQAVTGQQVERLEQLQRHVARLGELVSGLLDLA
FT                   EMSRGALQLEPAPFDLAELVHEVAARFEPDVRRRGTALSVHAPGPIPGRWDRRRVGDAI
FT                   AAVLGNAVKYGGRSPIEVTASRDDRRAVVVIEDRGPGIALEDQSRVFERFERAAPVAHY
FT                   PGLGVGLWTARQILNAHGGDIAVESAAGKGARFSLRLPLEYPA"
FT   gene            598268..599296
FT                   /locus_tag="Adeh_0507"
FT   CDS_pept        598268..599296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0507"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80283"
FT                   /db_xref="GOA:Q2IN99"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80283.1"
FT                   /translation="MAGTEGSPVVIVGAGVAGLSCARALAEGGRRTLVLDRARGVGGRC
FT                   ATRALEGQPVDYGAVFLHGRDPGFLAALDAVPATRLDWPADVHGSGPPCQPEAFSPGEV
FT                   RRAFAEGVNAFPRHLAEGLELRLQRKVVGLVPGDGTVALRLDDGSFLETEVAVLALAAE
FT                   QADELLATVLPAPPAVAAARALLATASSHCALALLAAYAPGAPRPPWHVSYPETSRIVQ
FT                   LVSHESSKRPGSPLLVFTYQAHPAWSRQHLDDPDWPRHVLDEAARLLGAWAADPRTAHP
FT                   HRWRWARTDLAAELARPLLLALPGGARLGVAGDRFAPGGGVEAAWRSGRALAGRILAGE
FT                   GA"
FT   gene            599293..600039
FT                   /locus_tag="Adeh_0508"
FT   CDS_pept        599293..600039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0508"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80284"
FT                   /db_xref="GOA:Q2IN98"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80284.1"
FT                   /translation="MTGGGDALAQLVLRDRDHECEGFGPGRVCVRVVAVAGLPTRAGPF
FT                   RIVAFWNNRDAKEHVALVHGDVVGASDVPVRLHSECLTGDVMGSLRCDCRDQLTEGLAA
FT                   IQREGRGVLLYLRQEGRGIGLINKIRAYALQEQGLDTVEANLALGFRDDERDYAVAAHM
FT                   IHGLELRSIRLITNNPEKIRQLTAYRVEVSGRIPHVIPPGEHNRFYLETKARRSGHLID
FT                   LDALAPRSEQADPVVVAPAPQEPGAE"
FT   gene            600062..601219
FT                   /locus_tag="Adeh_0509"
FT   CDS_pept        600062..601219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0509"
FT                   /product="Glucose sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80285"
FT                   /db_xref="GOA:Q2INA6"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80285.1"
FT                   /translation="MRSALAALGPLALLLACGAAPARPRAPGCTMVEQGFGAAGAVRIR
FT                   VERVASGLEVPWGLAFLPGGDVLVTERPGRVRLVRGGRLQPEPVATVEIAPGGEGGLLG
FT                   IAADPRFDENRCFYLYATVEANGAPVNQVSRWRLSADGRAATREKVLLDGIPAARYHDG
FT                   GRIRFGPDGMLYVGTGDGGQPDRARDPASPSGKLLRITADGAPAPGNPRPDSAVLLSGI
FT                   RNLEAFDWLDDRTLILADHGPSGERSRTGQDEVTVARAGDDLGWPAVSGCDAEPGTVAP
FT                   ILSFRAAAPPGGGSVYRGSAVPQWKGSFLFGTLRSRHLHRVALDGRGGLGAHEVYLEGE
FT                   PPSGLGRIREVVEGPDGALWLTTSNCDGRGTCPAERDVVVRLVGG"
FT   sig_peptide     600062..600121
FT                   /locus_tag="Adeh_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.850 at
FT                   residue 20"
FT   gene            601520..601933
FT                   /locus_tag="Adeh_0510"
FT   CDS_pept        601520..601933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0510"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80286"
FT                   /db_xref="GOA:Q2INA5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80286.1"
FT                   /translation="MSRDRIYVSETDHERLRALVEQHQEGRDAAAAERLDAELDRAVRV
FT                   PDGQVPADVVTMNSRVVYEDGATGRLREITLVYPTAADLREGRLSVLAPVGAALLGLST
FT                   GQSISWTLPDGREVELKVRSVQPPAAAAASAAV"
FT   gene            complement(601950..603182)
FT                   /locus_tag="Adeh_0511"
FT   CDS_pept        complement(601950..603182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0511"
FT                   /product="transporter, CPA2 family"
FT                   /note="TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80287"
FT                   /db_xref="GOA:Q2INA4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80287.1"
FT                   /translation="MVRAVSSELAYIALLFALFVIPKALQRFRIPGAITSLLLGLAAAR
FT                   AGLFTGDPTLALLATLGITGLFLFAGLDVDAKDLRRGAALVAQHLVIQALLLAGVAWAI
FT                   AAATGVAWRPATLVALALVTPSTGFILDSLQSFGLDADQRFWTRTKAVATELLALAVLF
FT                   AVLQSTSAARFAGATAALLAVVVLIPLVMKAFAVAIAPWAPRSEFAFLVMLAVMAAFAT
FT                   RKLGVYYLVGAFLVGVAARRFRERLPAFSSDRLLHAVEVFASFFAPFYFFSAGAHLHPE
FT                   LLTLSSLAAGLVYLAAMIPLRVGLVAVHRRLALRERLGQARRVATALVPTLVFSLVLAE
FT                   IVIERFEGVPPWLVGGIIPYALLNTMIPALTLGATASFEEVHLDVTVVEPEPQPDATMA
FT                   AAPPAGPRQAG"
FT   gene            complement(603220..603567)
FT                   /locus_tag="Adeh_0512"
FT   CDS_pept        complement(603220..603567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80288"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80288.1"
FT                   /translation="MPLLVSVRDLVFRSKIHAAAERLGVTVRFAPRGARLSDAARELGQ
FT                   GTVIADLSEPGVLDEVRAARQAGLPVRVIGFLGHVEVELAGAARAAGVDEVISRGQFVQ
FT                   RLDGLLTEHAG"
FT   gene            603726..604190
FT                   /locus_tag="Adeh_0513"
FT   CDS_pept        603726..604190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80289"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80289.1"
FT                   /translation="MAVLGLVLDQPGQPDLHAALARRGLGVHAGLVLPPAGVELAPPGL
FT                   VDLGGAGGGEQVHHHALDPLARILLVGERELPLHEQPAHVAPDLLRRLRVPDLVELGLQ
FT                   VPGARALGGDGGAAGERERERGGGDPGGAGHRLSSGRDGPRTVPDAGAAR"
FT   gene            complement(604127..605113)
FT                   /locus_tag="Adeh_0514"
FT   CDS_pept        complement(604127..605113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0514"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80290"
FT                   /db_xref="GOA:Q2INA9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80290.1"
FT                   /translation="MVESIGSPALWIGFLAFVALMLALDLGVFHRKAHVIRVREALGWS
FT                   VVWVTLALAFNALVWWQFGADRGLEFLTGYLIEKSLAVDNIFVFVIIFSALGVPPLYQH
FT                   RVLFWGILSALVLRAGMIFAGTALLARFHWTIYVFGALLVATGVKLFLGRHEAPDPTGG
FT                   RLMRLVRRVIPSTHELRGAHFLTVENGRRVATPLLLALVLVEISDVIFAVDSIPAIFAV
FT                   TLDPFIVFTSNIFAILGLRSMFFLLAGMVERFSGLKTGLSAVLVYVGLKMLAMDWVKVP
FT                   AALSLAIVAALLVAPVLLGAWRDRARGHRAAPASGTVLGPSRPEESR"
FT   gene            605277..605639
FT                   /locus_tag="Adeh_0515"
FT   CDS_pept        605277..605639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80291.1"
FT                   /translation="MTALRRAARWCLTALALAAAPAARAQGEPAADAPFPLTLEVGEVK
FT                   PLCPTGTVQCPPRAILCDDPKVAVGADSPEGGALRGVGPGTTTCSAAGGSPLGARRVYR
FT                   VTVVAPGDAARDAGAR"
FT   sig_peptide     605277..605354
FT                   /locus_tag="Adeh_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            complement(605636..607138)
FT                   /locus_tag="Adeh_0516"
FT   CDS_pept        complement(605636..607138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0516"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80292"
FT                   /db_xref="GOA:Q2INA7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80292.1"
FT                   /translation="MRSPGLAALAAASALAVSGCTLAPRYQRPAAPVAAEFPAGGGAPT
FT                   GPAAADLGWRDVFQDPGLQAVIDQALRENRDLRVAALNVELARAQYGIQRSYLLPTVGA
FT                   TGSGSRSRTAKDLSFTGEPSVGNVFSAGVGLTSFEIDLFGRVRSLRNQALEQYLSTEEA
FT                   HRSAHLALVSEVAVQYLASRALQSQVALAEQTLQTVQQSYDLAKRTFEAGRTSELDFRT
FT                   AEAQVETARVNLSAYQQALAQAENALVLLAGGPLPKDLPTAPLESQPPVAELPAGLPSD
FT                   LLQRRPDILSAEHQLKAANASIGAARAAFFPSISLTASVGTASTELSNLFTAGSGTWAF
FT                   SPRIDLPIFTGGRNKANLDAANVRKSIQIASYEKAIQVAFREVADALVARGRLDEQLEA
FT                   QTRRVQAEQRRYDISELRYRKGVDSYLNVLTAQRDLYGAQQQLIQTRLARYQNSIGLYR
FT                   ALGGGWLERGTAAAAAPAPATPASPAAPAPAEPAQAAPPQQG"
FT   sig_peptide     complement(607079..607138)
FT                   /locus_tag="Adeh_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.827 at
FT                   residue 20"
FT   gene            complement(607131..610298)
FT                   /locus_tag="Adeh_0517"
FT   CDS_pept        complement(607131..610298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0517"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80293"
FT                   /db_xref="GOA:Q2INB4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80293.1"
FT                   /translation="MARFFIDRPIFAWVISIMIMLAGGLAILGLPVSQYPAIAPPVVTV
FT                   YATYPGANAQTLENSVTQVIEQKMTGIDHLRYMSAASDSSGNASVTLTFEAEADPDIAQ
FT                   MQVQNKLQNAMPLLPQQVQQQGVRVLKTVNNYLLIAGLISEDGSMTRDDLNDYAFSNIV
FT                   DQISRVTGVGEVTAFGTQYAMRIWLDADKLASFKLTPLDVSAALRAQNAQVSTGSLGAA
FT                   PAVPGQQLNATVTSQTRLQTPEQFLNILLRVNPDGSQVRLRDVGTANLGGETYELESYY
FT                   NGKPAGGMGIRLASGANALKTAELVRAKLAELSQFFPPGMKVVYPVDSTPFVRISIEEV
FT                   VKTLAEAIILVFLVMFLFLQNFRATLIPTIAVPVVLLGTFGVLAAAGFTINTLTMLGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPREATRKSMGQITGALVGIALVLAAVFVPMAF
FT                   FGGSVGVIYRQFSITVVSAMALSVVVALTLTPALCATILKPVEKGHHASEKGFFGWFNR
FT                   LYGQGSGLYEKSVGWILRRAGRALIVYAVLLAALGGLFLHLPTGFLPEEDQGSIINMVQ
FT                   LPAGATMDRTRTVMQEVTRHYLEDEKDNVEAVMAITGFSFSGRGQNAGLAFVRLKDWSE
FT                   RPKKEQHAPAVAGRAMRAFSQIKDGLAFAFVPPAVPELGNATGFELQLQDRGNLGHEAL
FT                   MAARNQLLGMAAKDPRLAKVRPLGLEDTPQYRIDVDQQKAAALGLSLSDINATLSSTWG
FT                   INYVDDFVDKGRTKRVYVQAAAPFRMKPDDLNRWYVRNRGGQMVPFSAFSTGTWVYGPT
FT                   KLERFNGSPAMVIQGEPSPGHSSGEAMAAMEEHVKALPDGIGLEWSGLSYEERLSGANA
FT                   PALYAISLLVVFLALAALYESWSIPFSVMLVVPLGVLGAVLFTELASMDAGVYFQVGLL
FT                   TTIGLSAKNAILIVEFARALYEQGMSLFDAAVEAARMRLRPIIMTSLAFILGVLPLAIA
FT                   NGAGAAGQNAIGMAVIGGMVSATFLAILLVPVFFVKIAGKRKTPPPDLVAGPRDEDEAA
FT                   PKEIAHA"
FT   gene            complement(610385..611623)
FT                   /locus_tag="Adeh_0518"
FT   CDS_pept        complement(610385..611623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0518"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80294"
FT                   /db_xref="GOA:Q2INB3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80294.1"
FT                   /translation="MNPSLRSPRAATRRAPGLLFGNRALAPAALALALVAAGCGKKQEA
FT                   RAPGPVEVGVITLSPQAVTLTTELPGRVSAFKVAEVRARVNGIVLKRLFTEGSDVKQGQ
FT                   PLFKIDPAPYQAALDSARAQLARAEATLSSARLTAERYTELVAANAVSRQEHEDAVAAL
FT                   KKAEADVAAGRAAVDAARINLGYTTVTSPVGGRIGRSEVTEGAYVQAAQATLLATVQQL
FT                   DPVYVDVTQSSAELLRMRRDLEAGKLQSAGAGKAKVALTTEDGREYGLPGTLQFADVTV
FT                   DPGTGSVALRAIFPNPRAELLPGTYVRARLAEGVNPQALLVPQRAVARNNKGEPTALVV
FT                   AGGKVELRNLVTERVIGDAWLVTSGVKPGEQVIVEGLQKVRPGAPVNPVPAGGAKQANA
FT                   ATPGQPAPAGAAR"
FT   sig_peptide     complement(611507..611623)
FT                   /locus_tag="Adeh_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.489 at
FT                   residue 39"
FT   gene            611754..612416
FT                   /locus_tag="Adeh_0519"
FT   CDS_pept        611754..612416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0519"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80295"
FT                   /db_xref="GOA:Q2INB2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80295.1"
FT                   /translation="MTVKTEPFSSFRMAENQAQRPPDWCVGKRQQILDGARKAFQELGY
FT                   ERASVDVIASRTGVSKATLYNHFHDKSALFVACFEQGSNQMQADLEALFAETSDDLETA
FT                   LQAAGERMLAKFLSREAVALYRSALDGFRLPEIGKMLYERGPRVTHELIAAALSRWAAR
FT                   GLLRVDDPYYAAVQFVNLCHGDVMMRLHLGVLQEASPEDVRATVRRAVQTFLRAFRP"
FT   gene            612545..614158
FT                   /locus_tag="Adeh_0520"
FT   CDS_pept        612545..614158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0520"
FT                   /product="Alpha amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80296"
FT                   /db_xref="GOA:Q2INB1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80296.1"
FT                   /translation="MTPARTPRRTSLALLAAAALTALACGGGSTPPPAVDVSPVPAADP
FT                   GSALPDGWERGPFAEIYVRGYQDSDGDGVGDLRGLASRLDYLAELGVRGIWLMPVTASQ
FT                   DHDHGYAVADYRGVEPGYGTLEDLDALVAAAHARGIGVILDYVMNHSAATNPLFVNSAD
FT                   GKSNPYRGWYLWKSSQPSGWSVYGGNPWRQSGTGWYYAPFATNMPDFDLANPAVAAYHA
FT                   DSQRFWLNRGVDGFRFDAVGMLFENGPGAWNDQPQNYVRMAEVRALLDGYERRFMVCEG
FT                   PDDPAGFTAACGSAFAFGHQYDVMGAARGDPAAVARVAAYFEDPARHAAATMLSNHDAF
FT                   AGQRPWDQLGGDEARYRLAAATYLLQPGIPFIYYGEELGLGGAGSLSGDWRLRTPMSWT
FT                   GDARTAGFTTGKPFRALPSNVATHNVEAERGRAGSLLEFYREVIALRRAVPALQRGGYE
FT                   GARASEATLSFRRSLGTSHALVLLNYDVVPLTLQVTGLAPGAALAPRLPTTAPAATADA
FT                   AGAASFDLPALTVRVYTWDG"
FT   sig_peptide     612545..612619
FT                   /locus_tag="Adeh_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.840 at
FT                   residue 25"
FT   gene            complement(614160..614933)
FT                   /locus_tag="Adeh_0521"
FT   CDS_pept        complement(614160..614933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0521"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80297"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80297.1"
FT                   /translation="MNAHPLLLSLALAVTPAPARAAPADLQVSPAADGAITAGALAAAL
FT                   GLRRFERDLLPASCRWCSPGRLDAWAHETLAWKHPSRAATASDLLGVGVPLGAAAALAV
FT                   PDLAGGAPRRAAEDVLLVAEAIGIATLGTELVKVGTDRIRPDAWDGSGPAHALDSRVSF
FT                   WSGHTATAFAAASAAGTIATLREAPGAPWIVGGGAAAASVVGYLRLAADRHWATDVLAG
FT                   AGWGTAVGILVPLLHWHPIAHVRLVPAPGGIAGVF"
FT   sig_peptide     complement(614868..614933)
FT                   /locus_tag="Adeh_0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(614930..615655)
FT                   /locus_tag="Adeh_0522"
FT   CDS_pept        complement(614930..615655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0522"
FT                   /product="Alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80298"
FT                   /db_xref="GOA:Q2INB6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80298.1"
FT                   /translation="MAPDLRGYGATEKRGPFDLATLAADAAGLVRALGRERAVVIGHDW
FT                   GGAMAWAVAARHPEVVSRLVILNAPHPGAFARELRRNRRQLLRSSYMLLFQVPFLPEWL
FT                   LTRDRAAGVARAIRGGSYVRSAWPAEELEPYRRAFLQPGAARAALGWYRAAFRGRRSPG
FT                   PRPRPVSAPTLILWGVEDRFLGVETIARAKLAPYLAPGNAPEIVPIEGAGHFVQNEAPE
FT                   QVNAALLQWLGPAAGRSGT"
FT   gene            616008..616763
FT                   /locus_tag="Adeh_0523"
FT   CDS_pept        616008..616763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80299"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80299.1"
FT                   /translation="MRTLTCLAALLPALAAADTSPLLLAGAQIDATGTTAVQTQPMPKG
FT                   WFSTRNVLDRTKTSLVTRLAAGATTCSADQGVVATLSSVTAGNFTEVLNPQDRTVRYVW
FT                   DTVTDLSPFQNRWHHYTGCDGVQVVLGCPEAIPVTFTIEAFAKSGTCQTYVNDLGQTVC
FT                   AADQAVAMLPAVQEADQVATGCVEEGGDPSCGIGPCESACTQSCDAAFPVGRGADKGNV
FT                   ALLKACKEACPCTCKYERPARCPQPQNCE"
FT   sig_peptide     616008..616061
FT                   /locus_tag="Adeh_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.766 at
FT                   residue 18"
FT   gene            616854..617321
FT                   /locus_tag="Adeh_0524"
FT   CDS_pept        616854..617321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0524"
FT                   /product="protein of unknown function DUF454"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80300"
FT                   /db_xref="GOA:Q2INC1"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80300.1"
FT                   /translation="MRPVRDPPYTSPVPPDPEPTTAATRAAPARRLLLLALGWTAFALG
FT                   AIGLLLPIVPTTPFMLVALWAFSASSERFHRWLYTHRLFGPPLQKWQRDRAIPVWVKAI
FT                   ALGSMAVSLAWLAFVVRPPRYALLAAAALVACGAAFVLRIPSRPRQPVREP"
FT   gene            617321..617683
FT                   /locus_tag="Adeh_0525"
FT   CDS_pept        617321..617683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80301"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80301.1"
FT                   /translation="MARRRRAPLALLGAAALLAACGGDRGHRGDGARPPAVTGGCGAGC
FT                   PEGQACVDVPGDACTWPSDAGCPGACVVPVSCGGFAAIRCPDGRACVDDPRDDCAPPRG
FT                   ADCGGLCAPAPAAGAR"
FT   sig_peptide     617321..617389
FT                   /locus_tag="Adeh_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.653 at
FT                   residue 23"
FT   gene            617711..618625
FT                   /locus_tag="Adeh_0526"
FT   CDS_pept        617711..618625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0526"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80302"
FT                   /db_xref="GOA:Q2INB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80302.1"
FT                   /translation="MKDLPLNALRAFALVFAHRGVRPAARELGVAHSSLSRHLAELEAW
FT                   AGTPLTRGPGGRAGLSFTPQGEALGQAALAALRELERAAAAVREARSERSVVISTTASF
FT                   ASRWLLPRLPALEARHPDLEVSVLVDPRPVDLGTAGAGEVDLAIRLGRGPWRDLDCQPL
FT                   LDEVLYPVMSPAAWRAAGSPRRPPALARLRLLHDRDPGATWELWRRAHGPASLDVRRGP
FT                   RLASTDLVLRAAAQGQGVALARHRLAADDVAAGLLVRPFERSVALGPAYWLVLPPHARG
FT                   RAATAGVVAWLEQEARACGPLPA"
FT   gene            618704..619309
FT                   /locus_tag="Adeh_0527"
FT   CDS_pept        618704..619309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0527"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80303"
FT                   /db_xref="GOA:Q2INB8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80303.1"
FT                   /translation="METWIATAGLVAVGVFTPGPSNFVVMHRAAAAGLRGAAPAIAAVL
FT                   LGLVALLGLAAAGGGALLAAAPALGRVLQAGGAVYLAWGGVALVVESFRRGPAEGGAAG
FT                   GALPQRPAAVFLFQFTNPKAWAMVLTAASACGGGGAGAAFLRLVPLFTALSLAGLLTWA
FT                   MLGSALERAMRVPRWRRRIDRAMGALLAASAALLLAGA"
FT   gene            619357..620061
FT                   /locus_tag="Adeh_0528"
FT   CDS_pept        619357..620061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0528"
FT                   /product="Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80304"
FT                   /db_xref="GOA:Q2INC6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80304.1"
FT                   /translation="MQPIVGIVGGLGPEGTVHYYRKLTALLAGLPLDLGRPGIVVDHVW
FT                   IDRFSGLLRAGADPEALELLLGSLRRLERAGATLALFAAVTPHRFLAALRPRSPLPIAD
FT                   LVGATCDDVRAAGHRVVGLVGTRFTVSEPFFREALEAAGVRVVVPDEAGTDYLDALIFG
FT                   PLARGEKTPEMKGELAAIVGRMAGRAPLDALVVACTDLMDLMGTEVRLLDPIDSHLRLA
FT                   LRMLGSSGARAQ"
FT   gene            complement(620066..620530)
FT                   /locus_tag="Adeh_0529"
FT   CDS_pept        complement(620066..620530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0529"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80305"
FT                   /db_xref="GOA:Q2INC5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80305.1"
FT                   /translation="MPAVKHIPDGYQALTPYLVMKDAARAIDFYRQVFGAVELMRMPGP
FT                   EGRVGHAELKIGDARLMLADEHPEMGALGPKSIGGTAVGLVVYVPDVDATVARAVAAGA
FT                   TVKGAVEDKFYGDRMGSIVDPFGHLWHVGTHKEDVSPEEMQRRMAALPSM"
FT   gene            complement(620614..621213)
FT                   /locus_tag="Adeh_0530"
FT   CDS_pept        complement(620614..621213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0530"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80306"
FT                   /db_xref="GOA:Q2INC4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80306.1"
FT                   /translation="MLAAITHDLHTAGEAWLFRALNADGGPILDGLMVLVSSKPFGAAW
FT                   AILLAILVARAARGPLAARLRLVAALGAAIAMSDGLGSQLLRPLLARRRPCYALPPGTF
FT                   RWLAPAADVGSLPSLHAANFFAMATVAAAAGPRLGLAALGVAVLVALSRVYVGVHWPTD
FT                   VLAGAVWGVLCGMLARLLATRLWAAWQRRRPAPPAP"
FT   gene            complement(621285..623102)
FT                   /locus_tag="Adeh_0531"
FT   CDS_pept        complement(621285..623102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0531"
FT                   /product="suppressor of poH thermosensitive mutation
FT                   transmembrane protein, SuhR"
FT                   /note="similar to suppressor of E.coli rpoH thermosensitive
FT                   mutation transmembrane protein, SuhR"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80307"
FT                   /db_xref="GOA:Q2INC3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80307.1"
FT                   /translation="MQTGTTEAEGLLECDLVMKGGITSGVVYPLALVELARRYRFRSVG
FT                   GSSAGAIAAAAAVAAEYGRQSGATVEGSGFAGLARLPASLGERLPGGGSRLSSLFQPTR
FT                   RTRPVLEALLGAARGRSAAGKAARALAPLVVAAPGCWVALAGLLLAGAVGAVAGRQGGV
FT                   AEAAALWLSAAAVLALAALGAVVASAVSALGAIRDNGLGVCSGFAPPGRGGPPPLTTWL
FT                   HGLVQSLAGTREVLTLGHLERHGLRLEVTTTSVTHQRPFRLPLHPDDPVFFFREAEFRA
FT                   LFPGEVVDRLVEAGRAEEAERRARTDGRRVRLPAHDPSLVLFPRGPGLPVVVLARMSLS
FT                   FPLLLGAVPLYGVDWTRRRNQRRRAEPELERAWFSDGGICSNIPIHFFDAALPTRPTFA
FT                   IDLREQHPDHPLGAWLPANNASGIAQRWRRLGEGRAAPLRFLAAVVATMQTWVDEMQLA
FT                   APGYRDRIVHVSHAADEGGLNLEMPPDVIARLAARGADAGVRLRDRFRWDDHRWIRFRS
FT                   LLDVMQRYVAPAWAAHAPGTPGRAALLALLEAHRGGRGSYPVTGPQAECARAALEGVDR
FT                   LAEAAAATGGDLRERAPRPAPELRARPRV"
FT   gene            623280..624224
FT                   /locus_tag="Adeh_0532"
FT   CDS_pept        623280..624224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80308"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80308.1"
FT                   /translation="MTRDPAPGAWPELPLAQWEGTRHALHMCTQLIGKTLLACAPPLNH
FT                   WWHTALRVSAHGLASPVAIPTADGWLDLELDLVDHALVMRTGQRTASMPLVARSVHALH
FT                   DEYLALLDQLGVRIRLWPVPVEVPQPVPFDRDDAPRPYDAGAAHRFWQVLRGCAAALET
FT                   LCDGFVGKQSPVHFFWGSFDLAATRFSGRRAPERPGADAVNREAYSHEVISWGFWPGGA
FT                   SAAGVRVEEPVLYAYAAPEPPGFREADPGVAAASYDPRLGEFLLPYAVVRAAPDPAAVI
FT                   RAFCEATYRAGATLGGWDRAALERGPGRPAAAR"
FT   gene            624306..625508
FT                   /locus_tag="Adeh_0533"
FT   CDS_pept        624306..625508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0533"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80309"
FT                   /db_xref="GOA:Q2IND1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80309.1"
FT                   /translation="MDVVTRQIRSEMEGASWIRRMFDAGLELKQRIGADNVFDFSLGNP
FT                   DVPPPAAAAAALRGLAEQVTAPMGLGYCPNAGLPSVRAALARRLAAEQQAPVEARHLVL
FT                   TCGAAGGLVTFFRAVLEPGDEVLCFAPYFVEYGAYAGHFGGVLRAVPSKVPDFTPDLAA
FT                   LEAAIGPRTRVVLVNSPNNPTGRIYDAATMRAMGALLSRVNVERGRERPVFLVSDEPYR
FT                   RLAYGGAEVAPILPLTPFSLVVGSFSKSLSLAGERVGYLLVNPGMPDAQVLVDALTLTN
FT                   RTLGFVNAPVVGQRLVEALVDESVDVAIYDRRRRAMAEALTGAGIAFHLPEGAFYFFPE
FT                   APGGDDQAFVKLLLEENILAVPGRGFGMPGYVRLTFCVDEQVIRRAAPGFARAARRARG
FT                   G"
FT   gene            complement(625505..626677)
FT                   /locus_tag="Adeh_0534"
FT   CDS_pept        complement(625505..626677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0534"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80310"
FT                   /db_xref="GOA:Q2IND0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80310.1"
FT                   /translation="MPPVRWDRLARSRRACGSAPRARALDPAEMTPAQTDRTLTLPLSR
FT                   DLALRRRFMVVDEPLQGNLRFGLLLEALDKLAEEAALDYARSTHPEARVVTAAVDNILV
FT                   RHPPDVERDLELFARVNHVGRTSMEVGIRVTQPGDPPLHVASCYFTMVARLGEGDDARS
FT                   LPLPPLEYPDERARHRERRAGERREEYRRHLAASDEPPDRGEFELLRRLHRAQDVPGFG
FT                   GLLAAELGTDAWERMFPEQENVPRKIFGGYVMRRAYELSSICAELAAPERPVLAAVNRV
FT                   NFFHPVRLGDTLHFASRVVHTDGSFVSVEASIERRSRDRSVRALSNSCLFTFVNVDREM
FT                   RPRDALAVYPTTFGEDARLLAARRQHAALLRHAHRGWISEGWTSGPPAGG"
FT   gene            626814..627440
FT                   /locus_tag="Adeh_0535"
FT   CDS_pept        626814..627440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0535"
FT                   /product="outer membrane protein, OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80311"
FT                   /db_xref="GOA:Q2INC9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80311.1"
FT                   /translation="MKRMLLVMALALAMAPVAEAQAPTPESGLMVRLRALYLRPADRSD
FT                   AIPALGVPENAITVSDKVIPEVDLSWFFNRYLAAELILTYPQQHDVELSGARIGTFSHL
FT                   PPTLTVQGHLPLGRVKPYLGAGVNFTLVTATDLAVPGVGKLELEDYSFGFAAQAGVDVQ
FT                   LAGPWYANADVKYVTIRSDVKAGGTKVSEVRVDPWLIGGGIGYRF"
FT   sig_peptide     626814..626876
FT                   /locus_tag="Adeh_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            627597..628340
FT                   /locus_tag="Adeh_0536"
FT   CDS_pept        627597..628340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0536"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80312"
FT                   /db_xref="GOA:Q2INC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80312.1"
FT                   /translation="MRDAREPGGQAAPGGAVGGAPERAAADASASRGAGLDGATLAHEL
FT                   KNPLTAVKALVQLGLGNPREAASHERLEHVARAVERMERILRDYLASARGMAELAPARV
FT                   EVGPLVSGVLQGLSARASEARVRLVTHGDATVEADPRRLEEALVNLVANGIEATPPGGE
FT                   VEVEVLSSAEGAELVVRDTGTGIAPDALQRLGTPFFSTRSGGNGLGVAHVRSVIAMHGG
FT                   SLQYESEPGKGTVVRATLPRRERAA"
FT   gene            complement(628390..629133)
FT                   /locus_tag="Adeh_0537"
FT   CDS_pept        complement(628390..629133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80313"
FT                   /db_xref="GOA:Q2INC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80313.1"
FT                   /translation="MGVTGAPSWPAARRARGPLGEVDGRVVLLLALLFGVLVWRAGAAA
FT                   NAVYAAGFAAALAASGATAREARRLARWAGGFALLWGGVKLALDLAGGVPPAAALATAG
FT                   LLCLRLAALLLLGAAVSALVSPRALGLALATLTRPVLRDRAWSASLALLLMVHFVPRAL
FT                   AAFEAARAALRARRVRLSRTRALALVVEAGTRNLARMTWDQTLAVAARRLDRPEAWTGV
FT                   PPPRARDWCAGAAVAALAVAAAALL"
FT   gene            complement(629124..629852)
FT                   /locus_tag="Adeh_0538"
FT   CDS_pept        complement(629124..629852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0538"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80314"
FT                   /db_xref="GOA:Q2IND5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80314.1"
FT                   /translation="MIRADGLGYAFGAGGPALEAIGFALPRGALCAVVGANGSGKSTLL
FT                   ALLAGLFTPSAGTLAVGGDASPGAEEAIRRRAALVLQDPDQQIIGATVDEDLLLGLRPG
FT                   DAAARDAARALAARLGLLDLSAPVHALSLGTRRKLCIATALRDAPEVLLLDEPFAGLDY
FT                   PAIREVRAVLAANRAAGVTQVVAAHDLEALADLADRWLVLERGRLVADGAAEAVFPLLR
FT                   GHGVRPPGAWLSAHGLDPWA"
FT   gene            complement(629849..630430)
FT                   /locus_tag="Adeh_0539"
FT   CDS_pept        complement(629849..630430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0539"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80315"
FT                   /db_xref="GOA:Q2IND4"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80315.1"
FT                   /translation="MPAPNADPAPPRPAPSPPLARVHRLVWTALLAACIAVGAWIQVPV
FT                   GAVPITLQPLFAFLAGYLLGPARGAAAVALYVAAGVLGLPVFAGGAAGLGVVLGPTGGY
FT                   LLGFVVAAALTGLVPRRGPIGWGAGLAAGAAALAAAYVIGAAWLAAVLHLGARQAIVAG
FT                   VVPFLPFDVVKVVVALWVARRLRAQGLAPA"
FT   gene            630536..631201
FT                   /locus_tag="Adeh_0540"
FT   CDS_pept        630536..631201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0540"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80316"
FT                   /db_xref="GOA:Q2IND3"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80316.1"
FT                   /translation="MSPAMTSPALPLVHVVRPPRVPSARPPLLVLLHGIGADERDLLPL
FT                   AAHLDPRFLTVSLRAPNEAEPMGFAWYAIDWRTAPPRHDVAQAAASLEALLAFLAGAPA
FT                   ALGTDPARTFLLGFSQGAAMALAAALARPELVRGAVLHSGRPLPGQPAPAGGLAGLEVL
FT                   VLHGLADPVLPPAQGRAIRDLLAPVLGPRLTHLELEGAHEVTAETLSEAARWLSARLG"
FT   gene            631211..632008
FT                   /locus_tag="Adeh_0541"
FT   CDS_pept        631211..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80317.1"
FT                   /translation="MRPRFRACITAALACAAALAPARGLAGPPYTTDDPEPVPFRHWEV
FT                   YLATADQWSHADGWGGTCPHLEVNYGAIPGVQLHLVAPLAWARPPGGPGRAGPGDTELG
FT                   AKWRFLDEGTRRPQVGVFPLVELPTGDDRRGLGAGRAQVFLPVWVQKSLGAWTTYGGGG
FT                   YWLSPGAGNRNWWLVGWQAQRRVADGVALGAEVFHSSAREIGGRGDTRFDVGAVLDLGA
FT                   LHHVLVSAGRALGSRAAQAYLAYQLTFGPGGGPEERAASGAPR"
FT   sig_peptide     631211..631291
FT                   /locus_tag="Adeh_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.900 at
FT                   residue 27"
FT   gene            complement(631950..632927)
FT                   /locus_tag="Adeh_0542"
FT   CDS_pept        complement(631950..632927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0542"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80318"
FT                   /db_xref="GOA:Q2IND9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80318.1"
FT                   /translation="MDREQLAAFDQVAREASFTRAAIALGLGQPAVSARIRALEDQVGG
FT                   ALFTRGRRVALTALGESLLPYARRALEVLAEGLEAARLAQVGQRGRVRLGTLGSVAGGL
FT                   VGPALGAFVRAHPEVECLVRAGDHERIVALLLDGLVDLGIVTWPCTEAAAAELQDVLRF
FT                   HEPVLLVARPGHPVTARPDLCADELVRLGRPMFRLRWWQAPHPLLTRLAEQAGTPVEIP
FT                   METARALALEGAGVGFFVRTYVEEDLARGALVEVAVRDLPRIHRDTALVRRRRGGPLSP
FT                   AAAALVEQLRRQAAALGVLEGAPGRLSAARRRQRAPPARRRGRR"
FT   gene            633047..633640
FT                   /locus_tag="Adeh_0543"
FT   CDS_pept        633047..633640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0543"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80319"
FT                   /db_xref="GOA:Q2IND8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80319.1"
FT                   /translation="MKRIRMATLEDAGDVAEIYGAVVTGTPISFELEPPGPEEMARRME
FT                   AVLALAPWLVCEEDGRVDGYVYASRHHERAAYRWSVDVTVYVRDGRRRGGLGRALYTAL
FT                   LELLRAQGFHAAHAGITLPNAGSVGLHEALGFRPIGVYPRVGWKMGAWHDVGYWQLELR
FT                   ERTGAPGPILPVEALRRSAAWDRALAAGQALLAR"
FT   gene            633904..634896
FT                   /locus_tag="Adeh_0544"
FT   CDS_pept        633904..634896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0544"
FT                   /product="Aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80320"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80320.1"
FT                   /translation="MTLATRRLGSQGLEVSALGLGCMGMSQSYGAADEAESIATLHRAL
FT                   ELGVTFLDTAEVYGPFHNEELLGRALAGRRDEVVIATKFGFAIGGGARTGGLDSRPEHV
FT                   REAVEGSLRRLRTDRIDLLYQHRVDPAVPIEDVVGAMSRLVEQGKVRYLGLSEAGARTI
FT                   RRAHATHPVTALQSEYSLWERNLEPELLPLLRELGIGLVAFSPLGRGFLTGAVRRAEEY
FT                   PESDFRRRDPRFQGANFDANVRAADAVRALAARRGATPGQLALAWLLHRGEDVVPIPGT
FT                   KRRRNLEENVAAASIALSPAEVAELDAALAPENVAGPRYDEERMRTVDR"
FT   sig_peptide     633904..633999
FT                   /locus_tag="Adeh_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.489 at
FT                   residue 32"
FT   gene            complement(634914..635270)
FT                   /locus_tag="Adeh_0545"
FT   CDS_pept        complement(634914..635270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0545"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80321"
FT                   /db_xref="GOA:Q2IND6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80321.1"
FT                   /translation="MTLLTTPLENDPALQFRIDAFEVPEDARAEFEAAMTRNLELLTSL
FT                   PGFRGHLVFRKTGGPSRFGLVTLAIWESRAALDAAGVAVRAHYERIGFDRAAALARWQV
FT                   RSELGGYEVLRPPE"
FT   gene            635357..636130
FT                   /locus_tag="Adeh_0546"
FT   CDS_pept        635357..636130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0546"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80322"
FT                   /db_xref="GOA:Q2INE4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80322.1"
FT                   /translation="MQVRTFPPGAALADVVRCFQIVEAPEEATRTLLPDPGVVVAFRYR
FT                   GAAALVEREEARWIPDASVTGPRGTSRRIRTLAGGGVVVAKLREDGAARLLGVRGDELY
FT                   GAVLPADALAPRAAVDRAAAGIAEAATDAERVAAAEAFLLSLGRRRGPDPLVGAAVQAI
FT                   RARHGCLRIAELARQLGLGQDALEKRFRAAVGTSPKQLASLLRLHHAVEVHLGGASLSS
FT                   APYQAGYYDQSHFIREFRAVTGQPPGRYFAAGTHG"
FT   gene            complement(636103..636684)
FT                   /locus_tag="Adeh_0547"
FT   CDS_pept        complement(636103..636684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0547"
FT                   /product="FMN-binding pyridoxamine 5'-phosphate
FT                   oxidase-related protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80323"
FT                   /db_xref="GOA:Q2INE3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80323.1"
FT                   /translation="MGHRFAELAFTPAVRAVQESMGSRAAYARMEAGPDHHDALGPDEA
FT                   GFIAARDSFYLASVGETGWPYLQHRGGPPGFVRVLGPRTIGFADYRGNRQYVTVGNLAR
FT                   NDRVALFFMDYPARTRLKLLGHARWVGPEEPALLAALSAPAGAAPVERGIVIEVAAFDW
FT                   NCSQHITPRFTEAELEAGAGPDQPWVPAAK"
FT   gene            complement(636764..637768)
FT                   /locus_tag="Adeh_0548"
FT   CDS_pept        complement(636764..637768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0548"
FT                   /product="Alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80324"
FT                   /db_xref="GOA:Q2INE2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80324.1"
FT                   /translation="MIRIPPPPRRPLTAALLAALALAPAALPARTAAAPAGQATAAVQV
FT                   RYRTATVDGVEVFYREAGRPGAPAVLLLHGFPTSSHMFRNLIPALADRYHVIAPDYPGF
FT                   GHSAMPARDAFAYTFDRYAQVVEALTEQLGLRRYALYVMDYGAPVGFRLATAHPERVTA
FT                   LVVQNGNAYDEGIEAFWDPIKAYWASGSAEDREAIRWLTSLKATHWQYTNGVPDPSLVS
FT                   PDTWTVDQARLDRPGNPEIQLDLFYDYRTNLPLYAAWQAYFRAHRPPTLVVWGKNDAIF
FT                   VAAGAEPYRRDNPAAEVHLLDTGHFALETHGPEIARLVREFLGRSVRTKAAAN"
FT   sig_peptide     complement(637673..637768)
FT                   /locus_tag="Adeh_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.466 at
FT                   residue 32"
FT   gene            637888..638856
FT                   /locus_tag="Adeh_0549"
FT   CDS_pept        637888..638856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0549"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80325"
FT                   /db_xref="GOA:Q2INE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80325.1"
FT                   /translation="MDRLHQLQVFVAVADAGGFARAGARLRLSPPAVTRAVAALEARVG
FT                   ARLFNRTTRTVRPTEAGLRFLEPARRVLADLETAEREAAGEGAAPSGHLTLTASVTFGR
FT                   WALAPVVRAFLRAQPGVGATLVLVDRVVNLVEEGVDVAVRIGQLPDSDLVARKVGEIRR
FT                   VLVASPAYLRAHGAPASPARLREHAAIAFTGLQPGREWRFADGGRQVAVPVAPRLVVND
FT                   ALAALDAAEAGDGLTLALSYMVAERIAAGRLVPVLGRFAPPPVPVQLVHPHARLVAPKV
FT                   RAFVDFAAPRLAAAIAALPAIPERPARSARSARRTARASRA"
FT   gene            complement(638843..639313)
FT                   /locus_tag="Adeh_0550"
FT   CDS_pept        complement(638843..639313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80326"
FT                   /db_xref="GOA:Q2INE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80326.1"
FT                   /translation="MDRSPERRTAVMIWGALVAGPALFLVVALALPLAGEPAPGIAQPL
FT                   LLVLTGLVLVEVPLSWLWAVRARLAGKAGGEAISVEEQARTRLIIAAALCEGAALFAVV
FT                   VFMVTRDARALPLFAIAFGALLAHYPGDRHWARLCRGSGAGSSAPPNRLMRG"
FT   sig_peptide     complement(639221..639313)
FT                   /locus_tag="Adeh_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.924) with cleavage site probability 0.479 at
FT                   residue 31"
FT   gene            complement(639402..640313)
FT                   /locus_tag="Adeh_0551"
FT   CDS_pept        complement(639402..640313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0551"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80327"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80327.1"
FT                   /translation="MTKPLEGKVALVAGATRAAGRGIAVELGAAGATVYCTGRTTRTRR
FT                   SEMDRPETIEETAELVTRAGGRGIAVAVDHLVPAEVRALVERIDREQGALHVLVNDIFG
FT                   GTKMEWNKTVWESDLEYGLHTLRLAVDTHAITAHHALPLLIRSPGGLVVEVTDGTAEYN
FT                   ARNYRVSFFYDLVKAANLRMAWSLGHELAPHRATAVAITPGWLRSELMLELFGVTEASW
FT                   RDALEKEPHFAISETPAFVGRAVAALAADPEVARWNGQSLSSGQLAKVYGFTDVDGSRP
FT                   DAWRYMVEVQDPGKPADVTGYR"
FT   gene            640515..642002
FT                   /locus_tag="Adeh_0552"
FT   CDS_pept        640515..642002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0552"
FT                   /product="major facilitator superfamily MFS_1 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80328"
FT                   /db_xref="GOA:Q2INE7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80328.1"
FT                   /translation="MGTARTLTAAGGEPAFRGNDRLLLGIILGVLTFWLFAQTTLNIAP
FT                   DMRRDLGTGESLMNIAVALTALFSGIFIVVMGGLADRVGRVRMVRLGFLASIAGSLLVG
FT                   LAPAGGLAVAFLLAGRALQGLSGACIMPASLALVKAYWDGAERQRAISLWSIGSWGGSG
FT                   VCSLFGGLVTQHLGWRWIFFASVLVAIAGLLLLRGTPESRAEGGAADYRFDLAGVLTFM
FT                   VAMVALQVVVTQGNQLGWTSPASLGLVAATIVFGWLFLRIERRARSPFIDFGLFRSPTY
FT                   TGATISNFLLNGVAGTLIVSLQLVQVGGGMSAQRAGVLTLGYAVAIIAFIRVGEKLLRR
FT                   FGARRPMLWGCAITGASILLLAPSNVMLARYEVMAVIGYTLFGVGLAFYATPSTDAALS
FT                   NLPASQAGAGSGLYKMASSLGAAFGVAISAAIFTALRAAPQSVSWLEGVITFQGRQDNL
FT                   AVREAAIIALGFNELMVVVAIVSIVLTIPEGERRQGA"
FT   gene            642201..643394
FT                   /locus_tag="Adeh_0553"
FT   CDS_pept        642201..643394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0553"
FT                   /product="Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80329"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80329.1"
FT                   /translation="MKTTIIAGRLALACGAVLLGLGGGGVARATECGDLVTSSLKLEKD
FT                   LTCETSGLVIGADDVTIDLGGHTIASVPGAPGDVAWSGVKTEHTMTLRNVRVMNGTIVG
FT                   FRWGVAIRHGTAGAAIQNLAFADQADASVFVRDSSGVRITNVKVTDSGPISILNAGDVR
FT                   ISMAAIALASRSPAIIARNSAGVSIRTLAASGPIPSYYGDVVEPDSGILFERVTNADVQ
FT                   GVYVRGFKDGVGFTCPGCAPGDVPNSGSVRDSVFTDDQAGVNVEYASNVTVAGNHVARA
FT                   GRWHPVYWFVGGGITAAECTGLAVVDNAVSDSLQGLGFMDVTASRIEGNKVLDNVLSGI
FT                   GLNIQVGGSFGNTVASNIVLGTSTGFDIWAASGPNTWKGNLCRTASGEGVACAIVVP"
FT   sig_peptide     642201..642290
FT                   /locus_tag="Adeh_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.891 at
FT                   residue 30"
FT   gene            complement(643503..644036)
FT                   /locus_tag="Adeh_0554"
FT   CDS_pept        complement(643503..644036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80330.1"
FT                   /translation="MRRWIVGAIIALSTMTAASASDVAGEARHCSLVGSYVTGAEGVFS
FT                   SWMVTMTGGEVSGTLTTNVPAWPVPLGAGVKLLPTVGVWKRTGTNTFAFTQIFWAVGPD
FT                   GAVVAVFKNSGTDTLTDECNVLVVESTMEAFNPDGSEHPLGIPGNDTNANWLPPMIGYR
FT                   VQVQPPADDAVPMP"
FT   sig_peptide     complement(643974..644036)
FT                   /locus_tag="Adeh_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 21"
FT   gene            complement(644323..644745)
FT                   /locus_tag="Adeh_0555"
FT   CDS_pept        complement(644323..644745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80331.1"
FT                   /translation="MSRARWKVVLVLALVFLAGGVSGAVVSRAVVQRAVGRLLEGPPEQ
FT                   ARASAILFRLDRDLDLTREQRGELRAVLARHRGELAAIRRTVAPQLEAARRRQWAEMRE
FT                   VLDERQRDGFDRFVEELERRVARSLAAPPSAAAPIE"
FT   sig_peptide     complement(644674..644745)
FT                   /locus_tag="Adeh_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.600 at
FT                   residue 24"
FT   gene            complement(644742..645023)
FT                   /locus_tag="Adeh_0556"
FT   CDS_pept        complement(644742..645023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80332"
FT                   /db_xref="GOA:Q2INF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80332.1"
FT                   /translation="MRDHDESDDARLARLRDATGALHPSAAVVARLEAAVAARLRSPPA
FT                   WMAIAGGARPIALGAAALTAAMLLLGWRADRTFEEQVSRAAYVLEVLP"
FT   gene            complement(645016..645522)
FT                   /locus_tag="Adeh_0557"
FT   CDS_pept        complement(645016..645522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0557"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80333"
FT                   /db_xref="GOA:Q2INF0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80333.1"
FT                   /translation="MTASQDDDIGRIVRETAPRLYRLAARLTGDLAEAEDVLQESYVRA
FT                   CAGLGGRAFQRRSSIETWLHRIVVNASLDALRARRRRSARETHAAPADEVLDPGASLEA
FT                   RAALRELSEWLDELPAEQRVALVLKEIEGHSASEVARLLGCSEGAVEQRLVRARTFLRE
FT                   RRKHA"
FT   gene            645699..646343
FT                   /locus_tag="Adeh_0558"
FT   CDS_pept        645699..646343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80334"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80334.1"
FT                   /translation="MIHEPLSLLALAVLALTSPSSAAAADADVVARARARESAQLAELA
FT                   RSPVRVEAEGRASGGRRSREIAWTREITYAPDGTVQVRQLSGSGAGARGGRAFQLLGPL
FT                   TLAPFSVPGAHIAVRPSPGPGGSVLVEVRSPAGAISAVVVEVDPATGAKRALEVVPGGG
FT                   EGGRVSEARARITFDEDGAIARLESHAEIEGRRGAGTVEVRGHRVASAPQR"
FT   sig_peptide     645699..645773
FT                   /locus_tag="Adeh_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.893 at
FT                   residue 25"
FT   gene            646373..646744
FT                   /locus_tag="Adeh_0559"
FT   CDS_pept        646373..646744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80335.1"
FT                   /translation="MIAPLAALSSLAVAATVVVTHPRTVVVAPRPRAVVVVPARPPPPP
FT                   PAPPPMSRREAVERGYGWCGGSGYACVLVEAHPRGTVWDVHFRASRPGVTGPLRVTFDR
FT                   QTRALVEAVEPGPRAPPAR"
FT   sig_peptide     646373..646435
FT                   /locus_tag="Adeh_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.856 at
FT                   residue 21"
FT   gene            complement(646963..649308)
FT                   /locus_tag="Adeh_0560"
FT   CDS_pept        complement(646963..649308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80336"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80336.1"
FT                   /translation="MHPAPGEPRRRGDEALPDAAGDDRLHHPAPILRSVPGVEPPAAAG
FT                   WGGRRHPGLRVPCILLTGGGTHELVEAEACGRAGRFGPVPRQVGGAAGGLRLAGRPGRA
FT                   PGRGDARRRGRLVREARARPLGRGDAGGPPRPAAPAGRPRRHGRTADARGEGRGEGVPV
FT                   RGGHHHRLAFGERARRPQGPAALPAGDHGRRGGGRGGPPEPGVLVPRRPRRRARPRRRP
FT                   RHRRHLHHAPAVRPGRAGRRRGRERGGVLAPQPRPEGDRVLGLRRAPAGPGGARPRARS
FT                   APRARLRRGRGAARAGRDAHAARRFRAGPRRSGAHLPRRHGPRPRRLPVFRGRRAPDRP
FT                   RRHLRSGERRLAPAAARPRRAAPVAPPAGPGAGGGADPVLDRRHGAHGAARPGDARRPA
FT                   RRGRGARGVRVRGAGEARRPRGRRGRGRPRAPVVRGAWLPAGRGGRHPRQHALPRRGPE
FT                   AGRSRRPLAGPAQRLGDVHAGGPDRSAPDAHAPHDPRAPPGAPGGDARGRLAGPERGGL
FT                   DAALPGAVGCDLEVPRLARERLGALRRGRGRLRPQPRGAFAPQLDDLRRHRGGLRRVEA
FT                   DGPGAANRPALAGEERLELRSVERSDEREHLVRALPADGLQRLLVKPRLAPVPGGIAHE
FT                   VARADVQHRQDRRILARRVDLGEGERAIHARVERGRLLLERVPVGRFGLGIGVDADVLV
FT                   PEPVDGADRDALGLAEPAHVGHLERPVLEASEREGLGANLDEDEVGTIRLDEPGQIRER
FT                   ILGLGEVRPVDRPHDHRLEARGRRIAWR"
FT   gene            649314..649886
FT                   /locus_tag="Adeh_0561"
FT   CDS_pept        649314..649886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0561"
FT                   /product="protein of unknown function DUF1211"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80337"
FT                   /db_xref="GOA:Q2INF3"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80337.1"
FT                   /translation="MNKGRLEAFSDGVLAIIITIMVLELKVPPGDTLEALAAMRSTFLG
FT                   YVLSFVYVGIYWNNHHHLMHTVHHVTGSIMWANLHLLFWLSLVPAVTAWADHYPSSPLP
FT                   TALYGVVLLAAALAWLVLQRAIIRAGGSLRLMIGADLKGKLSPILYLIAIALSFVRTWA
FT                   ADAVYALVAALWFIPDRRIERRSGAGE"
FT   gene            complement(649902..650633)
FT                   /locus_tag="Adeh_0562"
FT   CDS_pept        complement(649902..650633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0562"
FT                   /product="DNA mismatch repair protein MutS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80338"
FT                   /db_xref="GOA:Q2INF6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80338.1"
FT                   /translation="MRGWLTALGEMEALAALATRVYENPAEQFPEVVSTGTMLDAQELG
FT                   HPLLPVERCVRNDVRLGGTAPQLILLSGSNMSGKSTLLRALGASAALALAGGTVRARRM
FT                   VLSPVALCASLRVQDSVLDGASRFQAEVLRLCDVARFAAGPHAVLFLLDEILGGTNSDD
FT                   RLRGAKGVLTALVNRGAIGVCTTHDLALTRIADELGARATNAHLVDALVGGKLAFDYRL
FT                   RPGVVRRSNAIEWMRLVGLEV"
FT   gene            complement(651423..652646)
FT                   /locus_tag="Adeh_0563"
FT   CDS_pept        complement(651423..652646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0563"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80339"
FT                   /db_xref="GOA:Q2ING0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80339.1"
FT                   /translation="MISVLVVDDDRLKTTLIRQALRELATDIRVTGASNIVDALKLLRA
FT                   ESFDLLIVDLNVPMRKGESARPDGGVQLVELLRRGRGPLPAHIVALTEYDDLASQHQKA
FT                   FSGDLIYVVRFDRSSRAWSEAIGRKLLAIERSQAPRERGGYDYDLAVVTALTRVELEAV
FT                   LELPISWRRRNVPEDDTIYHEGCLKRAEGDLRVIAAAAPEMGMPATTALAMKMICGFRP
FT                   RYIAMVGIAAGLKGGFGDVLIADISWDYGSGKFKERPDGKGGVFEPGPTQLRLDARVRA
FT                   RLEDFSRDQTVAQRILHRWNGDPVPRQIEVAIGPVASGAAVVDSHEMIEQIRAQQRKVV
FT                   GVEMETYGVFMAARNAPEPKPIALSFKSVSDFGSQKGDDYQRFAAFTSAQFLYEFACSG
FT                   LEWPHSRS"
FT   gene            complement(652643..653056)
FT                   /locus_tag="Adeh_0564"
FT   CDS_pept        complement(652643..653056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0564"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80340"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80340.1"
FT                   /translation="MRFLRTEFPTASVTAAQSYQSGLKAALGDTFDAIILDMSLPTYDI
FT                   SASNSGGRTRGYGGREFLEALKRRRRNTKVVVVTQFDTFGEGADAMNLTQLTEQLRAEY
FT                   PDIYVGTAFYQASQTAWRDELQAYLKSVSGDLS"
FT   gene            complement(653101..656580)
FT                   /locus_tag="Adeh_0565"
FT   CDS_pept        complement(653101..656580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80341"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80341.1"
FT                   /translation="MWTSEAPARPTTRLSVGRVGYRSMPPKNGYSPLLSGRTDNLAAHL
FT                   SALKEEPPSQIRFVLRKLPPKLLRALTANFLPRTLGDLGKAPVGRSQETLQAELNWAAA
FT                   IVSRYAAQLASYLKFSDSVERLFLLGRTDAAFGELRTAEAQLGVSLWSVRMSLLLAEHI
FT                   GGLEANRAALTVLREASGLGTLNLLATYYSQRAERSVSLASYDTAVAQIFRQIPAENLD
FT                   PWAAAYVRFHLSFHSEPHFQRQAFVLKREGAFSVIDRYETFVRTLQLLASGADGLDASI
FT                   AVRPYAQLVSAIPDVRIRCLLAWTQPHNANVITDLTDSLVSLSDAYTRGDYAQVLEAAP
FT                   PLLEAHPNALEFYELYALSHLHLGVPLINSLPATSPAAQALNNVYDVLQKDERTSEALD
FT                   SLGKLAATLAFSRFASQLRAFRDSHSTHRQPFAGPVFFQLNTIAPSGRFATIFRRAADA
FT                   LAFLDALRRSDAESPSIALFRAGAEGRDPPPDVDPARRDRYRAHDLLRRQRTAEAANEF
FT                   RRMLSEQQPVPVREECTRALAAACMSLQRWTECAELLARAFVEQPNLLATIEIAPVADA
FT                   YPGIDPEGQASIAWPIICHIRYTQAPGPGTARGVVAALDNYLVAHNVEKPTELLGRAAG
FT                   APSPEFVYFLRNVCVPELMDSLVGFDSVADLQRERIALCQILREHFDKVHADTYADEIK
FT                   RITQTLEVSKAIQHIDESKVNIDTNGIARSLDKSFRERFERFVSFSKLNEHLRKALALK
FT                   GIVPESEDMIILSDERLEQFGALFGDIKSRFLSSNEYGLDAYLSMRIRHGTLAGQLRSQ
FT                   FELEHLITRKTAEGEYEPNTEWLERSFATTGHAATAEADKRLRAFSSDIDDLIEHFKSK
FT                   CVQIRGPQNGNEGLFDFEYTNEDLRRLYVRFATVSEYDSFVHGVFAELWSRTERNLQKV
FT                   VEHIRTRLEREFVSSLDRLASDLAVLNPELPHLPLGAAVARSKTNIHYELERVAGWFRK
FT                   ASDAGFPDFSLSLLAQTAVAIVQNCYPTHRLQPQVAIGDECTLRGTLFAAFNDLMFYLL
FT                   ENVVRHSRCTPATAVMRLARENERVRIHVENPLGPSVNVASVRERISYVASLRTSVPSG
FT                   AVRSEGGTGFKKIHKALRVDMGLEEDFEFAVSVSDDGVFAVDISLPLQGLAP"
FT   gene            complement(656671..657132)
FT                   /locus_tag="Adeh_0566"
FT   CDS_pept        complement(656671..657132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80342"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80342.1"
FT                   /translation="MSLMLPGDAKAYVRGLTAFREAASATGLSVYPSDGAGGREATENR
FT                   AWEARELIDLIKARAGDPDRRRALPTVHPAAGCCSTMESLTGAAARQSRRPENAASHES
FT                   AQFMEKAGALGTNISALCREYGIARRPATSGFGDTGSKATMQCRQRFRE"
FT   gene            complement(657535..657611)
FT                   /gene="tRNA-Asp1"
FT                   /locus_tag="Adeh_R0004"
FT   tRNA            complement(657535..657611)
FT                   /gene="tRNA-Asp1"
FT                   /locus_tag="Adeh_R0004"
FT                   /product="tRNA-Asp"
FT   gene            complement(657618..657692)
FT                   /gene="tRNA-Val3"
FT                   /locus_tag="Adeh_R0005"
FT   tRNA            complement(657618..657692)
FT                   /gene="tRNA-Val3"
FT                   /locus_tag="Adeh_R0005"
FT                   /product="tRNA-Val"
FT   gene            657850..660546
FT                   /locus_tag="Adeh_0567"
FT   CDS_pept        657850..660546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0567"
FT                   /product="RNA polymerase associated protein rapA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80343"
FT                   /db_xref="GOA:Q2ING2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80343.1"
FT                   /translation="MAWKAGMKVVHRAQRAWGVGVVVQVADEGRRLAVRFAGREGITVV
FT                   SGRDQALVEVPADTPIEQVASGPIEALASAQPATASAFALRTRVNRLEALRRADSLGAL
FT                   LSSRVHVLPHQVGAAGRILSDRMPRFVLADEVGLGKTVEAGLVFAGMRQLGLAERVLVV
FT                   VPEHLAFQWLAELFHKFNALFALLTPERIEALGGPEAALARSPHAIVSFEALRADPELA
FT                   EAAADLPLDLVVVDEAHHLADDALHDRVAPICRASFGVLLLTATPVRLDPREYFRLLSL
FT                   VEPVPSTSLDDFLARLEQHEAYAQVARDLLAGGDLAAAAERLRALAPDDLVFSKAPPAL
FT                   DRGALLAHLAERYGLSSRLIRNRRVKVGAFTSRALRRVDVGEGEKPKALVDLCARLARA
FT                   GDKVLVFGGDLEALRGLQGGLAEAGLEALLYDDAPSLEARDRLVARFRDPEGPMLLLSG
FT                   ESGGEGRNFQFAHHLVCADLPASPLVLEQRIGRLDRLGQTRPVEIHVPVEPGDEAFLAD
FT                   LYEQEIGIFDEPVGGLDAVLASLPDELAALARKRSDRTREAFRKDLAKRVAAARKAQHE
FT                   GDPLLDIRSASLPELARLVRGAFERMGEEAPDGIDGGDGAGSALEQSLITLSRWLEEEL
FT                   EDVCADVGRRVGMDVDTDQNVQPFEVAFTLGSGMRIEALPGMQIPDEPETFVGSFWRET
FT                   AVARDELHWYATGHKLVEALLGLVRDGDAGRSAAVKREWAPRRGGLYARFEPRLATAAD
FT                   VAPGARVASRQASRYLDLSPIAVVVDLEAGNRVLPGAAHRLEDEIDDVQDARVGAPPPA
FT                   ALEAARAAAEREARLVMERRREEAVGLLLAHADAEEERLIEAAFAGGAPRERIDGALAV
FT                   LRHHRDVVAKSIERVKLDLDAAALIVP"
FT   gene            complement(660700..661815)
FT                   /locus_tag="Adeh_0568"
FT   CDS_pept        complement(660700..661815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0568"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80344"
FT                   /db_xref="GOA:Q2ING1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80344.1"
FT                   /translation="MDLVPLLRSLVALDTTSARTNLPALDLLEREAHAAGFATRRQRWT
FT                   DAAGVEKGNLVCRRGPDVPGGLALVGHTDCVPFDPEWKEALSGELVDGRLVGRGSADTK
FT                   AFLAAALTAARAAAPGRLPLTLVFTADEEIGCLGAKKLLAEGALHPAHAIVGEPTRLTP
FT                   IRAHKGYCAVEVVVSGIEGHSAYPEVGASAIHHVGRLWPELEAIGADLTRETDQAFSPP
FT                   YTTWNVGVIRGGKARNIIAGECRFTFEWRPLPGHDPKRALRLLEDACARLAAASGGKVA
FT                   VKVIPLRTDAAAVTPPGAEIVRFLEAESGNPAATVPFGTELPELIGMGAEACVFGPGDI
FT                   REAHRTGESVPLDQVERTVTILGNAIARFCA"
FT   gene            complement(661861..663258)
FT                   /locus_tag="Adeh_0569"
FT   CDS_pept        complement(661861..663258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0569"
FT                   /product="formiminoglutamate deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80345"
FT                   /db_xref="GOA:Q2ING3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80345.1"
FT                   /translation="MTTAQAFQPELLLAGGSLHEGAALSVKDGVVAAVGPPLPGFERVP
FT                   LPGRILVPGFVSAHGHSFQRALRGRTEARGGQAGRSDFWSWRSAMYAAARRLDPDRLEA
FT                   VARFAFFELARAGVTCAGEFHYLHLDPDGRPYADPCELELRVVRAARAVGLRIVLLRAA
FT                   YARAGAGTEPDPAQRRFVEPSPEVFLERLEHLARQFRNDDGVRVGIAPHSVRACPPEWL
FT                   SALAGAARARDLPLHVHAAEQPAEVAACRAEHGRSPVQLLADAGALEARTTLVHAIHLD
FT                   DADVAAIGRAGATVCACPLTERNLGDGVVPADRLVAAGARLALGVDAHAEADPLGEARA
FT                   LELQLRLVRGERAVLDGPPGALAARLFDAATAGGMASLGLEGGRLAVGEPADFVLLDVD
FT                   DPSIAGGERDALLPSLVFGAQPGAVRSTFVAGQPVVEDGWAPPGRPTGADLLADFRAAM
FT                   RALWGGA"
FT   gene            663416..664216
FT                   /locus_tag="Adeh_0570"
FT   CDS_pept        663416..664216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0570"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80346"
FT                   /db_xref="GOA:Q2ING7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80346.1"
FT                   /translation="MMRRVPLPFVKYHGLGNDFVVVDGPLMDAARARRICDRRRGVGAD
FT                   GVLTVLPPRTAGAAATMHIFNSDGSVAAMCGNGIRCVARHLADARGLDGDLVLDTDSGP
FT                   KRCTIHRGPGGAVEAVSVEMGPARLEGEQEYRVGGEALRALRVSMGNPHAVLFDAPERA
FT                   RALAVGPELERLVPGGVNVGFARPGPSGIDLVVWERGAGLTDACGTGACAAAVASVSRG
FT                   LARAGVPVEVRLPGGALAITVAPDLVGVTMRGPAERAFTGETDL"
FT   gene            664217..666085
FT                   /locus_tag="Adeh_0571"
FT   CDS_pept        664217..666085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0571"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80347"
FT                   /db_xref="GOA:Q2ING6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80347.1"
FT                   /translation="MANGRILVVDDERFFQELFRDVLAGAGHAVRTSSSAEEALEVLAA
FT                   ERVDLLLTDMVMPGLDGLGLIREARRRDPELEVVAVTGREDVKLAVESMKAGCSDFLTK
FT                   PLEPGELLRVAERVLARVRLRREHSQLLTENLEFVKAQALYRQGLQILATLDGERLVDL
FT                   ALSVLARTTDAQGAALWVADEKGQLALRGYRGLVDRAALPVRVDPRDPAFADALRGGAP
FT                   FQAPEGWGGEAFLVPLVADDEPLGLALLSDRARGRFGRDEHAAALMVADFAAIAVKNAR
FT                   RFQAVERVGLRDRETGAYNLSYFVDYAGKEFYKARRYGRAFSLVVLSVDNVEQLRKEAG
FT                   REPFRRLMRDLVAAVGRAVRDADILAKVSESEYYVLLPETDYFGALMFVRRATEEVRRE
FT                   ASVRTMEERVPVLLSIGAGSFPKDGEDFDELLHWARDRVQDQRGSLLRRLHLGDLEPGA
FT                   FWELTDVLLSGSARLPDSSASARLQPDPELFAAAQREAAREIARDPRARGLLYVGLRSA
FT                   LAASPVRAALPAGDPAARAGDPSARVYLLGPRGTDVEAAPHPLVTEVYVDGDQRFAGHE
FT                   FLLFLSERSAYALLSGPDGRTFHTSDMPLVDALVSKLQTAYDLQPI"
FT   gene            666098..667564
FT                   /locus_tag="Adeh_0572"
FT   CDS_pept        666098..667564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0572"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80348"
FT                   /db_xref="GOA:Q2ING5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80348.1"
FT                   /translation="MATVRKILVADPDPATVRALAPVLRQRGYQVHAARDGSRALQAAI
FT                   LRFPDLILLDEDCPLLDARSFVRILRTNPRTERIPVVITGASSDPDRSRLGLYLRKPFN
FT                   LDEVLARVEQVFRRAEASRAVSGDGREIEGNLAQIPLVDLLQILSVNKKSGTLTVEREG
FT                   DRASIALAEGRVVDAAMGAVVGEKALFRLLTHREGQFAFLPGLPPAAQRIDRRVEELVL
FT                   EGLRQADEVARLLPELPAPEDGVELAVHPSEIPAGLHPVTEEVLGLLQSGAARPFQELL
FT                   DRCRATDLEAMRAVGALLEHGYARRREALAPEPRGQLLAPHELHALRARIARGRSSGPQ
FT                   TVGKVVVAGGGPLARRAALSRFQAVPGFRPEPEPPAGGFGTVGRVTLADGVRVDLAELP
FT                   GDRALMPLWRPFAAGAVGALVLLPADGIDPLLEELVKVQRLPVVVCGPSEARVPEVLRE
FT                   APGGFAFEGSDAAEGLRALLAGAGARGPLV"
FT   gene            667574..668374
FT                   /locus_tag="Adeh_0573"
FT   CDS_pept        667574..668374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0573"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80349"
FT                   /db_xref="GOA:Q2ING4"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80349.1"
FT                   /translation="MRIPIWQVDAFVTDGVFTGNPAAVCPLDAWLPDATLLAIAAENAL
FT                   SETAFLVAEGEGWHLRWFTPEVEVELCGHATLASAHVVFEHLARGRDAIAFRTQAGTLT
FT                   VTRDAAGRIALSLPRRPPAPADAPPALVRALGGRAPEATLLGRDYLAVLATEQEVRELR
FT                   PDLAAVSELPGHGIVVTAPASTPGVDFVSRYFAPQVGIPEDPVTGSAHCTLVPYWADRL
FT                   GRRTLEALQVSRRGGRLSCEDQPDAGKVRLAGRAAEFLSGSIEA"
FT   gene            complement(668402..668719)
FT                   /locus_tag="Adeh_0574"
FT   CDS_pept        complement(668402..668719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80350.1"
FT                   /translation="MADFVIRAVERLREDPGFSRNRYFLALSSPEGKRALRIHRHLRSL
FT                   EHDLSDGATATVARDAERVRLTLRGKRGARTAWLTRAEYRLLLTSPVARAALAAAELEP
FT                   G"
FT   gene            complement(668818..669252)
FT                   /locus_tag="Adeh_0575"
FT   CDS_pept        complement(668818..669252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0575"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80351"
FT                   /db_xref="GOA:Q2INH0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80351.1"
FT                   /translation="MALHWTSVLSIGVPELDAEHEEMFTRMDRLHDAILSGERAEVSRM
FT                   IEYLREHAVRHLAAEETLMLAIGYPDRERHLREHEAFLATVRELTRRHDANGPTAVLVH
FT                   DVERAVASWIDGHVGIHDVALGAFAREHLRRRQGGERRPA"
FT   gene            complement(669411..670832)
FT                   /locus_tag="Adeh_0576"
FT   CDS_pept        complement(669411..670832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0576"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80352"
FT                   /db_xref="GOA:Q2ING9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80352.1"
FT                   /translation="MRRSSRQVRVKRRKDAPEKRGGAFRVALPRARVAARVRRAQEDWG
FT                   EVHRTVLPNGLRVLTAQAPGLHSAMIALYVRAGSRHETEARNGVSHFLEHLFFRGSVGY
FT                   PDTVAMNAEVEAAGGSLNGITARDHGCYYTPIHPEEVGTGLAVLGDLIRRPLLKEMDVE
FT                   REVILEEILDEVDASGRDIDPDNLSKKIVFGRHPLGFKIAGTQDIVRRLRPRDVRAHLE
FT                   RFYTGANLVLAVAGPVRPDQVADLAERHLGRLPRGQLSVDLPAPGWPEGPRLEMVEHDD
FT                   AQAEFSLSFPCPPERHPDYPAHMCLRRILDDGLSSRLPFEIVERRGLAYSLHAGIDTFA
FT                   DAGMTVIDGACAPAKLPRVIEEVLRVLGGLAERPVPEEELLRVQRRHRMTLAFSLDSAA
FT                   DLAGWYGAGEVLSAPEGFEERCRRVEQVTAADLLRVSRETFRRRNLVAVVVGPSRRRER
FT                   AAVERVVHGTDALPR"
FT   gene            complement(670829..672379)
FT                   /locus_tag="Adeh_0577"
FT   CDS_pept        complement(670829..672379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0577"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80353"
FT                   /db_xref="GOA:Q2ING8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80353.1"
FT                   /translation="MRRVATKIFLTFAVALAAFAAVAGFGVARLHDLRRDLRTLSSGYI
FT                   PLTRIAAQLDVKDWVTARALEARVLDPAARRAYLPVARAHFPALVREKIEEGKRVAAGA
FT                   RIDASGDDARFLGDVLARLDGLAARWADYDREARALLDALEAGAGMGPGAAAFDARVAA
FT                   VRQLEKGLSLDVKLLQVALETQIADRVHDAERTEGNTVALTVIYSLLALAVGVGAAAIS
FT                   QRLLAPIQTLTEGVKAVAAGDLTRKVEARGRDEISVLAHEFNAMAASLDRQRAELLRAE
FT                   RLAAVGRISAQITHEIRNPLNAIGLNAELLAEEIAALPAPPAEATGLVSAISREVDRLN
FT                   AVTEEYLRFARLPRPQLERHDLNEILGGLLDFLGPELAAARVDVHRALAPGLPGVRCDE
FT                   GQLRAVFLNLLRNSREAMPGGGTVRVVTRRVDSGAGVEVELGDTGGGIPPGDLTRIFEP
FT                   FYSTKERGTGLGLAFTQQVVEEHGGTIRCESTVGRGTVFTLRFPAIEDRVEHEVGAAT"
FT   sig_peptide     complement(672308..672379)
FT                   /locus_tag="Adeh_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.526 at
FT                   residue 24"
FT   gene            672547..673416
FT                   /locus_tag="Adeh_0578"
FT   CDS_pept        672547..673416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0578"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80354.1"
FT                   /translation="MTGLALVVALVGIAIAVLSYRSASAARAALAARTAEDVKRGEELE
FT                   AARKAERAARAEAKERRDEATAVKAELERSKKKAFEQQEAAKKAGGAQALRVELDKLAA
FT                   RLAEARAEAEHQTTRARALEKELEKAAAAVKRLEARPAVAAAPAPAPVAPVPQAAAPAA
FT                   PAVDDGRLAAEKDRADKAEAKLAEARKRVADLEKDVKNVRGRLETEKRVYIVQKSELEL
FT                   AGDRYAELRRRHEALRKDHDELVEAVRQAAREERRLTQQEAARAEAATPPAAPEGEGEG
FT                   DAGGSSAA"
FT   sig_peptide     672547..672624
FT                   /locus_tag="Adeh_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.471 at
FT                   residue 26"
FT   gene            complement(673577..674203)
FT                   /locus_tag="Adeh_0579"
FT   CDS_pept        complement(673577..674203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80355"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80355.1"
FT                   /translation="MAGLGLGPPDFALFELGDPDERARALDEELQPKLLALGVQCNSGL
FT                   ARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVR
FT                   GDSPRRAGMQRALEREAANLARKGKPFRKLREFLEWNHEELPELAPAHSAAFWLEMGEA
FT                   LAPGGPGLDLGIAWSQEEARSIALGDLLGVFRDLAPLYKVLANAE"
FT   gene            674284..675288
FT                   /locus_tag="Adeh_0580"
FT   CDS_pept        674284..675288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0580"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80356.1"
FT                   /translation="MQKDQRLLDLAALLLKAAEPVSWREIQEQFPEDYGGKGEAAIRKF
FT                   ERDKADLLELGIPVRYASGDEDLPAGYLIDRDEFYLPDLKLPPEDLALLYLAGSAALAT
FT                   GAFPYARDLAHALNKLSFAARAPGASEAAAVAARRLGEGDGGAPRVAPTVEELSRAIAL
FT                   KKRVRLAYLGAERRERTEREVDPYGLFQRGGAWFLVGWCHLRRDLRTFHVSRIESLTVN
FT                   ASAPRTPDFKPLQEFSLADHATREAWEYAVHAPVRCKARLEPPVSAEVLASFGPRARVR
FT                   EDGGATLVEVDATNGEGFLRHVLALGDRAELLAPKALRERARAVLDRLAEELA"
FT   gene            675285..676388
FT                   /locus_tag="Adeh_0581"
FT   CDS_pept        675285..676388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0581"
FT                   /product="transcriptional regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80357"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80357.1"
FT                   /translation="MSAAGSKRRPAGARAKVSSKAPARAKPGAKPAAKPVRGPARAPSR
FT                   AAAGAPAAPKKADPRDRLRRVLFLVPYAVRHPGIPVRDLARRCGCTEKELLEDLDFLLE
FT                   VGSPPFAPDDFLDLYVEGDRVYVALHQSFSRPPRFTESEAAALAAAAAALGGEGRERAV
FT                   KALRDSVPRDRRASFDELVERIYAGAPPARDSVLGRLQRAIAERRAVRLAYHSASRDAE
FT                   TDRTVRPYTLAQRFGHWYLYGHDAERGKALAFRLDRIRECTLLPDRFEPPTEAELARAR
FT                   LFSEAAGEPVRIRLGAEAAPWALSRPGISLVERTPGGGAVVEVAGAGNDWATRFALSLG
FT                   GGAEVVAPAAARRAFAETVRRTLARYA"
FT   gene            676444..676953
FT                   /locus_tag="Adeh_0582"
FT   CDS_pept        676444..676953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0582"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80358"
FT                   /db_xref="GOA:Q2INH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80358.1"
FT                   /translation="MTQGRPTAGDPPENRGPAPGTRDASRRRQGVGGAVAQVLIVDDTD
FT                   IVRRAIELALRRMGHAAVSTCDAGEALALARRNPPDLALLDFRMPGMDGATLFQELRAA
FT                   LGERCPRVLFVSASPPDEVAREVERIAPAAGYVRKPFHLDDLVRAVGEALQPDGPPRRA
FT                   LAEGSP"
FT   gene            complement(676966..677847)
FT                   /locus_tag="Adeh_0583"
FT   CDS_pept        complement(676966..677847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0583"
FT                   /product="NAD-binding 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80359"
FT                   /db_xref="GOA:Q2INI0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80359.1"
FT                   /translation="MRLRIGFIGLGTMGEPIANNLRRAGHDLTVWNRTPARAEHIVSRG
FT                   GKRAATPRECASGRDAVFTCVSDERALDAVLDGPDGALAGLREGDVLVDLTTAGVACAR
FT                   AVAARVAERGARFVACPILGSRTAAEQAQVVLVAGGPAAARERLRPALHAISARLFELD
FT                   DPAQAALMKLCVNAIGGAMMTAFGEALALASAGGVEPSRLVEVLQASAFHSPLYLVKGE
FT                   LVQKQDWAPRFRIALAEKDQRLAQEAAAELGARVPVSEAVRTLMAAATEGGRGDQDVAA
FT                   LAALYLDWMRKR"
FT   gene            678020..679222
FT                   /locus_tag="Adeh_0584"
FT   CDS_pept        678020..679222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0584"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80360"
FT                   /db_xref="GOA:Q2INH9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80360.1"
FT                   /translation="MADVIVVGAGISGLAFAWKAGQAGRQVLVLERDRRVGGCLHSERR
FT                   PDGFWFEMGAHTVYNSYGAFLDIAVGGGVAGKIVQRGPARGSFGLLRDGTYRWLTPPKV
FT                   LLQLNWLEAAVHFPAGMFRKKEGETVYSYYSRLLGRGNYDRVISPFFAAVPSQKADGFP
FT                   LEGAGSLFKKRPRREEFVRSFGFDGGLQLVADAAARSKGVTVETGVEVRRVARTAGGFA
FT                   VTTADGRTLEAPLVAVAAPPDAAAAMLEDDFHELATGIRRVGTVRVDSMGVVLPRAECW
FT                   MPECAFLVPVDDLFFSCVTRDPFPDPRMRAFAFHFRDGVSREQRLKRMSEVLRVPVERL
FT                   GTPVERRTTLPSPALGHAGIVAELDRCLAGGKLAVTGNYFAGLAIEDCVLRSNDEWKRV
FT                   G"
FT   gene            complement(679223..680257)
FT                   /locus_tag="Adeh_0585"
FT   CDS_pept        complement(679223..680257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80361"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80361.1"
FT                   /translation="MRRPPLVLAAALLAGSTGCVAHMPRSDEPTMLLERSYVGASTASG
FT                   QSFEAAPAFHVLLHNGLDDPEVFDHGGWASALSASFLATLRVSRGDSAPVRTPTYEPRA
FT                   KLQLFRLDPAGARPAPSAPRPWMRMAVLELGGGHRSNGQRGCSLDEHVRRPGDGDWECA
FT                   AATDPPSTALNLDDGSFTTNYVAGGAYLRLLRTGDQPGAFTSAVTVGGGLEYEVACALG
FT                   ACMPQGMRRRFGPVNARYLAEWEALVLRGRTRRLPLFGTVHLDSSVRATLSGNVHLGAA
FT                   RGPFGDLSAEVAILPRNPKGMVMGLFVRRHLGYDYLNIRFEERLDAWLFGLVLDPTPLD
FT                   GARR"
FT   sig_peptide     complement(680192..680257)
FT                   /locus_tag="Adeh_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 22"
FT   gene            complement(680328..680819)
FT                   /locus_tag="Adeh_0586"
FT   CDS_pept        complement(680328..680819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0586"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80362"
FT                   /db_xref="GOA:Q2INH7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2INH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80362.1"
FT                   /translation="MTSADRRRDAVARIIRARRIGTQEELLAALERAGFRATQATLSRD
FT                   LARLGARRVSGPEGAVYELGADGADGADGGLAALRGLVSSIAANASMVVIRTHPGSAPA
FT                   IARAIDLAQPPEVLGTIAGDDTIFVAPAGELRPRRLAARLAELLGTPSALAGEGGDRTH
FT                   "
FT   gene            complement(680816..682912)
FT                   /locus_tag="Adeh_0587"
FT   CDS_pept        complement(680816..682912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0587"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80363"
FT                   /db_xref="GOA:Q2INI4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80363.1"
FT                   /translation="MRIPKGFRFGGVACGLKPQRRDLALVVSDHPAAAAGLFTINKAAA
FT                   APVLDARTRVPAEGIRAIVVNSGNANALTGPAGLDDVTVIRSAVADALGIQKRAVLTAS
FT                   TGVIGARLPAMKVVTAMPALVDQLGDHPDLAAEAIMTTDTRPKMAAREVTLGGKTAIVT
FT                   AICKGSGMLAPQLATTICLLVTDAAVTPRALQDALARAVHRTLEMVTVDGEMSTNDTVY
FT                   ALANGLAGNPRISDPGPDLDRLETALSDLLEEMARAMAADGEGATKLVEVVVSGAPSDE
FT                   AARDCARAVASSPLVKAALFGADPNWGRVLATVGARAGAMSYPIDPYRARVVLQGVTVF
FT                   EGGAPVELDREMLRTRMRDSRIDVLVELADGAARAVAWGCDLSYDYVKINADYTSLIVQ
FT                   RPDGGVGKDDRVSNYSPAFKRTLLAEALKYIAAFSGQVAVIKYGGAAMVKDSLKAAFAE
FT                   DVTLLKKVGLKPVVVHGGAPEITRTLEKLGERSEFVDGMRITDAQSLPVVEMVLTGKVN
FT                   QELVALLNARSAGAVGLSGKDGQLLRARKAVHESGRDLGYVGEVVEVNTKFLRMFLDGG
FT                   YVPVISPIGLTEEGTGLSINADDVAAAIAVALGAPKLIYLTDVPGVLESAPDGQLVRQL
FT                   TLADLDRRIQAGAITGGMKWKAWAIQTALRGGVGRVHVLDGRQPHTVIAELFTDRGVGS
FT                   LVTA"
FT   gene            complement(682915..683952)
FT                   /locus_tag="Adeh_0588"
FT   CDS_pept        complement(682915..683952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0588"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80364"
FT                   /db_xref="GOA:Q2INI3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80364.1"
FT                   /translation="MHSHSAAVIGASGYSGLELTRLLARHPHARLTSIYSDRWSGERAG
FT                   ARLPLPGPAASLAYLPLAEGEAADADVVFLATPAEVSAELVPRLLARGAKLVVDLSGAF
FT                   RLTDPAAYPAWYGFTHPAPELLAEARYGCPELGREALAGARLVTNPGCYATTIALALAP
FT                   LVRSGVASPDGIAVTGLSGVSGAGRKSSEDYSFVEVSDDLRAYRLGRHQHVPEIEQTVA
FT                   RHAGACGPISFSPVLVPIRRGILATAVLRPAPGATQADVAAALERAYGDEPFVSVRAPD
FT                   RVMVKDVVHTNRCHVGAALDPRAGALVAVSAIDNLVKGAAGQAVQSMNVALGWPEAAGL
FT                   DLLGG"
FT   gene            complement(684121..684204)
FT                   /gene="tRNA-Leu5"
FT                   /locus_tag="Adeh_R0006"
FT   tRNA            complement(684121..684204)
FT                   /gene="tRNA-Leu5"
FT                   /locus_tag="Adeh_R0006"
FT                   /product="tRNA-Leu"
FT   gene            684635..685522
FT                   /locus_tag="Adeh_0589"
FT   CDS_pept        684635..685522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80365"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80365.1"
FT                   /translation="MLATVAALHLVLAAPGTLLAQANPGDAPFGGNPPLPEKGKRSPAP
FT                   PPGAMLPPPPPPSQDAPAGTPTDAPPPEARPAPAAAPARPPPARYEAAPAPAAPAPSAV
FT                   GRAPLRSLLSAEPLGGGSAVEVEAGWPSLGAMYGQGLTRIDDLGALASLDWAKTELRLG
FT                   GWYRRGLGRSSGLDVAARLAVAWYANFGGTWIDSKNHTDRGLEVAPGLALSRRAGGGVA
FT                   SALGELPLVFTVRHDAGLLFLPRVTFAYEAPFYGDFTLGARAGVGVRAGAGDAPLKETR
FT                   GELTFLIVGGFRAF"
FT   sig_peptide     684635..684697
FT                   /locus_tag="Adeh_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.664 at
FT                   residue 21"
FT   gene            complement(685748..687745)
FT                   /locus_tag="Adeh_0590"
FT   CDS_pept        complement(685748..687745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0590"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80366"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80366.1"
FT                   /translation="MRFRTALAAAAIALSAACSGSSGSSGPSGGPPPAPLTVVEVVPAD
FT                   GATGVSPSAPVRVTFSEAVDPATLQGAIAVAGATGTVTVSGAVATFTPAVLVGDTTYAA
FT                   RVAAGVRSLAGGALAADHAWSFTTGANRAPVAVAGADQDVATGAPVALDASGSVDPDGA
FT                   GLEYAWTQVAGPDVTGGAGALHGPAPAFTAPAEVSTLVFDLTVRDGQSESAPDRTVVTV
FT                   LRNPAAALFVAPGGDDTAAGTRAAPLATLRVAIERLGGPGGAVPGAGVYAAAGTYFGPV
FT                   VLASGVSLYGGFDPATWLRDAAAPSVIGNSLRGVVVTGATGVVVDGFTLAAGDAISPGF
FT                   SSFGAFLVDSEVTFSRCAIAAGNGQAGAAGGAGVEGAPGNAGGAGGGGSCDGATVGAGG
FT                   AAGLGAWSGGPGGAGGAEGANAGRNGSSGGGANGGASGGGGAYGKPGQRGQDGATGGDG
FT                   FQGLNGAPGGGFGALLPLPDAYRTSDGFGGGTGGDGFGGGGGGGGGGQGPCGFLECDEG
FT                   SGNGGGGGGSGGRLGTGGGGGRGGGASLGVVVVRGAVVLRDTSVRAGNGGAGGAGGAGG
FT                   LGGPGGRGGAGGATCTGEVGGGGNGGAGGRGGDGGWGGGGGGGPSVALLNEGGAVTVEG
FT                   ASTLTPGAGGAGGAAARPGAQGVSHARWDR"
FT   sig_peptide     complement(687674..687745)
FT                   /locus_tag="Adeh_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.456 at
FT                   residue 24"
FT   gene            complement(688031..689446)
FT                   /locus_tag="Adeh_0591"
FT   CDS_pept        complement(688031..689446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0591"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region/Thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80367"
FT                   /db_xref="GOA:Q2INI8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80367.1"
FT                   /translation="MRFAIRILLAALTFAAVAWIPDLIGLGPAGGSSDLRLGALLAEGS
FT                   ILAFAVAFAGGVATSLTPCVYPLIPITVSIFGARKAGSRGEAMAVSALYVLGIAAMYSA
FT                   LGVGAALTGKAFGSVMQNPWVIGFVAIVLAAMAASMFGAFELQLPPSLQARLNGVGGAG
FT                   RAGAFAMGLVSGIIAAPCTGPVLAAALTFVAAKGSVAFGFGIMFAYALGMGLLFFLIGA
FT                   FSISLPKSGAWMETVKSVFGVALLAAALIFLKDAFPALKPLFSAARGAAFAAAGAAALG
FT                   VLAGALSGSFHAPARQRLAKGLGVALLVGGIAYAAGAAGARERARAHAGFAWIHSEEEA
FT                   LALAKAEGRPVIIDFWADWCTACKELDKIAWAKPEVQEEAARFVAVKLDGTDGSDAFNA
FT                   LAEKYGVVGMPTVIFIDPRGREVPDRVMGAISAGEMVQKLRAVDGACEGKPPPATPAAV
FT                   QGEQVAMACAARW"
FT   sig_peptide     complement(689390..689446)
FT                   /locus_tag="Adeh_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.983 at
FT                   residue 19"
FT   gene            689605..690819
FT                   /locus_tag="Adeh_0592"
FT   CDS_pept        689605..690819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0592"
FT                   /product="cysteine desulfurase IscS"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80368"
FT                   /db_xref="GOA:Q2INI7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2INI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80368.1"
FT                   /translation="MKIPIYMDYHATTPVDPRVLEAMLPYFTTEYGNAASKSHAFGWKA
FT                   EEAVEAAREEVAKLIGASAKEIVWTSGATESDNLAVKGAAHFYQAKGKHLVTCKTEHKA
FT                   VLDSMHALERQGFEVTFLEPERDGRLDPAKVKAALRPDTILVSVMHANNETGVVHPIAE
FT                   IGRIAREAGVVFHCDAVQSIGKIPFDVEAMNVDLASISAHKMYGPKGVGALYVRRKPRV
FT                   RLVAEMDGGGHERGFRSGTLNVPGIVGMGKAAELARLERDAEAVRVTALRERLRKGLEQ
FT                   ELDLLTVNGSLEHRVPGNLNVSFAYVEGEALMMAVKDVAVSSGSACTSASLEPSYVLRA
FT                   MGVSEDLAHSSIRFGLGRFSTEEEVDYAIRLFGEKVRKLREMSPLYEMVKDGVDLNQIE
FT                   WANPH"
FT   gene            690876..691337
FT                   /locus_tag="Adeh_0593"
FT   CDS_pept        690876..691337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0593"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80369"
FT                   /db_xref="GOA:Q2INI6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80369.1"
FT                   /translation="MAYSEKLIDHYEHPRNVGSLDKNDPDVGTGLVGAPACGDVMKLQI
FT                   KVSDDGIIEDAKFKTFGCGSAIASSSLVTEWVKGRTVEEALTIKNTDVANELNLPPVKI
FT                   HCSVLAEDAIKAAVADWQKKHGREPSVKPNTVQGDRSALIEKGVLKSGI"
FT   gene            691350..691682
FT                   /locus_tag="Adeh_0594"
FT   CDS_pept        691350..691682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0594"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80370"
FT                   /db_xref="GOA:Q2INI5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80370.1"
FT                   /translation="M