(data stored in SCRATCH3701 zone)

EMBL: CP000259

ID   CP000259; SV 1; circular; genomic DNA; STD; PRO; 1836467 BP.
XX
AC   CP000259;
XX
PR   Project:PRJNA16363;
XX
DT   08-MAY-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Streptococcus pyogenes MGAS9429, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes MGAS9429
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
OS   Streptococcus phage 9429.1
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 9429.2
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 9428.3
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-1836467
RX   DOI; 10.1073/pnas.0510279103.
RX   PUBMED; 16636287.
RA   Beres S.B., Richter E.W., Nagiec M.J., Sumby P., Porcella S.F., DeLeo F.R.,
RA   Musser J.M.;
RT   "Molecular genetic anatomy of inter- and intraserotype variation in the
RT   human bacterial pathogen group A Streptococcus";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(18):7059-7064(2006).
XX
RN   [2]
RP   1-1836467
RA   Beres S.B., Sumby P., Porcella S.F., Richter E.W., Barbian K.D.,
RA   DeLeo F.R., Musser J.M.;
RT   ;
RL   Submitted (06-FEB-2006) to the INSDC.
RL   Laboratory of Human Bacterial Pathogenesis, Rocky Mountain Laboratories,
RL   National Institute of Allergy and Infectious Disease, National Institutes
RL   of Health, 903 S. 4th Street, Hamilton, MT 59840, USA
XX
DR   MD5; a9ba50ca0f03a5e5a0aab012b262a50c.
DR   BioSample; SAMN02603501.
DR   EnsemblGenomes-Gn; EBG00001136810.
DR   EnsemblGenomes-Gn; EBG00001136811.
DR   EnsemblGenomes-Gn; EBG00001136812.
DR   EnsemblGenomes-Gn; EBG00001136813.
DR   EnsemblGenomes-Gn; EBG00001136814.
DR   EnsemblGenomes-Gn; EBG00001136815.
DR   EnsemblGenomes-Gn; EBG00001136816.
DR   EnsemblGenomes-Gn; EBG00001136817.
DR   EnsemblGenomes-Gn; EBG00001136818.
DR   EnsemblGenomes-Gn; EBG00001136819.
DR   EnsemblGenomes-Gn; EBG00001136820.
DR   EnsemblGenomes-Gn; EBG00001136821.
DR   EnsemblGenomes-Gn; EBG00001136822.
DR   EnsemblGenomes-Gn; EBG00001136823.
DR   EnsemblGenomes-Gn; EBG00001136824.
DR   EnsemblGenomes-Gn; EBG00001136825.
DR   EnsemblGenomes-Gn; EBG00001136826.
DR   EnsemblGenomes-Gn; EBG00001136827.
DR   EnsemblGenomes-Gn; EBG00001136828.
DR   EnsemblGenomes-Gn; EBG00001136829.
DR   EnsemblGenomes-Gn; EBG00001136830.
DR   EnsemblGenomes-Gn; EBG00001136831.
DR   EnsemblGenomes-Gn; EBG00001136832.
DR   EnsemblGenomes-Gn; EBG00001136833.
DR   EnsemblGenomes-Gn; EBG00001136834.
DR   EnsemblGenomes-Gn; EBG00001136835.
DR   EnsemblGenomes-Gn; EBG00001136836.
DR   EnsemblGenomes-Gn; EBG00001136837.
DR   EnsemblGenomes-Gn; EBG00001136838.
DR   EnsemblGenomes-Gn; EBG00001136839.
DR   EnsemblGenomes-Gn; EBG00001136840.
DR   EnsemblGenomes-Gn; EBG00001136841.
DR   EnsemblGenomes-Gn; EBG00001136842.
DR   EnsemblGenomes-Gn; EBG00001136843.
DR   EnsemblGenomes-Gn; EBG00001136844.
DR   EnsemblGenomes-Gn; EBG00001136845.
DR   EnsemblGenomes-Gn; EBG00001136846.
DR   EnsemblGenomes-Gn; EBG00001136847.
DR   EnsemblGenomes-Gn; EBG00001136848.
DR   EnsemblGenomes-Gn; EBG00001136849.
DR   EnsemblGenomes-Gn; EBG00001136850.
DR   EnsemblGenomes-Gn; EBG00001136851.
DR   EnsemblGenomes-Gn; EBG00001136852.
DR   EnsemblGenomes-Gn; EBG00001136853.
DR   EnsemblGenomes-Gn; EBG00001136854.
DR   EnsemblGenomes-Gn; EBG00001136855.
DR   EnsemblGenomes-Gn; EBG00001136856.
DR   EnsemblGenomes-Gn; EBG00001136857.
DR   EnsemblGenomes-Gn; EBG00001136858.
DR   EnsemblGenomes-Gn; EBG00001136859.
DR   EnsemblGenomes-Gn; EBG00001136860.
DR   EnsemblGenomes-Gn; EBG00001136861.
DR   EnsemblGenomes-Gn; EBG00001136862.
DR   EnsemblGenomes-Gn; EBG00001136863.
DR   EnsemblGenomes-Gn; EBG00001136864.
DR   EnsemblGenomes-Gn; EBG00001136865.
DR   EnsemblGenomes-Gn; EBG00001136866.
DR   EnsemblGenomes-Gn; EBG00001136867.
DR   EnsemblGenomes-Gn; EBG00001136868.
DR   EnsemblGenomes-Gn; EBG00001136869.
DR   EnsemblGenomes-Gn; EBG00001136870.
DR   EnsemblGenomes-Gn; EBG00001136871.
DR   EnsemblGenomes-Gn; EBG00001136872.
DR   EnsemblGenomes-Gn; EBG00001136873.
DR   EnsemblGenomes-Gn; EBG00001136874.
DR   EnsemblGenomes-Gn; EBG00001136875.
DR   EnsemblGenomes-Gn; EBG00001136876.
DR   EnsemblGenomes-Gn; EBG00001136877.
DR   EnsemblGenomes-Gn; EBG00001136878.
DR   EnsemblGenomes-Gn; EBG00001136879.
DR   EnsemblGenomes-Gn; EBG00001136880.
DR   EnsemblGenomes-Gn; EBG00001136881.
DR   EnsemblGenomes-Gn; EBG00001136882.
DR   EnsemblGenomes-Gn; EBG00001136883.
DR   EnsemblGenomes-Gn; EBG00001136884.
DR   EnsemblGenomes-Gn; EBG00001136885.
DR   EnsemblGenomes-Gn; EBG00001136886.
DR   EnsemblGenomes-Gn; EBG00001136887.
DR   EnsemblGenomes-Gn; EBG00001136888.
DR   EnsemblGenomes-Gn; EBG00001136889.
DR   EnsemblGenomes-Gn; EBG00001136890.
DR   EnsemblGenomes-Gn; EBG00001136891.
DR   EnsemblGenomes-Gn; EBG00001136892.
DR   EnsemblGenomes-Gn; EBG00001136893.
DR   EnsemblGenomes-Gn; EBG00001136894.
DR   EnsemblGenomes-Gn; EBG00001136895.
DR   EnsemblGenomes-Gn; EBG00001136896.
DR   EnsemblGenomes-Gn; EBG00001136897.
DR   EnsemblGenomes-Gn; EBG00001136898.
DR   EnsemblGenomes-Gn; EBG00001136899.
DR   EnsemblGenomes-Gn; EBG00001136900.
DR   EnsemblGenomes-Gn; EBG00001136901.
DR   EnsemblGenomes-Gn; EBG00001136902.
DR   EnsemblGenomes-Gn; EBG00001136903.
DR   EnsemblGenomes-Gn; EBG00001136904.
DR   EnsemblGenomes-Gn; EBG00001136905.
DR   EnsemblGenomes-Gn; EBG00001136906.
DR   EnsemblGenomes-Gn; EBG00001136907.
DR   EnsemblGenomes-Gn; EBG00001136908.
DR   EnsemblGenomes-Gn; EBG00001136909.
DR   EnsemblGenomes-Gn; EBG00001136910.
DR   EnsemblGenomes-Gn; EBG00001136911.
DR   EnsemblGenomes-Gn; EBG00001136912.
DR   EnsemblGenomes-Gn; EBG00001136913.
DR   EnsemblGenomes-Gn; EBG00001136914.
DR   EnsemblGenomes-Gn; EBG00001136915.
DR   EnsemblGenomes-Gn; EBG00001136916.
DR   EnsemblGenomes-Gn; EBG00001136917.
DR   EnsemblGenomes-Gn; EBG00001136918.
DR   EnsemblGenomes-Gn; EBG00001136919.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0001.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0002.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0003.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0004.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0005.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0006.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0007.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0008.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0009.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0010.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0011.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0012.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0013.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0014.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0015.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0016.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0017.
DR   EnsemblGenomes-Gn; MGAS9429_SpyR0018.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0001.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0002.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0003.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0004.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0005.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0006.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0007.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0008.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0009.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0010.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0011.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0012.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0013.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0014.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0015.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0016.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0017.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0018.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0019.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0020.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0021.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0022.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0023.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0024.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0025.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0026.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0027.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0028.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0029.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0030.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0031.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0032.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0033.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0034.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0035.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0036.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0037.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0038.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0039.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0040.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0041.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0042.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0043.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0044.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0045.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0046.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0047.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0048.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0049.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0050.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0051.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0052.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0053.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0054.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0055.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0056.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0057.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0058.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0059.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0060.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0061.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0062.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0063.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0064.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0065.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0066.
DR   EnsemblGenomes-Gn; MGAS9429_SpyT0067.
DR   EnsemblGenomes-Tr; EBT00001727575.
DR   EnsemblGenomes-Tr; EBT00001727576.
DR   EnsemblGenomes-Tr; EBT00001727577.
DR   EnsemblGenomes-Tr; EBT00001727578.
DR   EnsemblGenomes-Tr; EBT00001727579.
DR   EnsemblGenomes-Tr; EBT00001727580.
DR   EnsemblGenomes-Tr; EBT00001727581.
DR   EnsemblGenomes-Tr; EBT00001727582.
DR   EnsemblGenomes-Tr; EBT00001727583.
DR   EnsemblGenomes-Tr; EBT00001727584.
DR   EnsemblGenomes-Tr; EBT00001727585.
DR   EnsemblGenomes-Tr; EBT00001727586.
DR   EnsemblGenomes-Tr; EBT00001727587.
DR   EnsemblGenomes-Tr; EBT00001727588.
DR   EnsemblGenomes-Tr; EBT00001727589.
DR   EnsemblGenomes-Tr; EBT00001727590.
DR   EnsemblGenomes-Tr; EBT00001727591.
DR   EnsemblGenomes-Tr; EBT00001727592.
DR   EnsemblGenomes-Tr; EBT00001727593.
DR   EnsemblGenomes-Tr; EBT00001727594.
DR   EnsemblGenomes-Tr; EBT00001727595.
DR   EnsemblGenomes-Tr; EBT00001727596.
DR   EnsemblGenomes-Tr; EBT00001727597.
DR   EnsemblGenomes-Tr; EBT00001727598.
DR   EnsemblGenomes-Tr; EBT00001727599.
DR   EnsemblGenomes-Tr; EBT00001727600.
DR   EnsemblGenomes-Tr; EBT00001727601.
DR   EnsemblGenomes-Tr; EBT00001727602.
DR   EnsemblGenomes-Tr; EBT00001727603.
DR   EnsemblGenomes-Tr; EBT00001727604.
DR   EnsemblGenomes-Tr; EBT00001727605.
DR   EnsemblGenomes-Tr; EBT00001727606.
DR   EnsemblGenomes-Tr; EBT00001727607.
DR   EnsemblGenomes-Tr; EBT00001727608.
DR   EnsemblGenomes-Tr; EBT00001727609.
DR   EnsemblGenomes-Tr; EBT00001727610.
DR   EnsemblGenomes-Tr; EBT00001727611.
DR   EnsemblGenomes-Tr; EBT00001727612.
DR   EnsemblGenomes-Tr; EBT00001727613.
DR   EnsemblGenomes-Tr; EBT00001727614.
DR   EnsemblGenomes-Tr; EBT00001727615.
DR   EnsemblGenomes-Tr; EBT00001727616.
DR   EnsemblGenomes-Tr; EBT00001727617.
DR   EnsemblGenomes-Tr; EBT00001727618.
DR   EnsemblGenomes-Tr; EBT00001727619.
DR   EnsemblGenomes-Tr; EBT00001727620.
DR   EnsemblGenomes-Tr; EBT00001727621.
DR   EnsemblGenomes-Tr; EBT00001727622.
DR   EnsemblGenomes-Tr; EBT00001727623.
DR   EnsemblGenomes-Tr; EBT00001727624.
DR   EnsemblGenomes-Tr; EBT00001727625.
DR   EnsemblGenomes-Tr; EBT00001727626.
DR   EnsemblGenomes-Tr; EBT00001727627.
DR   EnsemblGenomes-Tr; EBT00001727628.
DR   EnsemblGenomes-Tr; EBT00001727629.
DR   EnsemblGenomes-Tr; EBT00001727630.
DR   EnsemblGenomes-Tr; EBT00001727631.
DR   EnsemblGenomes-Tr; EBT00001727632.
DR   EnsemblGenomes-Tr; EBT00001727633.
DR   EnsemblGenomes-Tr; EBT00001727634.
DR   EnsemblGenomes-Tr; EBT00001727635.
DR   EnsemblGenomes-Tr; EBT00001727636.
DR   EnsemblGenomes-Tr; EBT00001727637.
DR   EnsemblGenomes-Tr; EBT00001727638.
DR   EnsemblGenomes-Tr; EBT00001727639.
DR   EnsemblGenomes-Tr; EBT00001727640.
DR   EnsemblGenomes-Tr; EBT00001727641.
DR   EnsemblGenomes-Tr; EBT00001727642.
DR   EnsemblGenomes-Tr; EBT00001727643.
DR   EnsemblGenomes-Tr; EBT00001727644.
DR   EnsemblGenomes-Tr; EBT00001727645.
DR   EnsemblGenomes-Tr; EBT00001727646.
DR   EnsemblGenomes-Tr; EBT00001727647.
DR   EnsemblGenomes-Tr; EBT00001727648.
DR   EnsemblGenomes-Tr; EBT00001727649.
DR   EnsemblGenomes-Tr; EBT00001727650.
DR   EnsemblGenomes-Tr; EBT00001727651.
DR   EnsemblGenomes-Tr; EBT00001727652.
DR   EnsemblGenomes-Tr; EBT00001727653.
DR   EnsemblGenomes-Tr; EBT00001727654.
DR   EnsemblGenomes-Tr; EBT00001727655.
DR   EnsemblGenomes-Tr; EBT00001727656.
DR   EnsemblGenomes-Tr; EBT00001727657.
DR   EnsemblGenomes-Tr; EBT00001727658.
DR   EnsemblGenomes-Tr; EBT00001727659.
DR   EnsemblGenomes-Tr; EBT00001727660.
DR   EnsemblGenomes-Tr; EBT00001727661.
DR   EnsemblGenomes-Tr; EBT00001727662.
DR   EnsemblGenomes-Tr; EBT00001727663.
DR   EnsemblGenomes-Tr; EBT00001727664.
DR   EnsemblGenomes-Tr; EBT00001727665.
DR   EnsemblGenomes-Tr; EBT00001727666.
DR   EnsemblGenomes-Tr; EBT00001727667.
DR   EnsemblGenomes-Tr; EBT00001727668.
DR   EnsemblGenomes-Tr; EBT00001727669.
DR   EnsemblGenomes-Tr; EBT00001727670.
DR   EnsemblGenomes-Tr; EBT00001727671.
DR   EnsemblGenomes-Tr; EBT00001727672.
DR   EnsemblGenomes-Tr; EBT00001727673.
DR   EnsemblGenomes-Tr; EBT00001727674.
DR   EnsemblGenomes-Tr; EBT00001727675.
DR   EnsemblGenomes-Tr; EBT00001727676.
DR   EnsemblGenomes-Tr; EBT00001727677.
DR   EnsemblGenomes-Tr; EBT00001727678.
DR   EnsemblGenomes-Tr; EBT00001727679.
DR   EnsemblGenomes-Tr; EBT00001727680.
DR   EnsemblGenomes-Tr; EBT00001727681.
DR   EnsemblGenomes-Tr; EBT00001727682.
DR   EnsemblGenomes-Tr; EBT00001727683.
DR   EnsemblGenomes-Tr; EBT00001727684.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0001-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0002-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0003-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0004-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0005-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0006-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0007-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0008-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0009-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0010-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0011-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0012-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0013-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0014-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0015-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0016-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0017-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyR0018-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0001-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0002-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0003-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0004-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0005-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0006-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0007-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0008-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0009-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0010-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0011-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0012-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0013-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0014-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0015-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0016-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0017-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0018-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0019-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0020-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0021-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0022-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0023-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0024-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0025-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0026-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0027-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0028-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0029-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0030-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0031-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0032-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0033-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0034-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0035-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0036-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0037-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0038-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0039-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0040-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0041-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0042-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0043-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0044-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0045-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0046-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0047-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0048-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0049-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0050-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0051-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0052-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0053-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0054-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0055-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0056-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0057-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0058-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0059-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0060-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0061-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0062-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0063-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0064-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0065-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0066-1.
DR   EnsemblGenomes-Tr; MGAS9429_SpyT0067-1.
DR   EuropePMC; PMC1459018; 16636287.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1949102; 17726530.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2824700; 20067631.
DR   EuropePMC; PMC2863612; 20145082.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3034890; 21103900.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3411356; 21115137.
DR   EuropePMC; PMC4125623; 22615319.
DR   EuropePMC; PMC4502227; 26173696.
DR   EuropePMC; PMC4914681; 27067338.
DR   EuropePMC; PMC5605940; 28928212.
DR   EuropePMC; PMC6374595; 30760615.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; CP000259.
DR   SILVA-SSU; CP000259.
DR   StrainInfo; 692592; 0.
XX
CC   Sequence finishing work performed at Integrated Genomics, Inc.,
CC   2201 W. Campbell Park Dr., Chicago, IL 60612 USA.
CC   Bacterial Source:
CC   James M. Musser, M.D., Ph.D.
CC   Fondren Foundation Distinguished Endowed Chair
CC   Executive Vice President and Co-Director
CC   Director, Center for Molecular and Translational Human Infectious
CC   Diseases Research
CC   Vice-Chair, Department of Pathology
CC   The Methodist Hospital Research Institute
CC   6565 Fannin Street, B154
CC   Houston, Texas 77030
CC   tel:  (713) 441-5890
CC   fax:  (713) 790-6460
CC   e-mail:  jmmusser@tmh.tmc.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..529556,571400..779263,818805..1379657,
FT                   1420476..1836467)
FT                   /organism="Streptococcus pyogenes MGAS9429"
FT                   /focus
FT                   /strain="MGAS9429"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370551"
FT   source          529557..571399
FT                   /organism="Streptococcus phage 9429.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370556"
FT   source          779264..818804
FT                   /organism="Streptococcus phage 9429.2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370557"
FT   source          1379658..1420475
FT                   /organism="Streptococcus phage 9428.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370558"
FT   gene            202..1557
FT                   /gene="dnaA"
FT                   /locus_tag="MGAS9429_Spy0001"
FT   CDS_pept        202..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MGAS9429_Spy0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31189"
FT                   /db_xref="GOA:Q1JP60"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP60"
FT                   /protein_id="ABF31189.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1712..2848
FT                   /gene="dnaN"
FT                   /locus_tag="MGAS9429_Spy0002"
FT   CDS_pept        1712..2848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MGAS9429_Spy0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31190"
FT                   /db_xref="GOA:Q1JP59"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP59"
FT                   /protein_id="ABF31190.1"
FT                   /translation="MIQFSINRTLFIHALNATKRAISTKNAIPILSSIKIEVTSTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            2923..3120
FT                   /locus_tag="MGAS9429_Spy0003"
FT   CDS_pept        2923..3120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0003"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31191"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP58"
FT                   /protein_id="ABF31191.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   gene            3450..4565
FT                   /locus_tag="MGAS9429_Spy0004"
FT   CDS_pept        3450..4565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0004"
FT                   /product="GTP-binding protein, probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31192"
FT                   /db_xref="GOA:Q1JP57"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP57"
FT                   /protein_id="ABF31192.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNILQKIKPVLEDGKSARTIEFTEDEAKVVKGLFLLTTKPVLYVANVDEGKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMAYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4590..5204
FT                   /gene="pth"
FT                   /locus_tag="MGAS9429_Spy0005"
FT   CDS_pept        4590..5204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="MGAS9429_Spy0005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31193"
FT                   /db_xref="GOA:Q1JP56"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP56"
FT                   /protein_id="ABF31193.1"
FT                   /translation="MEEHSSPFGILERENMVKMIVGLGNPGSKYEKTKHNIGFMAIDNI
FT                   VKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLI
FT                   VIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHV
FT                   MGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5207..8710
FT                   /gene="trcF"
FT                   /locus_tag="MGAS9429_Spy0006"
FT   CDS_pept        5207..8710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="MGAS9429_Spy0006"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31194"
FT                   /db_xref="GOA:Q1JP55"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP55"
FT                   /protein_id="ABF31194.1"
FT                   /translation="MNILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKALAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSGLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFHPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFTDNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYKRLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EREIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQIGSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVRKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQIFYVYNKVDTIEKKVSELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYISDERQKIDIYKRIREIQSREDYLN
FT                   LQDELIDRFGEYPDQVAYLLEIALLKHYMDNAFAELVERKNNQVIVRFEVTSLTYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYRILEELMLFGERLSEIKIRKNNSVF
FT                   K"
FT   gene            8848..9144
FT                   /locus_tag="MGAS9429_Spy0007"
FT   CDS_pept        8848..9144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0007"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31195"
FT                   /db_xref="GOA:Q1JP54"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP54"
FT                   /protein_id="ABF31195.1"
FT                   /translation="MKRIVGEIMRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKS
FT                   STNIKLNDHIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9131..9502
FT                   /gene="divIC"
FT                   /locus_tag="MGAS9429_Spy0008"
FT   CDS_pept        9131..9502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="MGAS9429_Spy0008"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31196"
FT                   /db_xref="GOA:Q1JP53"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP53"
FT                   /protein_id="ABF31196.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKRTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9499..9624
FT                   /locus_tag="MGAS9429_Spy0009"
FT   CDS_pept        9499..9624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31197"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP52"
FT                   /protein_id="ABF31197.1"
FT                   /translation="MMMDNIVKKIEAFLAFSDKKLAELQQENQKVKEESQYIQKN"
FT   gene            9637..10923
FT                   /locus_tag="MGAS9429_Spy0010"
FT   CDS_pept        9637..10923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0010"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31198"
FT                   /db_xref="GOA:Q1JP51"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP51"
FT                   /protein_id="ABF31198.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLLIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSFSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   gene            10920..12206
FT                   /gene="tilS"
FT                   /locus_tag="MGAS9429_Spy0011"
FT   CDS_pept        10920..12206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="MGAS9429_Spy0011"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31199"
FT                   /db_xref="GOA:Q1JP50"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP50"
FT                   /protein_id="ABF31199.1"
FT                   /translation="MMTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQHFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKEEKMLEYDSNLCYRDYCFSFMPKSNGDQGQV
FT                   SIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIIGEQDEQIIFV
FT                   LIGNKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12211..12753
FT                   /locus_tag="MGAS9429_Spy0012"
FT   CDS_pept        12211..12753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0012"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31200"
FT                   /db_xref="GOA:Q1JP49"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP49"
FT                   /protein_id="ABF31200.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   gene            12775..14754
FT                   /gene="ftsH"
FT                   /locus_tag="MGAS9429_Spy0013"
FT   CDS_pept        12775..14754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="MGAS9429_Spy0013"
FT                   /product="cell division protein"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31201"
FT                   /db_xref="GOA:Q1JP48"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP48"
FT                   /protein_id="ABF31201.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPKKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMIESESAE"
FT   gene            15012..16472
FT                   /locus_tag="MGAS9429_Spy0014"
FT   CDS_pept        15012..16472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0014"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31202"
FT                   /db_xref="GOA:Q1JP47"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP47"
FT                   /protein_id="ABF31202.1"
FT                   /translation="MKFTIITNYDTLSRKSFTIEGDNMTIFRKKKKYSNKTEMQRHFKV
FT                   IDLVFLGLGSMVGTGIFTVTGIGAAKYAGPALTISIIISAIAIGILALFYAEFASRMPS
FT                   NGGAYSYVYATLGEFPAWLVGWYIIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALN
FT                   GTFNLKNGTYIDILPVLVMFFVTGIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFI
FT                   DHNNWSHFAPYGVGQITGGKTGIFAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGII
FT                   LSLIIVTALYIVVTTILTGIVHYTKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITV
FT                   CISMTYALARTIYSISRDGLLPKSLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLA
FT                   EFVNICTLAYLIILSGAIIKLRRIEGEPKANEFKTPLVPFLPMLAIIICLSFMSQYKAF
FT                   TWIAFAIATIIGTLIYLAYGYTHSIENK"
FT   gene            16720..16875
FT                   /locus_tag="MGAS9429_Spy0015"
FT   CDS_pept        16720..16875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31203"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP46"
FT                   /protein_id="ABF31203.1"
FT                   /translation="MLFSSNIIEKQKHFVKKELTMTVKISYTNKAVREVPVTHLLKKDE
FT                   KVVDRL"
FT   gene            17056..18884
FT                   /locus_tag="MGAS9429_SpyR0001"
FT   rRNA            17056..18884
FT                   /locus_tag="MGAS9429_SpyR0001"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            18638..18713
FT                   /locus_tag="MGAS9429_SpyT0001"
FT   tRNA            18638..18713
FT                   /locus_tag="MGAS9429_SpyT0001"
FT                   /product="tRNA-Ala"
FT   gene            19009..21911
FT                   /locus_tag="MGAS9429_SpyR0002"
FT   rRNA            19009..21911
FT                   /locus_tag="MGAS9429_SpyR0002"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            21996..22112
FT                   /locus_tag="MGAS9429_SpyR0003"
FT   rRNA            21996..22112
FT                   /locus_tag="MGAS9429_SpyR0003"
FT                   /product="5S RNA"
FT   gene            22130..22202
FT                   /locus_tag="MGAS9429_SpyT0002"
FT   tRNA            22130..22202
FT                   /locus_tag="MGAS9429_SpyT0002"
FT                   /product="tRNA-Val"
FT   gene            22220..22292
FT                   /locus_tag="MGAS9429_SpyT0003"
FT   tRNA            22220..22292
FT                   /locus_tag="MGAS9429_SpyT0003"
FT                   /product="tRNA-Asp"
FT   gene            22324..22396
FT                   /locus_tag="MGAS9429_SpyT0004"
FT   tRNA            22324..22396
FT                   /locus_tag="MGAS9429_SpyT0004"
FT                   /product="tRNA-Lys"
FT   gene            22402..22483
FT                   /locus_tag="MGAS9429_SpyT0005"
FT   tRNA            22402..22483
FT                   /locus_tag="MGAS9429_SpyT0005"
FT                   /product="tRNA-Leu"
FT   gene            22494..22566
FT                   /locus_tag="MGAS9429_SpyT0006"
FT   tRNA            22494..22566
FT                   /locus_tag="MGAS9429_SpyT0006"
FT                   /product="tRNA-Thr"
FT   gene            22579..22650
FT                   /locus_tag="MGAS9429_SpyT0007"
FT   tRNA            22579..22650
FT                   /locus_tag="MGAS9429_SpyT0007"
FT                   /product="tRNA-Gly"
FT   gene            22659..22743
FT                   /locus_tag="MGAS9429_SpyT0008"
FT   tRNA            22659..22743
FT                   /locus_tag="MGAS9429_SpyT0008"
FT                   /product="tRNA-Leu"
FT   gene            22760..22836
FT                   /locus_tag="MGAS9429_SpyT0009"
FT   tRNA            22760..22836
FT                   /locus_tag="MGAS9429_SpyT0009"
FT                   /product="tRNA-Arg"
FT   gene            22840..22913
FT                   /locus_tag="MGAS9429_SpyT0010"
FT   tRNA            22840..22913
FT                   /locus_tag="MGAS9429_SpyT0010"
FT                   /product="tRNA-Pro"
FT   gene            23057..24885
FT                   /locus_tag="MGAS9429_SpyR0004"
FT   rRNA            23057..24885
FT                   /locus_tag="MGAS9429_SpyR0004"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            24639..24714
FT                   /locus_tag="MGAS9429_SpyT0011"
FT   tRNA            24639..24714
FT                   /locus_tag="MGAS9429_SpyT0011"
FT                   /product="tRNA-Ala"
FT   gene            25010..27912
FT                   /locus_tag="MGAS9429_SpyR0005"
FT   rRNA            25010..27912
FT                   /locus_tag="MGAS9429_SpyR0005"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            27997..28113
FT                   /locus_tag="MGAS9429_SpyR0006"
FT   rRNA            27997..28113
FT                   /locus_tag="MGAS9429_SpyR0006"
FT                   /product="5S RNA"
FT   gene            28131..28203
FT                   /locus_tag="MGAS9429_SpyT0012"
FT   tRNA            28131..28203
FT                   /locus_tag="MGAS9429_SpyT0012"
FT                   /product="tRNA-Val"
FT   gene            28221..28293
FT                   /locus_tag="MGAS9429_SpyT0013"
FT   tRNA            28221..28293
FT                   /locus_tag="MGAS9429_SpyT0013"
FT                   /product="tRNA-Asp"
FT   gene            28325..28397
FT                   /locus_tag="MGAS9429_SpyT0014"
FT   tRNA            28325..28397
FT                   /locus_tag="MGAS9429_SpyT0014"
FT                   /product="tRNA-Lys"
FT   gene            28403..28484
FT                   /locus_tag="MGAS9429_SpyT0015"
FT   tRNA            28403..28484
FT                   /locus_tag="MGAS9429_SpyT0015"
FT                   /product="tRNA-Leu"
FT   gene            28495..28567
FT                   /locus_tag="MGAS9429_SpyT0016"
FT   tRNA            28495..28567
FT                   /locus_tag="MGAS9429_SpyT0016"
FT                   /product="tRNA-Thr"
FT   gene            28580..28651
FT                   /locus_tag="MGAS9429_SpyT0017"
FT   tRNA            28580..28651
FT                   /locus_tag="MGAS9429_SpyT0017"
FT                   /product="tRNA-Gly"
FT   gene            28660..28744
FT                   /locus_tag="MGAS9429_SpyT0018"
FT   tRNA            28660..28744
FT                   /locus_tag="MGAS9429_SpyT0018"
FT                   /product="tRNA-Leu"
FT   gene            28761..28837
FT                   /locus_tag="MGAS9429_SpyT0019"
FT   tRNA            28761..28837
FT                   /locus_tag="MGAS9429_SpyT0019"
FT                   /product="tRNA-Arg"
FT   gene            28841..28914
FT                   /locus_tag="MGAS9429_SpyT0020"
FT   tRNA            28841..28914
FT                   /locus_tag="MGAS9429_SpyT0020"
FT                   /product="tRNA-Pro"
FT   gene            28920..28993
FT                   /locus_tag="MGAS9429_SpyT0021"
FT   tRNA            28920..28993
FT                   /locus_tag="MGAS9429_SpyT0021"
FT                   /product="tRNA-Met"
FT   gene            29014..29087
FT                   /locus_tag="MGAS9429_SpyT0022"
FT   tRNA            29014..29087
FT                   /locus_tag="MGAS9429_SpyT0022"
FT                   /product="tRNA-Met"
FT   gene            29113..29195
FT                   /pseudo
FT                   /locus_tag="MGAS9429_SpyT0023"
FT   tRNA            29113..29195
FT                   /pseudo
FT                   /locus_tag="MGAS9429_SpyT0023"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            29209..29282
FT                   /locus_tag="MGAS9429_SpyT0024"
FT   tRNA            29209..29282
FT                   /locus_tag="MGAS9429_SpyT0024"
FT                   /product="tRNA-Met"
FT   gene            29303..29375
FT                   /locus_tag="MGAS9429_SpyT0025"
FT   tRNA            29303..29375
FT                   /locus_tag="MGAS9429_SpyT0025"
FT                   /product="tRNA-Phe"
FT   gene            29388..29458
FT                   /locus_tag="MGAS9429_SpyT0026"
FT   tRNA            29388..29458
FT                   /locus_tag="MGAS9429_SpyT0026"
FT                   /product="tRNA-Gly"
FT   gene            29493..29566
FT                   /locus_tag="MGAS9429_SpyT0027"
FT   tRNA            29493..29566
FT                   /locus_tag="MGAS9429_SpyT0027"
FT                   /product="tRNA-Ile"
FT   gene            29576..29663
FT                   /locus_tag="MGAS9429_SpyT0028"
FT   tRNA            29576..29663
FT                   /locus_tag="MGAS9429_SpyT0028"
FT                   /product="tRNA-Ser"
FT   gene            complement(30140..30346)
FT                   /locus_tag="MGAS9429_Spy0016"
FT   CDS_pept        complement(30140..30346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0016"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31204"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP45"
FT                   /protein_id="ABF31204.1"
FT                   /translation="MRRHVKVITIGILSAHYYEITMLFLQAKIILDCFHIPQRLRQAIT
FT                   RFRIRIINTSAIKPIAYRTLKLY"
FT   gene            30843..32039
FT                   /gene="sibA"
FT                   /locus_tag="MGAS9429_Spy0017"
FT   CDS_pept        30843..32039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sibA"
FT                   /locus_tag="MGAS9429_Spy0017"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31205"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP44"
FT                   /protein_id="ABF31205.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINVLLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLVAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   ASPSARPQVSYSSVNNYPVGQCTWGAKSLAPWAGNNWGNGGQWAASAQAAGYSVGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSSSNIRVMESNYSGKQYIADHRGWFNPTGVTFIYPH"
FT   gene            32280..33254
FT                   /gene="prsA2"
FT                   /locus_tag="MGAS9429_Spy0018"
FT   CDS_pept        32280..33254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA2"
FT                   /locus_tag="MGAS9429_Spy0018"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31206"
FT                   /db_xref="GOA:Q1JP43"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP43"
FT                   /protein_id="ABF31206.1"
FT                   /translation="MEEKMSYSDLKLFALSSNKELAEKVASAMGLQLGKSTVRQFSDGE
FT                   IQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQD
FT                   RKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDR
FT                   HGLVGEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGK
FT                   KCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLD
FT                   TIYLPKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            33440..34195
FT                   /gene="recO"
FT                   /locus_tag="MGAS9429_Spy0019"
FT   CDS_pept        33440..34195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="MGAS9429_Spy0019"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31207"
FT                   /db_xref="GOA:Q1JP42"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP42"
FT                   /protein_id="ABF31207.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            34220..35305
FT                   /gene="plsX"
FT                   /locus_tag="MGAS9429_Spy0020"
FT   CDS_pept        34220..35305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="MGAS9429_Spy0020"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31208"
FT                   /db_xref="GOA:Q1JP41"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP41"
FT                   /protein_id="ABF31208.1"
FT                   /translation="MVSEYAIIKILLIDCVRTQDIIKGVEMKRIAIDAMGGDNAPKAIV
FT                   EGVNQAIEAFSDIEIQLYGDQTKINSYLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKA
FT                   SMVLAAKAVKEGKADAIISAGNTGALLAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDM
FT                   LDLGANAENTAKHLHQYAILGSFYAKNVRGIANPRVGLLNNGTEETKGDPLRKATYELL
FT                   TADNTISFVGNVEARELMSGVADVIVSDGFTGNAVLKSIEGTAISIMGQLKQIINSGGI
FT                   KTKIGASLLKSSLYEMKKTLDYSSAGGAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTM
FT                   LDTNVVGQLVEEFAKETQVND"
FT   gene            35298..35540
FT                   /gene="acpP2"
FT                   /locus_tag="MGAS9429_Spy0021"
FT   CDS_pept        35298..35540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP2"
FT                   /locus_tag="MGAS9429_Spy0021"
FT                   /product="acyl-carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31209"
FT                   /db_xref="GOA:Q1JP40"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP40"
FT                   /protein_id="ABF31209.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHLAIPDEDVEDMVFMGDVLDYLVQRLT"
FT   gene            35661..36395
FT                   /locus_tag="MGAS9429_Spy0022"
FT   CDS_pept        35661..36395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0022"
FT                   /product="phosphoribosylamidoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31210"
FT                   /db_xref="GOA:Q1JP39"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP39"
FT                   /protein_id="ABF31210.1"
FT                   /translation="MKTERKANNQVTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLN
FT                   GARKETIDGKGALNNQISSLIFEKLNKAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRN
FT                   VIAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGE
FT                   TRRINELLKGWFAQIGLNLIDFKLEFGFDQEGTIILADEFSPDNCRLWDKNGNHMDKDV
FT                   FRRDLGNLTDVYQVVLEKLIAL"
FT   gene            36471..40244
FT                   /locus_tag="MGAS9429_Spy0023"
FT   CDS_pept        36471..40244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0023"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31211"
FT                   /db_xref="GOA:Q1JP38"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP38"
FT                   /protein_id="ABF31211.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKALRIVQVYDVFNLAEDLLARAEKHIFSEQVTDCLLTETEITAELDKVAFFAIES
FT                   LPGQFDQRAVSSQEALLLFGSDSQVKVNTAQFYLVNKDIAEAELEAVKNYLLNPVDSRF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFETYKADDFTAYKVEQGLAMEVDDLLFIQDYFKSI
FT                   GRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRAGKLPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRAGNVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPSD
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNDETIVDLERRFLDTNGVRVVVDAKVVD
FT                   KDLTVPEARITSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTTTASVMAQGYNAYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPT
FT                   LVAFGVTTADSRKILSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFEAIQTQHKI
FT                   TAASAVKYGGVLESFALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQTDVLEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEVAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGGLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSPWLAGVEVGDIHAIPVSHGEG
FT                   KFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   gene            40348..41859
FT                   /gene="purF"
FT                   /locus_tag="MGAS9429_Spy0024"
FT   CDS_pept        40348..41859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="MGAS9429_Spy0024"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31212"
FT                   /db_xref="GOA:Q1JP37"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP37"
FT                   /protein_id="ABF31212.1"
FT                   /translation="MCEKLSIFALLDSLCIEVKMTYEVKSLNEECGVFGIWGHPQAAQV
FT                   TYFGLHSLQHRGQEGAGIVSNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRY
FT                   ATAGSADIRNIQPFLYKFHDGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMH
FT                   LIRRSHNSSFMGKVKEALNTVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVI
FT                   SSETCAFEVVGAKWVRDVEPGEVILIDDRGIQCDRYTDETQLAICSMEYVYFARPDSTI
FT                   HGVNVHTVRKNMGKRLAQEFKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYT
FT                   QRTFIQPTQELREQGVRMKLSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASE
FT                   VHVAIASPELKYPCFYGIDIQTRRELISANHAADEVCDIIGADSLTYLSLDGLIESIGL
FT                   ETKAPNGGLCVAYFDGHYPTPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            41887..42936
FT                   /gene="purM"
FT                   /locus_tag="MGAS9429_Spy0025"
FT   CDS_pept        41887..42936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="MGAS9429_Spy0025"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31213"
FT                   /db_xref="GOA:Q1JP36"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP36"
FT                   /protein_id="ABF31213.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVREPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLEP
FT                   LYFLEPLYFLDYVATGKNNPVKFEEVVSGVAEGCVQAGAALIGGETAEMPGMYGEDDYD
FT                   LAGFAVGVAEKSQLIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELE
FT                   GKQLKDVLLEPTRIYVRAALPLIKEELVNGIGHITGGGFIENVPRMFADDLAAEIDEDK
FT                   VPVLPIFKALEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIK
FT                   KADDSVVIK"
FT   gene            43104..43658
FT                   /gene="purN"
FT                   /locus_tag="MGAS9429_Spy0026"
FT   CDS_pept        43104..43658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="MGAS9429_Spy0026"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31214"
FT                   /db_xref="GOA:Q1JP35"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP35"
FT                   /protein_id="ABF31214.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLTGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            43842..45389
FT                   /locus_tag="MGAS9429_Spy0027"
FT   CDS_pept        43842..45389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0027"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31215"
FT                   /db_xref="GOA:Q1JP34"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP34"
FT                   /protein_id="ABF31215.1"
FT                   /translation="MTKRALISVSDKSGIVDFAKELKNLGWDIISTGGTKVALDNAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNLYP
FT                   FKETILRPDITYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADAGQT
FT                   TFETRQRLAAKVFRHTAAYDALIAEYFTTQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVVLKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAKKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQDSIDAANKHGLTMIFTGVRHFRH"
FT   gene            complement(45447..46571)
FT                   /locus_tag="MGAS9429_Spy0028"
FT   CDS_pept        complement(45447..46571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0028"
FT                   /product="autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31216"
FT                   /db_xref="GOA:Q1JP33"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP33"
FT                   /protein_id="ABF31216.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQASFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKVVTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYFTVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            46677..48089
FT                   /gene="purD"
FT                   /locus_tag="MGAS9429_Spy0029"
FT   CDS_pept        46677..48089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="MGAS9429_Spy0029"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31217"
FT                   /db_xref="GOA:Q1JP32"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP32"
FT                   /protein_id="ABF31217.1"
FT                   /translation="MANRVFLISRIVVYYHIFTMFQLLITNTLCKKANVYDIISNYNTK
FT                   EVDVLKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLDLVNIVVSEHSRL
FT                   IAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKY
FT                   NVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLAVGKGVVVAETVEQAVEAAQEMLLD
FT                   NKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAY
FT                   APVPHLPQSVVDTAVETIVKPVLEGMIAEGRPYLGVLYAGLILTADGPKVIEFNSRFGD
FT                   PETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEGYPLDYEKGVPLPE
FT                   KTDGDIITYYAGVKFAENSELLLSNGGRVYMLVTTEDSVKAGQDKIYTQLAQQDPTGLF
FT                   YRNDIGSKAIRE"
FT   gene            48367..48858
FT                   /gene="purE"
FT                   /locus_tag="MGAS9429_Spy0030"
FT   CDS_pept        48367..48858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="MGAS9429_Spy0030"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   carboxyltransferase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31218"
FT                   /db_xref="GOA:Q1JP31"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP31"
FT                   /protein_id="ABF31218.1"
FT                   /translation="MKTPIISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPD
FT                   LMFKHAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIV
FT                   QMPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSGELI
FT                   "
FT   gene            48809..49918
FT                   /gene="purK"
FT                   /locus_tag="MGAS9429_Spy0031"
FT   CDS_pept        48809..49918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="MGAS9429_Spy0031"
FT                   /product="phosphoribosylaminoimidazole carboxylase NCAIR
FT                   mutase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31219"
FT                   /db_xref="GOA:Q1JP30"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP30"
FT                   /protein_id="ABF31219.1"
FT                   /translation="MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITL
FT                   DPANDCPAARVSEVIVAPYDDVEALGQLAARCDVLTYEFENVDADGLDAVVSAGQLPQG
FT                   TDLLRISQNRIVEKDFLTNKAGVTVAPYKVVTSSLDLEGLDLTKTYVLKTATGGYDGHG
FT                   QKVIRSAEDLPEAQQLANSAQCVLEEFVNFDLEISVIVSGNGQDVTVFPVQENIHRNNI
FT                   LSKTIVPARISDQLADKAKKMAVQIAKKLQLSGTLCVEMFATADDIIVNEIAPRPHNSG
FT                   HYSIEACDFSQFDTHILGVLGAPLPTIHLHAPAVMLNVLGQHVQQAIDYVTENPSAHLH
FT                   MYGKLEAKHNRKMGHVTVFAEDADEVEEF"
FT   gene            49939..51279
FT                   /locus_tag="MGAS9429_Spy0032"
FT   CDS_pept        49939..51279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0032"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31220"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP29"
FT                   /protein_id="ABF31220.1"
FT                   /translation="MELREFKAWLLKNHFEEDELYKESIKCYQVEAYKAAYIFSYLANH
FT                   KFIAKLAIDYSGVPSNFMSKCPDDEVRKSSWQKRVNSLKNEDEWEQTVNEKLIQAWEGD
FT                   NVFKLPFKIKEKYSHMRVLRNNAAHAKDCRISESTVLELWNEIEYIYPYFVINGTIDAW
FT                   MEDLEKLVRYSNSSIESQNQLQNKFGDFSTENKTLIVKKIIQKYLVDSEWDETYPDIVM
FT                   NFLLYIFQESNYINQIGKDLTEKEELYLSIGTGIYHFQAEAIDIYSQFEESLSDYTFRY
FT                   FCEEFSDNFWKFIDSMDSEVNKENLTATSLEILKKNSAILVNAEFNESRFLSDNSLFFK
FT                   SVLDKIKHLYYYTMHHTGQRHHNTNTFDYSKFNSYIPYINYIFYRISSNPGLKEDEKVI
FT                   DFVKRCNNLISSDYSAESWYSERQMQDVIKKINEKYTILEDSGRESD"
FT   gene            complement(51280..51438)
FT                   /locus_tag="MGAS9429_Spy0033"
FT   CDS_pept        complement(51280..51438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31221"
FT                   /db_xref="GOA:Q1JP28"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP28"
FT                   /protein_id="ABF31221.1"
FT                   /translation="MYFLKFCELRKSVACIQFSEYDYLCFFLFFNLISLAFRMSKLDFL
FT                   NSLPNLI"
FT   gene            51648..52940
FT                   /gene="purB"
FT                   /locus_tag="MGAS9429_Spy0034"
FT   CDS_pept        51648..52940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="MGAS9429_Spy0034"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31222"
FT                   /db_xref="GOA:Q1JP27"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP27"
FT                   /protein_id="ABF31222.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQDTRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEQYVCYKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDIKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFKRLGI"
FT   gene            53074..53985
FT                   /locus_tag="MGAS9429_Spy0035"
FT   CDS_pept        53074..53985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0035"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31223"
FT                   /db_xref="GOA:Q1JP26"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP26"
FT                   /protein_id="ABF31223.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLIL
FT                   LELYLAYLDIEGMDGQYSDKIFYDSLLDNLSEQFEQFELDELFIVNKIIIDISSLSLKN
FT                   NRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKQKDIIKAEQSFMKACLFAQ
FT                   MTADQYLENKLIQEWEKDVKSY"
FT   gene            54139..55209
FT                   /gene="ruvB"
FT                   /locus_tag="MGAS9429_Spy0036"
FT   CDS_pept        54139..55209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="MGAS9429_Spy0036"
FT                   /product="holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31224"
FT                   /db_xref="GOA:Q1JP25"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP25"
FT                   /protein_id="ABF31224.1"
FT                   /translation="MLLTGGDYNKSRPLLSFTLCYNSPMARILDNDVMGNEEFSDRTLR
FT                   PQYLREYIGQDKVKEQFAIFIEAAKRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNL
FT                   KQTSGPAVEKAGDLVAILNELEPGDILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAG
FT                   DTSRSIHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYQEKDLTEIVERTATIFE
FT                   IKIDHEAARKLACRSRGTPRIANRLLKRVRDYAQIIGDGIITAQITDRALTMLDVDREG
FT                   LDYIDQKILRTMIEMYQGGPVGLGTLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRV
FT                   ATQKAYRHLGYPYQNT"
FT   gene            55347..55784
FT                   /locus_tag="MGAS9429_Spy0037"
FT   CDS_pept        55347..55784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0037"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31225"
FT                   /db_xref="GOA:Q1JP24"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP24"
FT                   /protein_id="ABF31225.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGK
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMNKEY"
FT   gene            55808..56209
FT                   /locus_tag="MGAS9429_Spy0038"
FT   CDS_pept        55808..56209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0038"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31226"
FT                   /db_xref="GOA:Q1JP23"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP23"
FT                   /protein_id="ABF31226.1"
FT                   /translation="MINMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRMHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            56206..57981
FT                   /locus_tag="MGAS9429_Spy0039"
FT   CDS_pept        56206..57981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0039"
FT                   /product="acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31227"
FT                   /db_xref="GOA:Q1JP22"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP22"
FT                   /protein_id="ABF31227.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLFWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMFIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGTLALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPNGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   gene            58291..60933
FT                   /gene="adh2"
FT                   /locus_tag="MGAS9429_Spy0040"
FT   CDS_pept        58291..60933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh2"
FT                   /locus_tag="MGAS9429_Spy0040"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="acetaldehyde dehydrogenase [acetylating]"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31228"
FT                   /db_xref="GOA:Q1JP21"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP21"
FT                   /protein_id="ABF31228.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALAEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWIAEQAGFTVPEGTNILAAEC
FT                   KEVSENEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAVNLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   gene            61128..62201
FT                   /gene="adhA"
FT                   /locus_tag="MGAS9429_Spy0041"
FT   CDS_pept        61128..62201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="MGAS9429_Spy0041"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31229"
FT                   /db_xref="GOA:Q1JP20"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP20"
FT                   /protein_id="ABF31229.1"
FT                   /translation="MYNLFVTDYKKVIIRWRTDMKAVVVNQASTGVEVVEHDLPNVGHG
FT                   KALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAW
FT                   FFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSI
FT                   TCGGVPTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELA
FT                   KEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGL
FT                   PSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGAEGLVVPIVEKVPVDTAPEVFD
FT                   EMERGLIQGRKVLDFIS"
FT   gene            62589..63878
FT                   /locus_tag="MGAS9429_Spy0042"
FT   CDS_pept        62589..63878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0042"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31230"
FT                   /db_xref="GOA:Q1JP19"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JP19"
FT                   /protein_id="ABF31230.1"
FT                   /translation="MIYNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEASVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPATAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   gene            64077..64385
FT                   /gene="rpsJ"
FT                   /locus_tag="MGAS9429_Spy0043"
FT   CDS_pept        64077..64385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="MGAS9429_Spy0043"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31231"
FT                   /db_xref="GOA:Q1JP18"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP18"
FT                   /protein_id="ABF31231.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGAKVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            64633..65259
FT                   /gene="rplC"
FT                   /locus_tag="MGAS9429_Spy0044"
FT   CDS_pept        64633..65259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="MGAS9429_Spy0044"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31232"
FT                   /db_xref="GOA:Q1JP17"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP17"
FT                   /protein_id="ABF31232.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILIKGNVPGAKKSLITIKSAVKAAK"
FT   gene            65283..65906
FT                   /gene="rplD"
FT                   /locus_tag="MGAS9429_Spy0045"
FT   CDS_pept        65283..65906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="MGAS9429_Spy0045"
FT                   /product="LSU ribosomal protein L1E (L4P)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31233"
FT                   /db_xref="GOA:Q1JP16"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP16"
FT                   /protein_id="ABF31233.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   gene            65906..66202
FT                   /gene="rplW"
FT                   /locus_tag="MGAS9429_Spy0046"
FT   CDS_pept        65906..66202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="MGAS9429_Spy0046"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31234"
FT                   /db_xref="GOA:Q1JP15"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP15"
FT                   /protein_id="ABF31234.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            66220..67053
FT                   /gene="rplB"
FT                   /locus_tag="MGAS9429_Spy0047"
FT   CDS_pept        66220..67053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="MGAS9429_Spy0047"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31235"
FT                   /db_xref="GOA:Q1JP14"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP14"
FT                   /protein_id="ABF31235.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            67139..67471
FT                   /gene="rpsS"
FT                   /locus_tag="MGAS9429_Spy0048"
FT   CDS_pept        67139..67471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="MGAS9429_Spy0048"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31236"
FT                   /db_xref="GOA:Q1JP13"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP13"
FT                   /protein_id="ABF31236.1"
FT                   /translation="MLLNSSRCGTLFKGENYKMGRSLKKGPFVDEHLMKKVEAQANDEK
FT                   KKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAAD
FT                   DKKTRR"
FT   gene            67487..67831
FT                   /gene="rplV"
FT                   /locus_tag="MGAS9429_Spy0049"
FT   CDS_pept        67487..67831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="MGAS9429_Spy0049"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31237"
FT                   /db_xref="GOA:Q1JP12"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP12"
FT                   /protein_id="ABF31237.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            67844..68497
FT                   /gene="rpsC"
FT                   /locus_tag="MGAS9429_Spy0050"
FT   CDS_pept        67844..68497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="MGAS9429_Spy0050"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31238"
FT                   /db_xref="GOA:Q1JP11"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP11"
FT                   /protein_id="ABF31238.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            68501..68914
FT                   /gene="rplP"
FT                   /locus_tag="MGAS9429_Spy0051"
FT   CDS_pept        68501..68914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="MGAS9429_Spy0051"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31239"
FT                   /db_xref="GOA:Q1JP10"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP10"
FT                   /protein_id="ABF31239.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            68924..69130
FT                   /gene="rpmC"
FT                   /locus_tag="MGAS9429_Spy0052"
FT   CDS_pept        68924..69130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="MGAS9429_Spy0052"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31240"
FT                   /db_xref="GOA:Q1JP09"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP09"
FT                   /protein_id="ABF31240.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            69156..69416
FT                   /gene="rpsQ"
FT                   /locus_tag="MGAS9429_Spy0053"
FT   CDS_pept        69156..69416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="MGAS9429_Spy0053"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31241"
FT                   /db_xref="GOA:Q1JP08"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP08"
FT                   /protein_id="ABF31241.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            69441..69809
FT                   /gene="rplN"
FT                   /locus_tag="MGAS9429_Spy0054"
FT   CDS_pept        69441..69809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="MGAS9429_Spy0054"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31242"
FT                   /db_xref="GOA:Q1JP07"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP07"
FT                   /protein_id="ABF31242.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            69888..70193
FT                   /gene="rplX"
FT                   /locus_tag="MGAS9429_Spy0055"
FT   CDS_pept        69888..70193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="MGAS9429_Spy0055"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31243"
FT                   /db_xref="GOA:Q1JP06"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP06"
FT                   /protein_id="ABF31243.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   gene            70217..70759
FT                   /gene="rplE"
FT                   /locus_tag="MGAS9429_Spy0056"
FT   CDS_pept        70217..70759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="MGAS9429_Spy0056"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31244"
FT                   /db_xref="GOA:Q1JP05"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP05"
FT                   /protein_id="ABF31244.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            70775..70960
FT                   /gene="rpsN"
FT                   /locus_tag="MGAS9429_Spy0057"
FT   CDS_pept        70775..70960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="MGAS9429_Spy0057"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31245"
FT                   /db_xref="GOA:Q1JP04"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP04"
FT                   /protein_id="ABF31245.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            71111..71509
FT                   /gene="rpsH"
FT                   /locus_tag="MGAS9429_Spy0058"
FT   CDS_pept        71111..71509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="MGAS9429_Spy0058"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31246"
FT                   /db_xref="GOA:Q1JP03"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP03"
FT                   /protein_id="ABF31246.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            71712..72248
FT                   /gene="rplF"
FT                   /locus_tag="MGAS9429_Spy0059"
FT   CDS_pept        71712..72248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="MGAS9429_Spy0059"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31247"
FT                   /db_xref="GOA:Q1JP02"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP02"
FT                   /protein_id="ABF31247.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            72344..72709
FT                   /gene="rplR"
FT                   /locus_tag="MGAS9429_Spy0060"
FT   CDS_pept        72344..72709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="MGAS9429_Spy0060"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31248"
FT                   /db_xref="GOA:Q1JP01"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP01"
FT                   /protein_id="ABF31248.1"
FT                   /translation="MKIVISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYA
FT                   QVIDDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYH
FT                   GRVKALADAARENGLKF"
FT   gene            72728..73222
FT                   /gene="rpsE"
FT                   /locus_tag="MGAS9429_Spy0061"
FT   CDS_pept        72728..73222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="MGAS9429_Spy0061"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31249"
FT                   /db_xref="GOA:Q1JP00"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JP00"
FT                   /protein_id="ABF31249.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            73237..73419
FT                   /gene="rpmD"
FT                   /locus_tag="MGAS9429_Spy0062"
FT   CDS_pept        73237..73419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="MGAS9429_Spy0062"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31250"
FT                   /db_xref="GOA:Q1JNZ9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ9"
FT                   /protein_id="ABF31250.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            73634..74074
FT                   /gene="rplO"
FT                   /locus_tag="MGAS9429_Spy0063"
FT   CDS_pept        73634..74074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="MGAS9429_Spy0063"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31251"
FT                   /db_xref="GOA:Q1JNZ8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ8"
FT                   /protein_id="ABF31251.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            74043..75395
FT                   /gene="secY"
FT                   /locus_tag="MGAS9429_Spy0064"
FT   CDS_pept        74043..75395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="MGAS9429_Spy0064"
FT                   /product="protein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31252"
FT                   /db_xref="GOA:Q1JNZ7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNZ7"
FT                   /protein_id="ABF31252.1"
FT                   /translation="MLKVVQSKSSNEGILIMFLKILKDALKIKTVRNKIFFTIFIILVF
FT                   RIGTHITVPGVNAKSLEQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLL
FT                   QMDILPKFVEWGKQGEVGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDI
FT                   KTYLLIGALLTTGSVIVTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVN
FT                   VKASDLHSSYLIVGILIIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVN
FT                   PAGVIPVIFASSITTIPSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFS
FT                   FFYTFVQVNPEKTAENLQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAP
FT                   IAAQQALNLSSSIALGGTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            75545..76183
FT                   /gene="adk"
FT                   /locus_tag="MGAS9429_Spy0065"
FT   CDS_pept        75545..76183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="MGAS9429_Spy0065"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /EC_number="2.7.4.6"
FT                   /note="nucleoside-diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31253"
FT                   /db_xref="GOA:Q1JNZ6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ6"
FT                   /protein_id="ABF31253.1"
FT                   /translation="MNLLIIGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLGLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            76247..76519
FT                   /gene="infA"
FT                   /locus_tag="MGAS9429_Spy0066"
FT   CDS_pept        76247..76519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="MGAS9429_Spy0066"
FT                   /product="bacterial protein translation initiation factor 1
FT                   (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31254"
FT                   /db_xref="GOA:Q1JNZ5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ5"
FT                   /protein_id="ABF31254.1"
FT                   /translation="MLPLCSEDIKSKFRGYFCVAKEDVIEIEGKVVETMPNAMFTVELE
FT                   NGHQILATVSGKIRKNYIRILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            76545..76661
FT                   /gene="rpmJ"
FT                   /locus_tag="MGAS9429_Spy0067"
FT   CDS_pept        76545..76661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="MGAS9429_Spy0067"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31255"
FT                   /db_xref="GOA:Q1JNZ4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ4"
FT                   /protein_id="ABF31255.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            76679..77044
FT                   /gene="rpsM"
FT                   /locus_tag="MGAS9429_Spy0068"
FT   CDS_pept        76679..77044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="MGAS9429_Spy0068"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31256"
FT                   /db_xref="GOA:Q1JNZ3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ3"
FT                   /protein_id="ABF31256.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            77062..77445
FT                   /gene="rpsK"
FT                   /locus_tag="MGAS9429_Spy0069"
FT   CDS_pept        77062..77445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="MGAS9429_Spy0069"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31257"
FT                   /db_xref="GOA:Q1JNZ2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ2"
FT                   /protein_id="ABF31257.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            77491..78429
FT                   /gene="rpoA"
FT                   /locus_tag="MGAS9429_Spy0070"
FT   CDS_pept        77491..78429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="MGAS9429_Spy0070"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31258"
FT                   /db_xref="GOA:Q1JNZ1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ1"
FT                   /protein_id="ABF31258.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            78444..78830
FT                   /gene="rplQ"
FT                   /locus_tag="MGAS9429_Spy0071"
FT   CDS_pept        78444..78830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="MGAS9429_Spy0071"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31259"
FT                   /db_xref="GOA:Q1JNZ0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNZ0"
FT                   /protein_id="ABF31259.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            complement(79426..79560)
FT                   /locus_tag="MGAS9429_Spy0072"
FT   CDS_pept        complement(79426..79560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31260"
FT                   /db_xref="GOA:Q1JK14"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JK14"
FT                   /protein_id="ABF31260.1"
FT                   /translation="MVRLIQFSKVLTSPKKQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            79668..81496
FT                   /locus_tag="MGAS9429_SpyR0007"
FT   rRNA            79668..81496
FT                   /locus_tag="MGAS9429_SpyR0007"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            81250..81325
FT                   /locus_tag="MGAS9429_SpyT0029"
FT   tRNA            81250..81325
FT                   /locus_tag="MGAS9429_SpyT0029"
FT                   /product="tRNA-Ala"
FT   gene            81621..84523
FT                   /locus_tag="MGAS9429_SpyR0008"
FT   rRNA            81621..84523
FT                   /locus_tag="MGAS9429_SpyR0008"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            84608..84724
FT                   /locus_tag="MGAS9429_SpyR0009"
FT   rRNA            84608..84724
FT                   /locus_tag="MGAS9429_SpyR0009"
FT                   /product="5S RNA"
FT   gene            84742..84814
FT                   /locus_tag="MGAS9429_SpyT0030"
FT   tRNA            84742..84814
FT                   /locus_tag="MGAS9429_SpyT0030"
FT                   /product="tRNA-Val"
FT   gene            84820..84890
FT                   /locus_tag="MGAS9429_SpyT0031"
FT   tRNA            84820..84890
FT                   /locus_tag="MGAS9429_SpyT0031"
FT                   /product="tRNA-Gly"
FT   gene            84925..84998
FT                   /locus_tag="MGAS9429_SpyT0032"
FT   tRNA            84925..84998
FT                   /locus_tag="MGAS9429_SpyT0032"
FT                   /product="tRNA-Ile"
FT   gene            85021..85092
FT                   /locus_tag="MGAS9429_SpyT0033"
FT   tRNA            85021..85092
FT                   /locus_tag="MGAS9429_SpyT0033"
FT                   /product="tRNA-Glu"
FT   gene            85106..85188
FT                   /pseudo
FT                   /locus_tag="MGAS9429_SpyT0034"
FT   tRNA            85106..85188
FT                   /pseudo
FT                   /locus_tag="MGAS9429_SpyT0034"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            85202..85275
FT                   /locus_tag="MGAS9429_SpyT0035"
FT   tRNA            85202..85275
FT                   /locus_tag="MGAS9429_SpyT0035"
FT                   /product="tRNA-Met"
FT   gene            85296..85368
FT                   /locus_tag="MGAS9429_SpyT0036"
FT   tRNA            85296..85368
FT                   /locus_tag="MGAS9429_SpyT0036"
FT                   /product="tRNA-Phe"
FT   gene            85388..85468
FT                   /locus_tag="MGAS9429_SpyT0037"
FT   tRNA            85388..85468
FT                   /locus_tag="MGAS9429_SpyT0037"
FT                   /product="tRNA-Tyr"
FT   gene            85475..85545
FT                   /locus_tag="MGAS9429_SpyT0038"
FT   tRNA            85475..85545
FT                   /locus_tag="MGAS9429_SpyT0038"
FT                   /product="tRNA-Trp"
FT   gene            85557..85629
FT                   /locus_tag="MGAS9429_SpyT0039"
FT   tRNA            85557..85629
FT                   /locus_tag="MGAS9429_SpyT0039"
FT                   /product="tRNA-His"
FT   gene            85638..85709
FT                   /locus_tag="MGAS9429_SpyT0040"
FT   tRNA            85638..85709
FT                   /locus_tag="MGAS9429_SpyT0040"
FT                   /product="tRNA-Gln"
FT   gene            85729..85812
FT                   /locus_tag="MGAS9429_SpyT0041"
FT   tRNA            85729..85812
FT                   /locus_tag="MGAS9429_SpyT0041"
FT                   /product="tRNA-Leu"
FT   gene            86072..86257
FT                   /locus_tag="MGAS9429_Spy0073"
FT   CDS_pept        86072..86257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY8"
FT                   /protein_id="ABF31261.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVRDE
FT                   MLSQQGHEDKADWPEP"
FT   gene            86760..86864
FT                   /locus_tag="MGAS9429_Spy0074"
FT   CDS_pept        86760..86864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0074"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31262"
FT                   /db_xref="GOA:Q1JNY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY7"
FT                   /protein_id="ABF31262.1"
FT                   /translation="MVMMSIDLCDYVTVDHIDDNKIVFASNCPKIPIN"
FT   gene            86895..87203
FT                   /locus_tag="MGAS9429_Spy0075"
FT   CDS_pept        86895..87203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0075"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31263"
FT                   /db_xref="GOA:Q1JNY6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY6"
FT                   /protein_id="ABF31263.1"
FT                   /translation="MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLT
FT                   LSRKDMMDIGIPIGSDVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST"
FT   gene            87243..87470
FT                   /locus_tag="MGAS9429_Spy0076"
FT   CDS_pept        87243..87470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0076"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31264"
FT                   /db_xref="GOA:Q1JNY5"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY5"
FT                   /protein_id="ABF31264.1"
FT                   /translation="MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKT
FT                   LQAGAATTLMTGSGPTVFALCQTEKQTIIV"
FT   gene            87580..88023
FT                   /gene="adcR"
FT                   /locus_tag="MGAS9429_Spy0077"
FT   CDS_pept        87580..88023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="MGAS9429_Spy0077"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31265"
FT                   /db_xref="GOA:Q1JNY4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY4"
FT                   /protein_id="ABF31265.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            88027..88746
FT                   /gene="adcC"
FT                   /locus_tag="MGAS9429_Spy0078"
FT   CDS_pept        88027..88746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="MGAS9429_Spy0078"
FT                   /product="high-affinity zinc uptake system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31266"
FT                   /db_xref="GOA:Q1JNY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY3"
FT                   /protein_id="ABF31266.1"
FT                   /translation="MRYISVKNLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEVETDDEKGGHGHA"
FT   gene            88700..89554
FT                   /gene="adcB"
FT                   /locus_tag="MGAS9429_Spy0079"
FT   CDS_pept        88700..89554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="MGAS9429_Spy0079"
FT                   /product="high-affinity zinc uptake system membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31267"
FT                   /db_xref="GOA:Q1JNY2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY2"
FT                   /protein_id="ABF31267.1"
FT                   /translation="MKLKQMTKKEVMVMLDILSYDFMQRAVMAVVAISIFAPILGIFLI
FT                   LRRQSLMSDTLSHVSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEIST
FT                   AILMSLGLALSLIIMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLF
FT                   IRPMYILTFDEDTAFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIA
FT                   MRLGKNFKTVILLGIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKK
FT                   RLF"
FT   gene            complement(89594..89977)
FT                   /locus_tag="MGAS9429_Spy0080"
FT   CDS_pept        complement(89594..89977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0080"
FT                   /product="adenosine 5'-monophosphoramidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31268"
FT                   /db_xref="GOA:Q1JNY1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNY1"
FT                   /protein_id="ABF31268.1"
FT                   /translation="MTECIFCHQLKANQLLTQSQYFKVVFDIDPIQKGHLLLISKDHYT
FT                   SLTQLPKEVRYDLIDLQAALVAKLEQHLPISGVTSVSNDKELMDEGTHFHLHLIPRLTN
FT                   DSFWESITINQENWDLTPFLKHL"
FT   gene            complement(90028..91284)
FT                   /gene="tyrS"
FT                   /locus_tag="MGAS9429_Spy0081"
FT   CDS_pept        complement(90028..91284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="MGAS9429_Spy0081"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31269"
FT                   /db_xref="GOA:Q1JNY0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNY0"
FT                   /protein_id="ABF31269.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSEDSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGDRVQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            91376..93688
FT                   /gene="pbp1b"
FT                   /locus_tag="MGAS9429_Spy0082"
FT   CDS_pept        91376..93688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1b"
FT                   /locus_tag="MGAS9429_Spy0082"
FT                   /product="multimodular transpeptidase-transglycosylase PBP
FT                   1B"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31270"
FT                   /db_xref="GOA:Q1JNX9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX9"
FT                   /protein_id="ABF31270.1"
FT                   /translation="MRYFMVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIF
FT                   LFGMMGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLR
FT                   TPVANDAISENIKKAIVSTEDEHFQEHKGVVPKAVFRATLASVLGFGEASGGSTLTQQL
FT                   VKQQVLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNM
FT                   YRTGVLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKV
FT                   SSRDLKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTV
FT                   QMGNVLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENY
FT                   MTKMGYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVV
FT                   YKHENKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTE
FT                   NYTDVWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVG
FT                   QRFNLDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGG
FT                   TDADYQKAWGNFGFRKN"
FT   gene            93952..96837
FT                   /gene="rpoB"
FT                   /locus_tag="MGAS9429_Spy0083"
FT   CDS_pept        93952..96837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="MGAS9429_Spy0083"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31271"
FT                   /db_xref="GOA:Q1JNX8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNX8"
FT                   /protein_id="ABF31271.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPRVSFHVLYQLKTCHTFQTEHQLTSC"
FT   gene            96795..97544
FT                   /locus_tag="MGAS9429_Spy0084"
FT   CDS_pept        96795..97544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0084"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31272"
FT                   /db_xref="GOA:Q1JNX7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX7"
FT                   /protein_id="ABF31272.1"
FT                   /translation="MPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIA
FT                   TPVFDGASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDK
FT                   LHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGR
FT                   LKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDI
FT                   MHVDDLEKAREKQAQETQEVSETTDEK"
FT   gene            97635..101258
FT                   /gene="rpoC"
FT                   /locus_tag="MGAS9429_Spy0085"
FT   CDS_pept        97635..101258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="MGAS9429_Spy0085"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31273"
FT                   /db_xref="GOA:Q1JNX6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNX6"
FT                   /protein_id="ABF31273.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAE"
FT   gene            101410..101775
FT                   /locus_tag="MGAS9429_Spy0086"
FT   CDS_pept        101410..101775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0086"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31274"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX5"
FT                   /protein_id="ABF31274.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   gene            101868..102806
FT                   /gene="comYA"
FT                   /locus_tag="MGAS9429_Spy0087"
FT   CDS_pept        101868..102806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYA"
FT                   /locus_tag="MGAS9429_Spy0087"
FT                   /product="ComG operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31275"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX4"
FT                   /protein_id="ABF31275.1"
FT                   /translation="MVQALAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISSYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGITKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            102685..103776
FT                   /gene="comYB"
FT                   /locus_tag="MGAS9429_Spy0088"
FT   CDS_pept        102685..103776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYB"
FT                   /locus_tag="MGAS9429_Spy0088"
FT                   /product="ComG operon protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31276"
FT                   /db_xref="GOA:Q1JNX3"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX3"
FT                   /protein_id="ABF31276.1"
FT                   /translation="MTLLKTNLNIIPHRTGINKLISFLRQDISIPSKLSLKKLSSKHQH
FT                   KFIQLLANLLSTGFSFAEVIAFLKRSQLLQLDYVLKMEESLLKGQGLADMLSGLGFSDA
FT                   ILTQISLADRHGNIETTLVAIQHYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRY
FT                   LVPQLETQNQITYFLNHFPAFFIGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLG
FT                   KLLKQYLTSYYAREWSTLIGQGLDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHI
FT                   KVATYPFFKKELSLMIEYGEIKSKLGVELEIYAQESWEQFFSQLYQVTQLIQPAIFLVV
FT                   AVTIVMIYAAILLPIYQNMGGIF"
FT   gene            103778..104104
FT                   /gene="comYC"
FT                   /locus_tag="MGAS9429_Spy0089"
FT   CDS_pept        103778..104104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="MGAS9429_Spy0089"
FT                   /product="ComG operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31277"
FT                   /db_xref="GOA:Q1JNX2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX2"
FT                   /protein_id="ABF31277.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            104079..104507
FT                   /locus_tag="MGAS9429_Spy0090"
FT   CDS_pept        104079..104507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0090"
FT                   /product="ComG operon protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31278"
FT                   /db_xref="GOA:Q1JNX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX1"
FT                   /protein_id="ABF31278.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            104464..104748
FT                   /locus_tag="MGAS9429_Spy0091"
FT   CDS_pept        104464..104748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0091"
FT                   /product="ComG operon protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31279"
FT                   /db_xref="GOA:Q1JNX0"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNX0"
FT                   /protein_id="ABF31279.1"
FT                   /translation="MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYR
FT                   KQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   gene            104741..105175
FT                   /gene="comYD"
FT                   /locus_tag="MGAS9429_Spy0092"
FT   CDS_pept        104741..105175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYD"
FT                   /locus_tag="MGAS9429_Spy0092"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31280"
FT                   /db_xref="GOA:Q1JNW9"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW9"
FT                   /protein_id="ABF31280.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFCKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIEQSQICITLKWKSGLERTFYYAFQD"
FT   gene            105159..105485
FT                   /locus_tag="MGAS9429_Spy0093"
FT   CDS_pept        105159..105485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0093"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31281"
FT                   /db_xref="GOA:Q1JNW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW8"
FT                   /protein_id="ABF31281.1"
FT                   /translation="MPFKTNLKAGVLLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVFFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            105538..106536
FT                   /locus_tag="MGAS9429_Spy0094"
FT   CDS_pept        105538..106536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0094"
FT                   /product="adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31282"
FT                   /db_xref="GOA:Q1JNW7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW7"
FT                   /protein_id="ABF31282.1"
FT                   /translation="MTLLFISSVIWYDKVMTFEKIEEAYQLLLENCQLIENDLKTHIYD
FT                   AIVEQNSFYLGAEGASPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQF
FT                   TPDAIGFILLYLLEQLSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLID
FT                   LSASIAEIMDSSAHFIQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHT
FT                   YAHHLLMEQSLKYLKKDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVALITLPDSIFG
FT                   HPSNAKSIIVLQKQTDHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            106595..107791
FT                   /gene="ackA"
FT                   /locus_tag="MGAS9429_Spy0095"
FT   CDS_pept        106595..107791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="MGAS9429_Spy0095"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31283"
FT                   /db_xref="GOA:Q1JNW6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNW6"
FT                   /protein_id="ABF31283.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEEVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEQIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            107978..108286
FT                   /locus_tag="MGAS9429_Spy0096"
FT   CDS_pept        107978..108286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31284"
FT                   /db_xref="GOA:Q1JNW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW5"
FT                   /protein_id="ABF31284.1"
FT                   /translation="MYVFIEPNDLKDYLITVYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLALIFAYLYLIIRSLVAKKMEALGKITTNSQKPPFDTSQVLC"
FT   gene            complement(108369..109139)
FT                   /gene="proC"
FT                   /locus_tag="MGAS9429_Spy0097"
FT   CDS_pept        complement(108369..109139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="MGAS9429_Spy0097"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31285"
FT                   /db_xref="GOA:Q1JNW4"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW4"
FT                   /protein_id="ABF31285.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   gene            complement(109187..110254)
FT                   /gene="pepA"
FT                   /locus_tag="MGAS9429_Spy0098"
FT   CDS_pept        complement(109187..110254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="MGAS9429_Spy0098"
FT                   /product="glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31286"
FT                   /db_xref="GOA:Q1JNW3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW3"
FT                   /protein_id="ABF31286.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKAEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAESFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNPGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEDA
FT                   GVNFQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKRY"
FT   gene            complement(110364..110528)
FT                   /locus_tag="MGAS9429_Spy0099"
FT   CDS_pept        complement(110364..110528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31287"
FT                   /db_xref="GOA:Q1JNW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW2"
FT                   /protein_id="ABF31287.1"
FT                   /translation="MTPLSLLFASEESFRILSALLFLLTSLCFIILMISLLPKKTDYRQ
FT                   KTNTSSRDL"
FT   gene            110710..111000
FT                   /locus_tag="MGAS9429_Spy0100"
FT   CDS_pept        110710..111000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0100"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31288"
FT                   /db_xref="GOA:Q1JNW1"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW1"
FT                   /protein_id="ABF31288.1"
FT                   /translation="MRDMSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRKRRQMTRDLR
FT                   TFFSPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDK"
FT   gene            110997..111317
FT                   /locus_tag="MGAS9429_Spy0101"
FT   CDS_pept        110997..111317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0101"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31289"
FT                   /db_xref="GOA:Q1JNW0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNW0"
FT                   /protein_id="ABF31289.1"
FT                   /translation="MMIRPTSYESLAALVEKEDKLVLFFTADWCPDCQFIYPIMPEIEA
FT                   ELTDMTFVCVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAA
FT                   YQ"
FT   gene            111335..111961
FT                   /locus_tag="MGAS9429_Spy0102"
FT   CDS_pept        111335..111961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0102"
FT                   /product="tRNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31290"
FT                   /db_xref="GOA:Q1JNV9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV9"
FT                   /protein_id="ABF31290.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPTVGPVFVVGQIVEM
FT                   VAHLDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   gene            112113..112508
FT                   /locus_tag="MGAS9429_Spy0103"
FT   CDS_pept        112113..112508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0103"
FT                   /product="single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31291"
FT                   /db_xref="GOA:Q1JNV8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV8"
FT                   /protein_id="ABF31291.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLISIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   gene            complement(112768..113457)
FT                   /locus_tag="MGAS9429_Spy0104"
FT   CDS_pept        complement(112768..113457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0104"
FT                   /product="deoxyadenosine kinase"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.113"
FT                   /note="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31292"
FT                   /db_xref="GOA:Q1JNV7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV7"
FT                   /protein_id="ABF31292.1"
FT                   /translation="MKPSSKQYANDIRRRRMLIVLAGTIGAGKSSLAAALGEHLGTDVF
FT                   YEAVDNNPVLDLYYQDPKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLK
FT                   LNYKNGNVTKTELDIYQELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSF
FT                   EQVDGNPSLEQYYHQVHGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTK
FT                   LKELHLL"
FT   gene            complement(113429..114478)
FT                   /locus_tag="MGAS9429_Spy0105"
FT   CDS_pept        complement(113429..114478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0105"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31293"
FT                   /db_xref="GOA:Q1JNV6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV6"
FT                   /protein_id="ABF31293.1"
FT                   /translation="MLRLFANFVVPSTNLMKVIWRPLSMIKLNSSFRIGDVEIPHRTVL
FT                   APMAGVTNSAFRTIAKEFGAGLVVMEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFG
FT                   GDAEGLKRAADFIQTNTKADIVDINMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSV
FT                   LDIPLTVKMRTGWADSSLAVENALAAESAGVSALAMHGRTREQMYTGTCDHETLARVSK
FT                   AITKIPFIGNGDVRSVQDAKFMIEEIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPD
FT                   LPFAKKLDIAKDHLKRLINLKGETIAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAE
FT                   VEAIFETVR"
FT   gene            complement(114393..115265)
FT                   /locus_tag="MGAS9429_Spy0106"
FT   CDS_pept        complement(114393..115265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0106"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31294"
FT                   /db_xref="GOA:Q1JNV5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNV5"
FT                   /protein_id="ABF31294.1"
FT                   /translation="MDKIIKSIAQSGSFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSRITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEVARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEAIINDKA"
FT   gene            complement(115412..117004)
FT                   /gene="rofA"
FT                   /locus_tag="MGAS9429_Spy0107"
FT   CDS_pept        complement(115412..117004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rofA"
FT                   /locus_tag="MGAS9429_Spy0107"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31295"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV4"
FT                   /protein_id="ABF31295.1"
FT                   /translation="MISIFSLDRIEIGEYTYQRLIWLSKCRKRGPLSLIEKYLESSIES
FT                   KCQLVVLFFKTSSLPITEVAEKTGLTFLQLNHYCEELNAFFPDSLSMTIQKRMISCQFT
FT                   HPSKETYLYQLYASSNVLQLLAFLIKNGSHSRPLTDFARSHFLSNSSAYRMREALIPLL
FT                   RNFELKLSKNKIVGEEYRIRYLIALLYSKFGIKVYDLTQQDKNIIHSFLSHSSTHLKTS
FT                   PWLSESFSFYDILLALSWKRHQFSVTIPQTRIFQQLKKLFVYDSLKKSSRDIIETYCQL
FT                   NFSAGDLDYLYLIYITANNSFASLQWTPEHIRQCCQLFEENDTFRLLLNPIITLLPNLK
FT                   EQKASLVKALMFFSKSFLFNLQHFIPETNLFVSPYYKGNQKLYTSLKLIVEEWMAKLPG
FT                   KRYLNHKHFHLFCHYVEQILRNIQPPLVVVFVASNFINAHLLTDSFPRYFSDKSIDFHS
FT                   YYLLQDNVYQIPDLKPDLVITHSQLIPFVHHELTKGIAVAEISFDESILSIQELMYQVK
FT                   EEKFQADLTKQLT"
FT   gene            117137..119233
FT                   /locus_tag="MGAS9429_Spy0108"
FT   CDS_pept        117137..119233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0108"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31296"
FT                   /db_xref="GOA:Q1JNV3"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV3"
FT                   /protein_id="ABF31296.1"
FT                   /translation="MVSSYMFARGEKMNNKMFLNKEAGFLVHTKRKRRFAVTLVGVFFL
FT                   LLACAGAIGFGQVAYAADEKTVPNFKSPDPDYPWYGYDSYRGIFARYHNLKVNLKGSKE
FT                   YQAYCFNLTKYFPRPTYSTTNNFYKKIDGSGSAFKSYAANPRVLDENLDKLEKNILNVI
FT                   YNGYKSNANGFMNGIEDLNAILVTQNAIWYYSDSAPLNDVNKMWEREVRNGEISESQVT
FT                   LMREALKKLIDPNLEATAANKIPSGYRLNIFKSENEDYQNLLSAEYVPDDPPKPGDTSE
FT                   HNPKTPELDGTPIPEDPKRPDESSEPALPPLMPELDGEEVPEVPSESLEPALPPLMPEL
FT                   DGEEVPEVPSESLEPALPPLMPELDGEEVPEVPSESLEPALPPLMPELDGEEVPEVPSE
FT                   SLEPALPPLMPELDGEEVPEKPSVDLPIEVPRYEFNNKDQSPLAGESGETEYITEVYGN
FT                   QQNPVDIDKKLPNETGFSGNMVETEDTKEPEVLMGGQSESVEFTKDTQTGMSGQTTPQV
FT                   ETEDTKEPEVLMGGQSESVEFTKDTQTGMSGQTTPQVETEDTKEPGVLMGGQSESVEFT
FT                   KDTQTGMSGQTTPQVETEDTKEPGVLMGGQSESVEFTKDTQTGMSGFSETVTIVEDTRP
FT                   KLVFHFDNNEPKVEENREKPTKNITPILPATGDIENVLAFLGILILSVLSIFSLLKNKQ
FT                   NNKV"
FT   gene            119457..119762
FT                   /locus_tag="MGAS9429_Spy0109"
FT   CDS_pept        119457..119762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0109"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31297"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV2"
FT                   /protein_id="ABF31297.1"
FT                   /translation="MTERLKNLGILLLFLLGTAIFLYPTLSSQWNAYRDRQLLSTYHKQ
FT                   VTQKKPSEMEEVWQKAKAYNARLGIQPVPDAFSFRDGIHDKNYESLLQIENNDIMG"
FT   gene            119769..120305
FT                   /locus_tag="MGAS9429_Spy0110"
FT   CDS_pept        119769..120305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0110"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31298"
FT                   /db_xref="GOA:Q1JNV1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV1"
FT                   /protein_id="ABF31298.1"
FT                   /translation="MPSIKVTLPIYHYTTDEVLTKGAGHLVGSALPVGGDGTHTVISAH
FT                   RGLPSAEMFTNLNLVKRGDTFYFRVLNKVLAYKVDQILTVEPDQVTSLSGVMGKDHATL
FT                   VTCTPYGVNTKRLLVRGHRITYHYKKYQQAKKAMKLVDKSRMWTEVVCAAFGVVIAIIL
FT                   VFMYSKMTDKKVIKN"
FT   gene            120591..122861
FT                   /locus_tag="MGAS9429_Spy0111"
FT   CDS_pept        120591..122861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0111"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31299"
FT                   /db_xref="GOA:Q1JNV0"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNV0"
FT                   /protein_id="ABF31299.1"
FT                   /translation="MNNKKLQKKQDAPRVSNRKPKQLTVTLVGVFLMFLTLVSSMRGAQ
FT                   SIFGEEKRIEEVSVPKIKSPDDAYPWYGYDSYDSSHPYYERFKVAHDLRVNLNGSKSYQ
FT                   VYCFNINSHYPNRKNAFSKQWFKRVDGTGDVFTNYAQTPKIRGESLNNKLLSIMYNAYP
FT                   KNANGYMDKIEPLNAILVTQQAVWYYSDSSYGNIKTLWASELKDGKIDFEQVKLMREAY
FT                   SKLISDDLEETSKNKLPQGSKLNIFVPQDKSVQNLLSAEYVPESPPAPGQSPEPPVQTK
FT                   KTSVIIRKYAEGDYSKLLEGATLRLTGEDILDFQEKVFQSNGTGEKIELSNGTYTLTET
FT                   SSPDGYKIAEPIKFRVVNKKVFIVQKDGSQVENPNKEVAEPYSVEAYSDMQDSNYINPE
FT                   TFTPYGKFYYAKNKDKSSQVVYCFNADLHSPPESEDGGGTIDPDISTMKEVKYTHTAGS
FT                   DLFKYALRPRDTNPEDFLKHIKKVIEKGYNKKGDSYNGLTETQFRAATQLAIYYFTDST
FT                   DLKTLKTYNNGKGYHGFESMDEKTLAVTKELINYAQDNSAPQLTNLDFFVPNNSKYQSL
FT                   IGTEYHPDDLVDVIRMEDKKQEVIPVTHSLTVKKTVVGELGDKTKGFQFELELKDKTGQ
FT                   PIVNTLKTNNQDLVAKDGKYSFNLKHGDTIRIEGLPTGYSYTLKETEAKDYIVTVDNKV
FT                   SQEAQSASENVTADKEVTFENRKDLVPPTGFITDGGTYLWLLLLVPFGLLVWFFGRKGL
FT                   KND"
FT   gene            122854..123375
FT                   /locus_tag="MGAS9429_Spy0112"
FT   CDS_pept        122854..123375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0112"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31300"
FT                   /db_xref="GOA:Q1JNU9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU9"
FT                   /protein_id="ABF31300.1"
FT                   /translation="MTNYLNRLNENPLFKAFIRLVLKISIIGFLGYILFQYVFGVMIVN
FT                   TNQMSPAVSAGDGVLYYRLTDRYHINDVVVYEVDNTLKVGRIAAQAGDEVSFTQEGGLL
FT                   INGHPPEKEVPYLTYPHSSGPNFPYKVPTGTYFILNDYREERLDSRYYGALPINQIKGK
FT                   ISTLLRVRGI"
FT   gene            123382..124425
FT                   /locus_tag="MGAS9429_Spy0113"
FT   CDS_pept        123382..124425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0113"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31301"
FT                   /db_xref="GOA:Q1JNU8"
FT                   /db_xref="InterPro:IPR017503"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU8"
FT                   /protein_id="ABF31301.1"
FT                   /translation="MEREKMKKNKLLLATAILATALGTASLNQNVKAETAGVVSSGQLT
FT                   IKKSITNFNDDTLLMPKTDYTFSVNPDSAATGTESNLPIKPGIAVNNQDIKVSYSNTDK
FT                   TSGKEKQVVVDFMKVTFPSVGIYRYVVTENKGTAEGVTYDDTKWLVDVYVGNNEKGGLE
FT                   PKYIVSKKGDSATKEPIQFNNSFETTSLKIEKEVTGNTGDHKKAFNFTLTLQPNEYYEA
FT                   SSVVKIEENGQTKDVKIGEAYKFTLNDSQSVILSKLPVGINYKVEEAEANQGGYTTTAT
FT                   LKDGEKLSTYNLGQEHKTDKTADEIVVTNNRDTQVPTGVVGTLAPFAVLSIVAIGGVIY
FT                   ITKRKKA"
FT   gene            124426..125166
FT                   /gene="eftLSL-B"
FT                   /locus_tag="MGAS9429_Spy0114"
FT   CDS_pept        124426..125166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eftLSL-B"
FT                   /locus_tag="MGAS9429_Spy0114"
FT                   /product="sortase B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31302"
FT                   /db_xref="GOA:Q1JNU7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU7"
FT                   /protein_id="ABF31302.1"
FT                   /translation="MISQRMMMTIVQVINKAIDTLILIFCLVVLFLAGFGLWDSYHLYQ
FT                   QADASNFKKFKTAQQQPKFEDLLALNEDVIGWLNIPGTHIDYPLVQGKTNLEYINKAVD
FT                   GSVAMSGSLFLDTRNHNDFTDDYSLIYGHHMAGNAMFGEIPKFLKKDFFNKHNKAIIET
FT                   KERKKLTVTIFACLKTDAFDQLVFNPNAITNQDQQRQLVDYISKRSKQFKPVKLKHHTK
FT                   FVAFSTCENFSTDNRVIVVGTIQE"
FT   gene            125111..125770
FT                   /locus_tag="MGAS9429_Spy0115"
FT   CDS_pept        125111..125770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31303"
FT                   /db_xref="GOA:Q1JNU6"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU6"
FT                   /protein_id="ABF31303.1"
FT                   /translation="MKIFLLTIVLSLSVLFKNNERRRLLRKYWKMLFSVVMILTMLAFN
FT                   QTVLAKDSTVQTSISVENVLERAGDSTPFSIALESIDAMKTIEEITIAGSGKASFSPLT
FT                   FTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAI
FT                   TFKPKRLVKPIPPRQPNIPKTPLPLAGEVKSLLGILSIVLLGLLVLLYVKKLKSKL"
FT   gene            complement(125929..127134)
FT                   /locus_tag="MGAS9429_Spy0116"
FT   CDS_pept        complement(125929..127134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0116"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31304"
FT                   /db_xref="GOA:Q1JNU5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024022"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU5"
FT                   /protein_id="ABF31304.1"
FT                   /translation="MVIFDLKHVQTLHSLSQLPISVMSQDKALIQVYGNDDYLLCYYQF
FT                   LKHLAIPQAAQDVIFYEGLFEESFMIFPLCHYIIAIGPFYPYSLNKDYQEQLANNFLKH
FT                   SSHRSKEELLSYMALVPHFPINNVRNLLIAIDAFFDTQFETTCQQTIHQLLQHSKQMTA
FT                   DPDIIHRLKHISKASSQLPPVLEHLNHIMDLVKLGNPQLLKQEINRIPLSSITSSSISA
FT                   LRAEKNLTVIYLTRLLEFSFVENTDVAKHYSLVKYYMALNEEASDLLKVLRIRCAAIIH
FT                   FSESLTNKSISDKRQMYNSVLHYVDSHLYSKLKVSDIAKRLYVSESHLRSVFKKYSNVS
FT                   LQHYILSTKIKEAQLLLKRGIPVGEVAKSLYFYDTTHFHKIFKKYTGISSKDYLAKYRD
FT                   NI"
FT   gene            127519..131004
FT                   /locus_tag="MGAS9429_Spy0117"
FT   CDS_pept        127519..131004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0117"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31305"
FT                   /db_xref="GOA:Q1JNU4"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU4"
FT                   /protein_id="ABF31305.1"
FT                   /translation="MTQKNSYKLSFLLSLTGFILGLLLVFIGLSGVSVGHAETRNGANK
FT                   QGSFEIKKVDQNNKPLPGATFSLTSKDGKGTSVQTFTSNDKGIVDAQNLQPGTYTLKEE
FT                   TAPDGYDKTSRTWTVTVYENGYTKLVENPYNGEIISKAGSKDVSSSLQLENPKMSVVSK
FT                   YGKTEVSSGAADFYRNHAAYFKMSFELKQKDKSETINPGDTFVLQLDRRLNPKGISQDI
FT                   PKIIYDSANSPLAIGKYHAENHQLIYTFTDYIAGLDKVQLSAELSLFLENKEVLENTSI
FT                   SNFKSTIGGQEITYKGTVNVLYGNESTKESNYITNGLSNVGGSIESYNTETGEFVWYVY
FT                   VNPNRTNIPYATMNLWGFGRARSNTSDLENDANTSSAELGEIQVYEVPEGEKLPSSYGV
FT                   DVTKLTLRTDITAGLGNGFQMTKRQRIDFGNNIQNKAFIIKVTGKTDQSGKPLVVQSNL
FT                   ASFRGASEYAAFTPVGGNVYFQNEIALSPSKGSGSGKSEFTKPSITVANLKRVAQLRFK
FT                   KMSTDNVPLPEAAFELRSSNGNSQKLEASSNTQGEVHFKDLTSGTYDLYETKAPKGYQQ
FT                   VTEKLATVTVDTTKPAEEMVTWGSPHSSVKVEANKEVTIVNHKETLTFSGKKIWENDRP
FT                   DQRPAKIQVQLLQNGQKMPNQIQEVTKDNDWSYHFKDLPKYDAKNQEYKYSVEEVNVPD
FT                   GYKVSYLGNDIFNTRETEFVFEQNNFNLEFGNAEIKGQSGSKIIDEDTLTSFKGKKIWK
FT                   NDTAENRPQAIQVQLYADGVAVEGQTKFISGSGNEWSFEFKNLKKYNGTGNDIIYSVKE
FT                   VTVPTGYDVTYSANDIINTKREVITQQGPKLEIEETLPLESGASGGTTTVEDSRPVDTL
FT                   SGLSSEQGQSGDMTIEEDSATHIKFSKRDIDGKELAGATMELRDSSGKTISTWISDGQV
FT                   KDFYLMPGKYTFVETAAPDGYEIATAITFTVNEQGQVTVNGKATKGDTHIVMVDAYKPT
FT                   KGSGQVIDIEEKLPDEQGHSGSTTEIEDSKSSDLIIGGQGEVVDTTEDTQSGMTGHSGS
FT                   TTEIEDSKSSDVIIGGQGQVVETTEDTQTGMYGDSGCKTEVEDTKLVQSFHFDNKEPES
FT                   NSEIPKKDKPKSNTSLPATGEKQHNMFFWMVTSCSLISSVFVISLKSKKRLSSC"
FT   gene            complement(131271..131936)
FT                   /locus_tag="MGAS9429_Spy0118"
FT   CDS_pept        complement(131271..131936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31306"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU3"
FT                   /protein_id="ABF31306.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEKGKVHLYWQGNY
FT                   YVDNYVDYTKALTADEKSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPTEITYEHHYWD
FT                   GTVHSEKHNNTQWHYDWKSQQTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHVLVD
FT                   TYGRQSHTYFSHKMVWKFKTELEEDYKNKWDKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            132256..133695
FT                   /gene="atoE"
FT                   /locus_tag="MGAS9429_Spy0119"
FT   CDS_pept        132256..133695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="MGAS9429_Spy0119"
FT                   /product="short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31307"
FT                   /db_xref="GOA:Q1JNU2"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU2"
FT                   /protein_id="ABF31307.1"
FT                   /translation="MLVDNVKGIDNMNNIKTKKRFMDRYIDGFMKWMPESLFICFILTF
FT                   LVVTMSVLMTDSPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHK
FT                   MFKSLAKLPQTRTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTP
FT                   LFVATLFFTFLPATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFI
FT                   SLLVVCMLVPLCFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRL
FT                   VMYLVGGAIVSYSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVM
FT                   SSWGLVLQFPFYAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLHSALLNIAVPSG
FT                   GSKFVIEAPYIVPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIV
FT                   AYTIPCVLVVTGIAIIYLFVF"
FT   gene            complement(133763..134674)
FT                   /locus_tag="MGAS9429_Spy0120"
FT   CDS_pept        complement(133763..134674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0120"
FT                   /product="transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31308"
FT                   /db_xref="GOA:Q1JNU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU1"
FT                   /protein_id="ABF31308.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   VVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDATIADIDI
FT                   LLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLP
FT                   VVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHN
FT                   KTSHLKHYIKHTILDYFTNQRF"
FT   gene            134795..135979
FT                   /locus_tag="MGAS9429_Spy0121"
FT   CDS_pept        134795..135979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0121"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31309"
FT                   /db_xref="GOA:Q1JNU0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNU0"
FT                   /protein_id="ABF31309.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPK
FT                   FGTTVDKLAKLRSAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            135934..136650
FT                   /gene="atoD2"
FT                   /locus_tag="MGAS9429_Spy0122"
FT   CDS_pept        135934..136650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoD2"
FT                   /locus_tag="MGAS9429_Spy0122"
FT                   /product="acetate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31310"
FT                   /db_xref="GOA:Q1JNT9"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT9"
FT                   /protein_id="ABF31310.1"
FT                   /translation="MYWWWPRSKYHRNKIEGNRMKENKRIAIAEAISHIKDGDTIMVGG
FT                   FMANGTPEALIDALVDKGTKDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEA
FT                   GRQMTAGETTIELIPQGTFAEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLL
FT                   EYPFEADVALIFANKADEMGNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPEC
FT                   VHTPHIFVDYIVKEGV"
FT   gene            136653..137300
FT                   /locus_tag="MGAS9429_Spy0123"
FT   CDS_pept        136653..137300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0123"
FT                   /product="acetate CoA-transferase beta subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31311"
FT                   /db_xref="GOA:Q1JNT8"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT8"
FT                   /protein_id="ABF31311.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   gene            complement(137422..138102)
FT                   /locus_tag="MGAS9429_Spy0124"
FT   CDS_pept        complement(137422..138102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0124"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31312"
FT                   /db_xref="GOA:Q1JNT7"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT7"
FT                   /protein_id="ABF31312.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            138276..138641
FT                   /locus_tag="MGAS9429_Spy0125"
FT   CDS_pept        138276..138641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0125"
FT                   /product="translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31313"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT6"
FT                   /protein_id="ABF31313.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            138678..139697
FT                   /gene="sloR"
FT                   /locus_tag="MGAS9429_Spy0126"
FT   CDS_pept        138678..139697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sloR"
FT                   /locus_tag="MGAS9429_Spy0126"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31314"
FT                   /db_xref="GOA:Q1JNT5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT5"
FT                   /protein_id="ABF31314.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            140148..140471
FT                   /locus_tag="MGAS9429_Spy0127"
FT   CDS_pept        140148..140471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT4"
FT                   /protein_id="ABF31315.1"
FT                   /translation="MMNTLLSLMNSIEQEARTIYDSYDAKKKSLADKKEEELKQLFLEY
FT                   EQETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVET
FT                   YGH"
FT   gene            140461..142461
FT                   /gene="ntpI"
FT                   /locus_tag="MGAS9429_Spy0128"
FT   CDS_pept        140461..142461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="MGAS9429_Spy0128"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31316"
FT                   /db_xref="GOA:Q1JNT3"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT3"
FT                   /protein_id="ABF31316.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEESHRQQAAQTALKMMSQKIERLEQLQNKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANDHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   gene            142421..142942
FT                   /gene="ntpK"
FT                   /locus_tag="MGAS9429_Spy0129"
FT   CDS_pept        142421..142942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpK"
FT                   /locus_tag="MGAS9429_Spy0129"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31317"
FT                   /db_xref="GOA:Q1JNT2"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT2"
FT                   /protein_id="ABF31317.1"
FT                   /translation="MSMSMKKQIWRTINMEHLAHYFTAHGGVFFAALGIVLAVALSGMG
FT                   SAYGVGKGGQAAAALLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQ
FT                   GLAYFLISLPIAIVGYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFV
FT                   VSFILLNKIG"
FT   gene            143011..143595
FT                   /gene="ntpE"
FT                   /locus_tag="MGAS9429_Spy0130"
FT   CDS_pept        143011..143595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpE"
FT                   /locus_tag="MGAS9429_Spy0130"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31318"
FT                   /db_xref="GOA:Q1JNT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT1"
FT                   /protein_id="ABF31318.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKGLFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   gene            143611..144609
FT                   /gene="ntpC"
FT                   /locus_tag="MGAS9429_Spy0131"
FT   CDS_pept        143611..144609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpC"
FT                   /locus_tag="MGAS9429_Spy0131"
FT                   /product="V-type sodium ATP synthase subunit C"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31319"
FT                   /db_xref="GOA:Q1JNT0"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNT0"
FT                   /protein_id="ABF31319.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLVALEHLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLVAALANDLPKERVIERMRPIA"
FT   gene            144606..144926
FT                   /gene="ntpF"
FT                   /locus_tag="MGAS9429_Spy0132"
FT   CDS_pept        144606..144926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpF"
FT                   /locus_tag="MGAS9429_Spy0132"
FT                   /product="V-type sodium ATP synthase subunit F"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31320"
FT                   /db_xref="GOA:Q1JNS9"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS9"
FT                   /protein_id="ABF31320.1"
FT                   /translation="MTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQDAINQLRQLAM
FT                   EDFGIIYITEDIAAAIPEALTHYDNQVLPAVIPLPTHQGAQGIGLSRIQAMVEKAVGQN
FT                   IL"
FT   gene            145127..146902
FT                   /gene="ntpA"
FT                   /locus_tag="MGAS9429_Spy0133"
FT   CDS_pept        145127..146902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="MGAS9429_Spy0133"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31321"
FT                   /db_xref="GOA:Q1JNS8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNS8"
FT                   /protein_id="ABF31321.1"
FT                   /translation="MNQGKIITVSGPLVVASGMQEANIQDICRVGHLGLVGEIIEMRRD
FT                   QASIQVYEETSGIGPGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLI
FT                   RGVAIPSLDRKAKWAFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIH
FT                   AGNFTVTDTVYEIKQEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFP
FT                   VTKGGAAAVPGPFGAGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPN
FT                   TGQSIMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALR
FT                   EMSGRLQEMPGDEGYPAYLGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDIS
FT                   EPVTQNTLRIVKVFWGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQESNWSNKV
FT                   TRAMAILQREASLEEIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFP
FT                   KQEAMLTNILTFNEEASKALSLGAYFKEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQ
FT                   KVTKEIHHVLAKGGI"
FT   gene            146903..148318
FT                   /gene="ntpB"
FT                   /locus_tag="MGAS9429_Spy0134"
FT   CDS_pept        146903..148318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpB"
FT                   /locus_tag="MGAS9429_Spy0134"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31322"
FT                   /db_xref="GOA:Q1JNS7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNS7"
FT                   /protein_id="ABF31322.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            148342..148989
FT                   /gene="ntpD"
FT                   /locus_tag="MGAS9429_Spy0135"
FT   CDS_pept        148342..148989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpD"
FT                   /locus_tag="MGAS9429_Spy0135"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31323"
FT                   /db_xref="GOA:Q1JNS6"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS6"
FT                   /protein_id="ABF31323.1"
FT                   /translation="MTKGVISMARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELM
FT                   RRFADLIRENNELRQTIEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIEN
FT                   IMSVNVPKFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTC
FT                   QLMADDIEKTRRRVNGLEYSIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(149109..150371)
FT                   /locus_tag="MGAS9429_Spy0136"
FT   CDS_pept        complement(149109..150371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0136"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31324"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS5"
FT                   /protein_id="ABF31324.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   ATPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIINANNAALQMLAETSKEAIPALEQSAQ
FT                   NPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   gene            complement(150384..151262)
FT                   /locus_tag="MGAS9429_Spy0137"
FT   CDS_pept        complement(150384..151262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0137"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31325"
FT                   /db_xref="GOA:Q1JNS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS4"
FT                   /protein_id="ABF31325.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            151700..152992
FT                   /gene="purA"
FT                   /locus_tag="MGAS9429_Spy0138"
FT   CDS_pept        151700..152992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="MGAS9429_Spy0138"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31326"
FT                   /db_xref="GOA:Q1JNS3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNS3"
FT                   /protein_id="ABF31326.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLGFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGKRIDYYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            153319..154362
FT                   /locus_tag="MGAS9429_Spy0139"
FT   CDS_pept        153319..154362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0139"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31327"
FT                   /db_xref="GOA:Q1JNS2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS2"
FT                   /protein_id="ABF31327.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSSKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEGQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIETAKKAIIEG
FT                   TITVPEN"
FT   gene            154520..155074
FT                   /gene="nusG"
FT                   /locus_tag="MGAS9429_Spy0140"
FT   CDS_pept        154520..155074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="MGAS9429_Spy0140"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31328"
FT                   /db_xref="GOA:Q1JNS1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS1"
FT                   /protein_id="ABF31328.1"
FT                   /translation="MKGNIMLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNIL
FT                   RVEIPTQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNR
FT                   SKPTPLLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKL
FT                   MLNMFGSETVAEVELYQIAEL"
FT   gene            155436..156800
FT                   /gene="nga"
FT                   /locus_tag="MGAS9429_Spy0141"
FT   CDS_pept        155436..156800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="MGAS9429_Spy0141"
FT                   /product="NAD glycohydrolase"
FT                   /EC_number="3.2.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31329"
FT                   /db_xref="GOA:Q1JNS0"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="InterPro:IPR041934"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNS0"
FT                   /protein_id="ABF31329.1"
FT                   /translation="MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKE
FT                   NKKSDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFVSP
FT                   MRIGRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEI
FT                   DKKLDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADE
FT                   FIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKK
FT                   DLMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYS
FT                   DGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPS
FT                   ISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   gene            156805..157290
FT                   /gene="ifs"
FT                   /locus_tag="MGAS9429_Spy0142"
FT   CDS_pept        156805..157290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ifs"
FT                   /locus_tag="MGAS9429_Spy0142"
FT                   /product="streptococcal NAD glycohydrolase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31330"
FT                   /db_xref="GOA:Q1JNR9"
FT                   /db_xref="InterPro:IPR032002"
FT                   /db_xref="InterPro:IPR038509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR9"
FT                   /protein_id="ABF31330.1"
FT                   /translation="MYKVPKSLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMG
FT                   DISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALDIYQAVQTLNAENMLLN
FT                   YYESLPFYLNRQSILANITKALKDAHIREAMVHYKLGEFAHYQDTMLDMVERTIETF"
FT   gene            157305..159029
FT                   /gene="slo"
FT                   /locus_tag="MGAS9429_Spy0143"
FT   CDS_pept        157305..159029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="MGAS9429_Spy0143"
FT                   /product="streptolysin O"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31331"
FT                   /db_xref="GOA:Q1JNR8"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR8"
FT                   /protein_id="ABF31331.1"
FT                   /translation="MKDMSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTE
FT                   TTTTNEQPKPESSELTTEKAGQKMDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKS
FT                   EEDHTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTP
FT                   VDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVND
FT                   PTYANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTL
FT                   GIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPL
FT                   FVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGG
FT                   DAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRSEYVET
FT                   TSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVI
FT                   PLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            159284..159691
FT                   /locus_tag="MGAS9429_Spy0144"
FT   CDS_pept        159284..159691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR7"
FT                   /protein_id="ABF31332.1"
FT                   /translation="MKQQSYQPLRFVYLLVALFAAMLLIARPVMADGENNDPANAAYYK
FT                   GKSAGKEASWTDLTPTNPTIPEPPSDIRETTNKQHYKDGYTDGYRDGYNEGWKSQHPVL
FT                   TPVKVIWDLISHWLQQFFPNNQATTTVQSMS"
FT   gene            complement(159877..160113)
FT                   /locus_tag="MGAS9429_Spy0145"
FT   CDS_pept        complement(159877..160113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR6"
FT                   /protein_id="ABF31333.1"
FT                   /translation="MKKKLSLFMIATAAVVSLSLATPENQTVSANDTQVTCVGCPDCGP
FT                   KWSCCPLTCMRDLLRGWGKSAAYYCTWGYYYSE"
FT   gene            complement(160523..160690)
FT                   /locus_tag="MGAS9429_Spy0146"
FT   CDS_pept        complement(160523..160690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31334"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR5"
FT                   /protein_id="ABF31334.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGSHQTVSANDASYSNGFYGHTG
FT                   PDSWLLYTVW"
FT   gene            complement(160865..161152)
FT                   /locus_tag="MGAS9429_Spy0147"
FT   CDS_pept        complement(160865..161152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR4"
FT                   /protein_id="ABF31335.1"
FT                   /translation="MKNKLFLVALATVTVLGPSLATPHHQTVHAAEQAKEPQTSSMTCT
FT                   NDGSVCAGWHSLSEGDSITSNSSSNTKTSLLNWLWSLITNLWNSAKNLFI"
FT   gene            161502..162785
FT                   /gene="metB"
FT                   /locus_tag="MGAS9429_Spy0148"
FT   CDS_pept        161502..162785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="MGAS9429_Spy0148"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31336"
FT                   /db_xref="GOA:Q1JNR3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR3"
FT                   /protein_id="ABF31336.1"
FT                   /translation="MPTTFLYFSYRLADHAFLKSFLVCATIGVGPLSKREFIGVNAIAE
FT                   VHEMRENTTLLHGYTVIDEFTGAASVPIYQTSTFHNSELYCPSQKHLYTRFSNPTTEAL
FT                   EDGLACLEKATYAVAYASGMAAISTVLMLLKAGDHVIFPLEVYGGTCQFATAILPNYQI
FT                   ETSFVDMADLATVKASIRPNTRMIYLETPSNPLLKICDISELAQLAKAYGVLTVADNTF
FT                   MTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATNNEAIYNQLKLFQKNFGAIVGV
FT                   EDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLKVHYPGLDSHPNHDTHLQQAK
FT                   NGGAVLSFELASKEELMSFTHRIQLPILAVSLGGVESILSHPATMSHACLSSQARLEQG
FT                   VVDGLLRLSCGVENIEDLLADFEQALAF"
FT   gene            162996..165497
FT                   /gene="leuS"
FT                   /locus_tag="MGAS9429_Spy0149"
FT   CDS_pept        162996..165497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MGAS9429_Spy0149"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31337"
FT                   /db_xref="GOA:Q1JNR2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNR2"
FT                   /protein_id="ABF31337.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTSDQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGKEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSDFLDGLDKASAIAKMVEW
FT                   LEAEGVGNENVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   gene            165804..167237
FT                   /locus_tag="MGAS9429_Spy0150"
FT   CDS_pept        165804..167237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0150"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31338"
FT                   /db_xref="GOA:Q1JNR1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR1"
FT                   /protein_id="ABF31338.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAISSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSDVDLIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QLQFAKAKDKEAYYRGEAQ"
FT   gene            167308..167586
FT                   /locus_tag="MGAS9429_Spy0151"
FT   CDS_pept        167308..167586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0151"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31339"
FT                   /db_xref="GOA:Q1JNR0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNR0"
FT                   /protein_id="ABF31339.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            167709..168194
FT                   /locus_tag="MGAS9429_Spy0152"
FT   CDS_pept        167709..168194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0152"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31340"
FT                   /db_xref="GOA:Q1JNQ9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ9"
FT                   /protein_id="ABF31340.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVQLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   gene            168285..168947
FT                   /locus_tag="MGAS9429_Spy0153"
FT   CDS_pept        168285..168947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0153"
FT                   /product="3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31341"
FT                   /db_xref="GOA:Q1JNQ8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ8"
FT                   /protein_id="ABF31341.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAMK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIKRIWG"
FT   gene            168910..169815
FT                   /locus_tag="MGAS9429_Spy0154"
FT   CDS_pept        168910..169815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0154"
FT                   /product="L-xylulose 5-phosphate 3-epimerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31342"
FT                   /db_xref="GOA:Q1JNQ7"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ7"
FT                   /protein_id="ABF31342.1"
FT                   /translation="MPSKMKSNVSGGNFMARPIGIYEKATPKQFTWRERLQFAKDLGFD
FT                   FVEMSVDESDARLARLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPAIEA
FT                   KSLKLMKQCIELAQDLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVML
FT                   SIEIMDDPFINSIEKYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALH
FT                   LKDTYAVTETSKGQFRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETK
FT                   AAIKEAQDFLYPLIEKAGLA"
FT   gene            169793..170521
FT                   /gene="araD"
FT                   /locus_tag="MGAS9429_Spy0155"
FT   CDS_pept        169793..170521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="MGAS9429_Spy0155"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31343"
FT                   /db_xref="GOA:Q1JNQ6"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ6"
FT                   /protein_id="ABF31343.1"
FT                   /translation="MRKRGWHNMAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCR
FT                   ELGRIVIKPSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIV
FT                   HTHSTEAVGWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEF
FT                   SKRGLDPMAVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVARMNRLTEQINPRVEPAPR
FT                   YIMDKHYLRKHGPNAYYGQK"
FT   gene            170579..170725
FT                   /locus_tag="MGAS9429_Spy0156"
FT   CDS_pept        170579..170725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31344"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ5"
FT                   /protein_id="ABF31344.1"
FT                   /translation="MLIIVWASPFDLSFSMNYLNANEHKLDESYVVEFLETRYKVLVLD
FT                   QLR"
FT   gene            170846..172492
FT                   /locus_tag="MGAS9429_Spy0157"
FT   CDS_pept        170846..172492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0157"
FT                   /product="transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31345"
FT                   /db_xref="GOA:Q1JNQ4"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ4"
FT                   /protein_id="ABF31345.1"
FT                   /translation="MMILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKI
FT                   NQALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVS
FT                   TERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQ
FT                   YLYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTIN
FT                   TQDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFK
FT                   LHLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDL
FT                   LKQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDD
FT                   IAYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQ
FT                   YQSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTE
FT                   LTKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            172745..173836
FT                   /locus_tag="MGAS9429_Spy0158"
FT   CDS_pept        172745..173836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0158"
FT                   /product="metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31346"
FT                   /db_xref="GOA:Q1JNQ3"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ3"
FT                   /protein_id="ABF31346.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            174324..175520
FT                   /gene="opuAA"
FT                   /locus_tag="MGAS9429_Spy0159"
FT   CDS_pept        174324..175520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="MGAS9429_Spy0159"
FT                   /product="glycine betaine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31347"
FT                   /db_xref="GOA:Q1JNQ2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ2"
FT                   /protein_id="ABF31347.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            175536..177272
FT                   /gene="opuABC"
FT                   /locus_tag="MGAS9429_Spy0160"
FT   CDS_pept        175536..177272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuABC"
FT                   /locus_tag="MGAS9429_Spy0160"
FT                   /product="glycine betaine-binding protein"
FT                   /note="glycine betaine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31348"
FT                   /db_xref="GOA:Q1JNQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ1"
FT                   /protein_id="ABF31348.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAALAVFLIAALGRGIMTMASGMADKGETVNIAYVQWDSEVAS
FT                   THVIAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDD
FT                   LGPNLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLS
FT                   SWELVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENIN
FT                   TIARKGLKKDLPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSW
FT                   TK"
FT   gene            177403..180045
FT                   /gene="polA"
FT                   /locus_tag="MGAS9429_Spy0161"
FT   CDS_pept        177403..180045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="MGAS9429_Spy0161"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31349"
FT                   /db_xref="GOA:Q1JNQ0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNQ0"
FT                   /protein_id="ABF31349.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVRPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQFSYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKTSKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAVISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQSKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   gene            180232..180687
FT                   /locus_tag="MGAS9429_Spy0162"
FT   CDS_pept        180232..180687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0162"
FT                   /product="coA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31350"
FT                   /db_xref="GOA:Q1JNP9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP9"
FT                   /protein_id="ABF31350.1"
FT                   /translation="MIYSFQNPSEDILKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEVQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNL"
FT   gene            180739..181206
FT                   /gene="perR"
FT                   /locus_tag="MGAS9429_Spy0163"
FT   CDS_pept        180739..181206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="MGAS9429_Spy0163"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31351"
FT                   /db_xref="GOA:Q1JNP8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP8"
FT                   /protein_id="ABF31351.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQSDF"
FT   gene            181363..181662
FT                   /gene="vlg"
FT                   /locus_tag="MGAS9429_Spy0164"
FT   CDS_pept        181363..181662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vlg"
FT                   /locus_tag="MGAS9429_Spy0164"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP7"
FT                   /protein_id="ABF31352.1"
FT                   /translation="MFLTWENLFLTNQSRRRLKLLVVERSYNNVGNFLKEYFGGFFEII
FT                   NFDDLRLTMVDMVSLSSEYDVIVTDMILEQTMDSEILFFNQMAPSVVANRLTDM"
FT   gene            181884..183218
FT                   /locus_tag="MGAS9429_Spy0165"
FT   CDS_pept        181884..183218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0165"
FT                   /product="co-activator of prophage gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31353"
FT                   /db_xref="GOA:Q1JNP6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP6"
FT                   /protein_id="ABF31353.1"
FT                   /translation="MKKYLNQNVYDALIERLHFLFNEFPIVYISFSGGKDSGLLLNILL
FT                   DFRDKYYPDREIGVFHQDFEAQYSLTTKYVQETFTSLEGRKKVSLYWVCLPMATRTALS
FT                   SYEMFWYPWDDKTEDIWVRPMPSQDYVINLENNSITTYRYKMNQEDLAKQFGRWYKQIH
FT                   GNQKTVCILGNRASESLHRYSGFINKKYGYQKECWITKQFKDVWTASPLYDWSVEDIWH
FT                   AYYKFSYSYNELYDLFYKAGLKPSQMRVASPFQDYAVDSLNLYRIIDQETWVKLLGRVQ
FT                   GVNFSNIYGRTKAMGYKSIALPKGHSWKSYTQFLLSTLPVRLRNNYVRKFNKSIDFWHK
FT                   TGGGLAEETINELIEKGYRIARNGISNYTSFKHSRVIFLDQIPDDTDDIVTTKDIPSWK
FT                   RMCFCILKNDHICRTMGFGLTREQQKIVAFLKEKYKTSLKELESE"
FT   gene            183211..183741
FT                   /locus_tag="MGAS9429_Spy0166"
FT   CDS_pept        183211..183741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0166"
FT                   /product="co-activator of prophage gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31354"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP5"
FT                   /protein_id="ABF31354.1"
FT                   /translation="MSNFISPVYEIKSIPIEKISPNDYNPNSVAPPEMKLLYDSIKSDG
FT                   YTMPIVCYYDKEEDRYSIVDGFHRYRIMLDYSDIYERESGRLPVSVIDKSLDYRMASTI
FT                   RHNRARGSHDVDLMSQIVKDLHECGRSDNWIAKHLGMDKDEILRLKQITGLASLFKDHE
FT                   FNQSWEPEELLNE"
FT   gene            complement(183788..184030)
FT                   /locus_tag="MGAS9429_Spy0167"
FT   CDS_pept        complement(183788..184030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0167"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31355"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP4"
FT                   /protein_id="ABF31355.1"
FT                   /translation="MKSLYTHTFKTALNPLSATKIRHRCPPAASFNDKLEATNRLIKGI
FT                   KYNAFRFQNFDNFKTKILIALNIQKERTNLILSRC"
FT   gene            complement(184070..184285)
FT                   /locus_tag="MGAS9429_Spy0168"
FT   CDS_pept        complement(184070..184285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0168"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31356"
FT                   /db_xref="GOA:Q1JNP3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP3"
FT                   /protein_id="ABF31356.1"
FT                   /translation="MSRKGNPYDNALMESFYKTLKRELVNDAHFATIEQAQLEIFKYSE
FT                   TYYNPKRLHSALGYLSPVEFEKIVTH"
FT   gene            complement(184325..184894)
FT                   /locus_tag="MGAS9429_Spy0169"
FT   CDS_pept        complement(184325..184894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0169"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31357"
FT                   /db_xref="GOA:Q1JL58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JL58"
FT                   /protein_id="ABF31357.1"
FT                   /translation="MNSHHACQTLQVSRSGFYAYLKRRPSSRHVENEALKEMIKAIFYE
FT                   HKERYGSVRITQELCRRGIHVNYKRVGRLLHQLGLYAKGSRYQYKYYNRRRSSLTRPNL
FT                   VNQCFQATGKNKLWLGDLTYIPTQEGILYVSVFIDVYSRKIVGWAMGRRMQDKLVTEAF
FT                   NQAYNREKPKEGVIVHTDQGSQYTGA"
FT   gene            complement(184927..185142)
FT                   /locus_tag="MGAS9429_Spy0170"
FT   CDS_pept        complement(184927..185142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0170"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31358"
FT                   /db_xref="GOA:Q1JNP1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP1"
FT                   /protein_id="ABF31358.1"
FT                   /translation="MASSTLKIHPNSLYRWIQEYEKYGESAFPGHGSALRHAQFETKKL
FT                   EKEHKLLQEELALLKKFQVFLKPNRK"
FT   gene            complement(185298..186608)
FT                   /locus_tag="MGAS9429_Spy0171"
FT   CDS_pept        complement(185298..186608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0171"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31359"
FT                   /db_xref="GOA:Q1JNP0"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNP0"
FT                   /protein_id="ABF31359.1"
FT                   /translation="MIHLIIISAIALAIGIGYRTKINIGLLAIAFSYLIATTLMGLSPK
FT                   ALLHFWPTSLFFTIFSVSLFYNVATTNGTLDVLAQHILYRTRTHPDALYMILYLIATLL
FT                   SALGAGFFTTMAVCCPLAITLCQKADKHSLIGAQAVNWGASGGANLITSGSGIVFQGLF
FT                   KQMGWEEQAFSLGNHIFIVSIIYPLIVLLLLSCYIRYSKGRTNSSLTIDQPPILSKVQR
FT                   QTTLLMISSMVLVWLFPLLHLIFPNIAWIATYRQTFDIGFVSILMVCLALRLKLGKQEA
FT                   ILAKVPWAIIIMLCGMSLLMSLAVKSGLVTLIGHLITTTIPHFWLPLFFCVIAGVMSLF
FT                   SSTLSVVAPTLFPIIATISAQSPHIDIRLLTTATIIGALSTNISPFSSAGSLIQLSLPH
FT                   IEERSLAFKKQILLGVPISLSLALLTIWILMLLASLS"
FT   gene            186805..187704
FT                   /gene="nadC"
FT                   /locus_tag="MGAS9429_Spy0172"
FT   CDS_pept        186805..187704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="MGAS9429_Spy0172"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31360"
FT                   /db_xref="GOA:Q1JNN9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN9"
FT                   /protein_id="ABF31360.1"
FT                   /translation="MILKIEDLVMSIISTDLTPFQIDDTLKAALREDVHSEDYSTNAIF
FT                   DHHGQAKVSLFAKEAGVLAGLTVFQRVFTLFDAEVTFQNPHQFKDGDRLTSGDLVLEII
FT                   GSVRSLLTCERVALNFLQHLSGIASMTAAYVEALGDDRIKVFDTRKTTPNLRLFEKYAV
FT                   RVGGGYNHRFNLSDAIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVEVESLAAAEEA
FT                   AAAGVDIIMLDNMSLEQIEQAITLIAGRSRIECSGNIDMTTISRFRGLAIDYISSGSLT
FT                   HSAKSLDFSMKGLTYLDV"
FT   gene            complement(188004..188810)
FT                   /locus_tag="MGAS9429_Spy0173"
FT   CDS_pept        complement(188004..188810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0173"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31361"
FT                   /db_xref="GOA:Q1JNN8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN8"
FT                   /protein_id="ABF31361.1"
FT                   /translation="MLLEILDLSRSTYYYQVKRLAQGDKDIELKHVIREIYDEHKGNYG
FT                   YRRIHMELRNRGFVVNHKKVQRLMKVMGLAARIRRKRKYSSYKGEVGKKADNLIKRHFE
FT                   GSKPYEKCYTDVTELALPEGKLYLLPVLDGYNSEIIDFTLSRSPNLKQVQTMLEKTFPA
FT                   DSYSGTILHSDQGWQYQHQSYHDFLESKGILPSTSRKGNSPDNGMMESFFGILKSEMFY
FT                   GLETTYQSLDKLEEAITDYIFYYNNKRIKAKLKGFSPVQYRTKSFQ"
FT   gene            complement(188831..189364)
FT                   /locus_tag="MGAS9429_Spy0174"
FT   CDS_pept        complement(188831..189364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0174"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31362"
FT                   /db_xref="GOA:Q1JNN7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN7"
FT                   /protein_id="ABF31362.1"
FT                   /translation="MGCYFFMKFNQETKVKIYELRQMGESIKSISKKFDMAESDLKYMI
FT                   RLIDRYGVTIVQKCKNHYYSPELKQKIINKVLIDGQSQKQTSLDYALPTSSMLSRWIAQ
FT                   YKKNGYTILEKPRGRPSKMGRKRKKNLEEMTEVERLQKELEYLRAENAVLKKLREYRLR
FT                   DEVKLKEQQKSFKH"
FT   gene            complement(189432..190295)
FT                   /locus_tag="MGAS9429_Spy0175"
FT   CDS_pept        complement(189432..190295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0175"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31363"
FT                   /db_xref="GOA:Q1JNN6"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN6"
FT                   /protein_id="ABF31363.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGGSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDKVKEGTYLGAIAVIETSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   gene            190377..190517
FT                   /locus_tag="MGAS9429_Spy0176"
FT   CDS_pept        190377..190517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31364"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN5"
FT                   /protein_id="ABF31364.1"
FT                   /translation="MTNYGFFDKMIGARTTCHLEALHYDGNSGRSKKLKTVYLDSKEES
FT                   T"
FT   gene            190514..191656
FT                   /gene="tgt"
FT                   /locus_tag="MGAS9429_Spy0177"
FT   CDS_pept        190514..191656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="MGAS9429_Spy0177"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31365"
FT                   /db_xref="GOA:Q1JNN4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNN4"
FT                   /protein_id="ABF31365.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            191874..192185
FT                   /locus_tag="MGAS9429_Spy0178"
FT   CDS_pept        191874..192185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0178"
FT                   /product="zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31366"
FT                   /db_xref="GOA:Q1JNN3"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN3"
FT                   /protein_id="ABF31366.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   TDHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            192189..192728
FT                   /locus_tag="MGAS9429_Spy0179"
FT   CDS_pept        192189..192728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0179"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31367"
FT                   /db_xref="GOA:Q1JNN2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN2"
FT                   /protein_id="ABF31367.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALLISGVVLVDVLGAIWLAAYTGMSLVTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            192887..194029
FT                   /locus_tag="MGAS9429_Spy0180"
FT   CDS_pept        192887..194029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0180"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31368"
FT                   /db_xref="GOA:Q1JJR8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JJR8"
FT                   /protein_id="ABF31368.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETSKEMEDFIEMNEPLFATYVDLSEGCPSHDTLERVISLVNSDRLKELKVQFEQSLTSL
FT                   DAVHQLISVDGKTIRGNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIEVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLKVMVFPKKDLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            194194..194973
FT                   /locus_tag="MGAS9429_Spy0181"
FT   CDS_pept        194194..194973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0181"
FT                   /product="metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31369"
FT                   /db_xref="GOA:Q1JNN0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNN0"
FT                   /protein_id="ABF31369.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVEQIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPEGI
FT                   DPDNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            194949..195488
FT                   /locus_tag="MGAS9429_Spy0182"
FT   CDS_pept        194949..195488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0182"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31370"
FT                   /db_xref="GOA:Q1JNM9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM9"
FT                   /protein_id="ABF31370.1"
FT                   /translation="MELGESFLMPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKD
FT                   GEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGL
FT                   ARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRER
FT                   KKIAKHLIKEQSDPFD"
FT   gene            complement(196102..197334)
FT                   /locus_tag="MGAS9429_Spy0183"
FT   CDS_pept        complement(196102..197334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0183"
FT                   /product="S-layer protein"
FT                   /EC_number="3.2.1.-"
FT                   /note="peptidoglycan endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31371"
FT                   /db_xref="GOA:Q1JNM8"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM8"
FT                   /protein_id="ABF31371.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPVSKKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANTPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQSQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDYLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDNDAI
FT                   LASLENQLLNRQEPLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   gene            197734..198438
FT                   /gene="speG"
FT                   /locus_tag="MGAS9429_Spy0184"
FT   CDS_pept        197734..198438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="MGAS9429_Spy0184"
FT                   /product="enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31372"
FT                   /db_xref="GOA:Q1JNM7"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM7"
FT                   /protein_id="ABF31372.1"
FT                   /translation="MKTNILTIIILSCVFSYGSQLAYADENLKDLKRSLRFAYNITPCD
FT                   YENVEIAFVTTNSIHINTKQKRSECILYVDSIVSLGITDQFIKGDKVDVFGLPYNFSPP
FT                   YVDNIYGGIVKHSNQGNKSLQFVGILNQDGKETYLPSEVVRIKKKQFTLQEFDFKIRKF
FT                   LMEKYNIYDSESRYTSGSLFLATKDSKHYEVDLFNKDDKLLSRDSFFKRYKDNKIFNSE
FT                   EISHFDIYLKTY"
FT   gene            198526..198645
FT                   /locus_tag="MGAS9429_Spy0185"
FT   CDS_pept        198526..198645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0185"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31373"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM6"
FT                   /protein_id="ABF31373.1"
FT                   /translation="MRKYLQVIGASIAFVGVALCIDHMHDGVITRIEMIKSLK"
FT   gene            198681..198800
FT                   /locus_tag="MGAS9429_Spy0186"
FT   CDS_pept        198681..198800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM5"
FT                   /protein_id="ABF31374.1"
FT                   /translation="MIFLGNMKSYFLLKNHYDENMLALTHVLGLKKRKPFQKT"
FT   gene            198897..200246
FT                   /gene="pgi"
FT                   /locus_tag="MGAS9429_Spy0187"
FT   CDS_pept        198897..200246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="MGAS9429_Spy0187"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31375"
FT                   /db_xref="GOA:Q1JNM4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNM4"
FT                   /protein_id="ABF31375.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDKEEFARILTAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDKPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   gene            complement(200595..202103)
FT                   /locus_tag="MGAS9429_Spy0188"
FT   CDS_pept        complement(200595..202103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0188"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31376"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM3"
FT                   /protein_id="ABF31376.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFAAQKNLQPSAFLDRRFLFFDVLLMLTWKRHRYPVHLPHLALF
FT                   EHLKSLPIFDNIKTIAVDELAPRTRVTFSSDDFDYLFLIYLTTDNSFLSGYWTSHQRQQ
FT                   LYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQ
FT                   YQGNMLLLDKLETVIKDWLYDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQ
FT                   ETVGNVIANFITSTIPSYKVELSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFP
FT                   KETRLFGLSLDCIQQQREDLIKTILALHQNHYQKRLEELWRIPS"
FT   gene            202649..203791
FT                   /locus_tag="MGAS9429_Spy0189"
FT   CDS_pept        202649..203791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0189"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31377"
FT                   /db_xref="GOA:Q1JNM2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM2"
FT                   /protein_id="ABF31377.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRYPLSTILFLVFVCQLAGI
FT                   ETWKEMEDFIEMNEPLFATYVDLSEGCPSHDTLERVISLVNSGRLKELKVQFEQSLTSL
FT                   DAVHQLISVDGKTIRGNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIGVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLKVMVFPKKDLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            203775..203900
FT                   /locus_tag="MGAS9429_Spy0190"
FT   CDS_pept        203775..203900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31378"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM1"
FT                   /protein_id="ABF31378.1"
FT                   /translation="MEKEAKQMIDLKRNLFKIDVRAQKDEEKVFMRTAWLVSCQP"
FT   gene            203876..203968
FT                   /locus_tag="MGAS9429_Spy0191"
FT   CDS_pept        203876..203968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNM0"
FT                   /protein_id="ABF31379.1"
FT                   /translation="MASFLSALNLFPNLWYDKKMMKKEILKELF"
FT   gene            203981..204088
FT                   /locus_tag="MGAS9429_Spy0192"
FT   CDS_pept        203981..204088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0192"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL9"
FT                   /protein_id="ABF31380.1"
FT                   /translation="MDVDLKRQNDQALLVDVVSNQAYQRANTIAKSNDL"
FT   gene            204116..204787
FT                   /locus_tag="MGAS9429_Spy0193"
FT   CDS_pept        204116..204787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0193"
FT                   /product="integral membrane protein (Rhomboid family)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31381"
FT                   /db_xref="GOA:Q1JNL8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL8"
FT                   /protein_id="ABF31381.1"
FT                   /translation="MTQLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(204886..205791)
FT                   /gene="hasC2"
FT                   /locus_tag="MGAS9429_Spy0194"
FT   CDS_pept        complement(204886..205791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasC2"
FT                   /locus_tag="MGAS9429_Spy0194"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31382"
FT                   /db_xref="GOA:Q1JNL7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL7"
FT                   /protein_id="ABF31382.1"
FT                   /translation="MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVE
FT                   EALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIR
FT                   QSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIA
FT                   VMRVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSI
FT                   LEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQV
FT                   KDDLKAYIIQLGKALEKTKP"
FT   gene            complement(205818..206834)
FT                   /gene="gpsA"
FT                   /locus_tag="MGAS9429_Spy0195"
FT   CDS_pept        complement(205818..206834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="MGAS9429_Spy0195"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31383"
FT                   /db_xref="GOA:Q1JNL6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNL6"
FT                   /protein_id="ABF31383.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            207132..207581
FT                   /locus_tag="MGAS9429_Spy0196"
FT   CDS_pept        207132..207581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0196"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31384"
FT                   /db_xref="GOA:Q1JNL5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL5"
FT                   /protein_id="ABF31384.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            207574..209280
FT                   /locus_tag="MGAS9429_Spy0197"
FT   CDS_pept        207574..209280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0197"
FT                   /product="multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31385"
FT                   /db_xref="GOA:Q1JNL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL4"
FT                   /protein_id="ABF31385.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINRIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIVVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLVQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            209280..211067
FT                   /locus_tag="MGAS9429_Spy0198"
FT   CDS_pept        209280..211067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0198"
FT                   /product="multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31386"
FT                   /db_xref="GOA:Q1JNL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL3"
FT                   /protein_id="ABF31386.1"
FT                   /translation="MMKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLT
FT                   ELGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHS
FT                   TNRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIG
FT                   LVWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQ
FT                   KAIIVQGVQEDTMTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTI
FT                   VLSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEE
FT                   VRPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPKGKMIAVVGPTGSGKTTIM
FT                   NLINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTIS
FT                   QDMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILD
FT                   EATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHE
FT                   LLHQKGFYAELYHNQFVFE"
FT   gene            211185..211952
FT                   /locus_tag="MGAS9429_Spy0199"
FT   CDS_pept        211185..211952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0199"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31387"
FT                   /db_xref="GOA:Q1JNL2"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL2"
FT                   /protein_id="ABF31387.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            212062..212508
FT                   /locus_tag="MGAS9429_Spy0200"
FT   CDS_pept        212062..212508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0200"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31388"
FT                   /db_xref="GOA:Q1JNL1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL1"
FT                   /protein_id="ABF31388.1"
FT                   /translation="MTKIRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            212589..213950
FT                   /gene="radA"
FT                   /locus_tag="MGAS9429_Spy0201"
FT   CDS_pept        212589..213950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="MGAS9429_Spy0201"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31389"
FT                   /db_xref="GOA:Q1JNL0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNL0"
FT                   /protein_id="ABF31389.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYASGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLKAVFS"
FT   gene            214136..214636
FT                   /locus_tag="MGAS9429_Spy0202"
FT   CDS_pept        214136..214636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0202"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31390"
FT                   /db_xref="GOA:Q1JNK9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK9"
FT                   /protein_id="ABF31390.1"
FT                   /translation="MMSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVA
FT                   QALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFA
FT                   KHIHEHLGMDVSGQDFLPFQDVEDSVREDMTKIRASSLISDDVVINGAVYDVDTGKMTQ
FT                   VME"
FT   gene            214731..215477
FT                   /locus_tag="MGAS9429_Spy0203"
FT   CDS_pept        214731..215477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31391"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK8"
FT                   /protein_id="ABF31391.1"
FT                   /translation="MYQVIHTNKESKMVDNRMRFTIDQNMQFPLVEIDLGHGGSVYLQQ
FT                   GSMVYHTENVTLNTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNT
FT                   PGQIIALELGEKQYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTL
FT                   LANSFGSIKKITLDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGH
FT                   GEIYIQSLNLEQFAGTLKRYLPTSSN"
FT   gene            215659..217104
FT                   /gene="gltX"
FT                   /locus_tag="MGAS9429_Spy0204"
FT   CDS_pept        215659..217104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="MGAS9429_Spy0204"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31392"
FT                   /db_xref="GOA:Q1JNK7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNK7"
FT                   /protein_id="ABF31392.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            217499..218845
FT                   /gene="fasB"
FT                   /locus_tag="MGAS9429_Spy0205"
FT   CDS_pept        217499..218845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasB"
FT                   /locus_tag="MGAS9429_Spy0205"
FT                   /product="sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31393"
FT                   /db_xref="GOA:Q1JNK6"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK6"
FT                   /protein_id="ABF31393.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLLVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   gene            218842..220125
FT                   /gene="fasC"
FT                   /locus_tag="MGAS9429_Spy0206"
FT   CDS_pept        218842..220125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasC"
FT                   /locus_tag="MGAS9429_Spy0206"
FT                   /product="sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31394"
FT                   /db_xref="GOA:Q1JNK5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK5"
FT                   /protein_id="ABF31394.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSVIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFIYLAIFIWVIVKLDRFAKDQLSQKLTQAQNE
FT                   RIAYLENYNQSIEQLYREIRTVKHDSENILISLKDSIDSGDIDLITRVYDTVIQQSATS
FT                   MMRTNYEISSLDNIKEAVIRSIMNSKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLF
FT                   TGLVDNAIETAKGSRRPFLSIAYFKQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHF
FT                   LTVLDSYPQITLSTKSDHYRLRQLLEMR"
FT   gene            220129..220869
FT                   /gene="fasA"
FT                   /locus_tag="MGAS9429_Spy0207"
FT   CDS_pept        220129..220869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasA"
FT                   /locus_tag="MGAS9429_Spy0207"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31395"
FT                   /db_xref="GOA:Q1JNK4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK4"
FT                   /protein_id="ABF31395.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            221409..221768
FT                   /gene="fasX"
FT                   /locus_tag="MGAS9429_Spy0208"
FT   CDS_pept        221409..221768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasX"
FT                   /locus_tag="MGAS9429_Spy0208"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31396"
FT                   /db_xref="GOA:Q1JNK3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNK3"
FT                   /protein_id="ABF31396.1"
FT                   /translation="MKKTYRVKCEKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGYQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            221734..222561
FT                   /locus_tag="MGAS9429_Spy0209"
FT   CDS_pept        221734..222561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0209"
FT                   /product="60 kDa inner membrane protein YIDC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31397"
FT                   /db_xref="GOA:Q1JNK2"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK2"
FT                   /protein_id="ABF31397.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   gene            222573..223487
FT                   /locus_tag="MGAS9429_Spy0210"
FT   CDS_pept        222573..223487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0210"
FT                   /product="jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31398"
FT                   /db_xref="GOA:Q1JNK1"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK1"
FT                   /protein_id="ABF31398.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINQKNAPAVNSADVEPEEIKATQKLEAEDTK
FT                   VVPLMSEDSPAQTPSNLAETVTERKVQQPSIPVEESEVPQDPGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            223571..223693
FT                   /locus_tag="MGAS9429_Spy0211"
FT   CDS_pept        223571..223693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNK0"
FT                   /protein_id="ABF31399.1"
FT                   /translation="MIIVAIDKVSTVRQRNSVKEETLYEMSGLLNERETVEKRK"
FT   gene            223801..223935
FT                   /gene="rpmH"
FT                   /locus_tag="MGAS9429_Spy0212"
FT   CDS_pept        223801..223935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="MGAS9429_Spy0212"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31400"
FT                   /db_xref="GOA:Q1JNJ9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNJ9"
FT                   /protein_id="ABF31400.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            224209..224913
FT                   /locus_tag="MGAS9429_Spy0213"
FT   CDS_pept        224209..224913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0213"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31401"
FT                   /db_xref="GOA:Q1JNJ8"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNJ8"
FT                   /protein_id="ABF31401.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLLAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMAEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   gene            224962..226281
FT                   /locus_tag="MGAS9429_Spy0214"
FT   CDS_pept        224962..226281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0214"
FT                   /product="N-acetylneuraminate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31402"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ7"
FT                   /protein_id="ABF31402.1"
FT                   /translation="MNMKKLASLVMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTKEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMEKIAEWTKFYSPYYNTIDGF
FT                   AEMRTLWFPMVQAISNGDEKPEDALKAFTEKANKTIKKTQ"
FT   gene            226385..227272
FT                   /locus_tag="MGAS9429_Spy0215"
FT   CDS_pept        226385..227272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0215"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31403"
FT                   /db_xref="GOA:Q1JNJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ6"
FT                   /protein_id="ABF31403.1"
FT                   /translation="MNVNKLKMRETLISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYS
FT                   MTDFTFVGFANYARMFQDPIFMKSLMNTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARS
FT                   FYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNYVLKYAHVIEQNISWLGDKHWALLAI
FT                   IAILLTTSVGQPIILYIAAMGNIDNSLMEAARVDGATEFQVFWNIKWPSLLPTTLYIAV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIAII
FT                   SFAQFKILGNDVEY"
FT   gene            227285..228115
FT                   /locus_tag="MGAS9429_Spy0216"
FT   CDS_pept        227285..228115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0216"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31404"
FT                   /db_xref="GOA:Q1JNJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ5"
FT                   /protein_id="ABF31404.1"
FT                   /translation="MTKKKLTASDVLTTVILCILTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSVFISVATMFLVCGTSSLAGYALAKKRFYG
FT                   QWILFSIFIAAMALPKQVVLVPLVRIVNFIGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLISREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            228272..228934
FT                   /locus_tag="MGAS9429_Spy0217"
FT   CDS_pept        228272..228934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0217"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31405"
FT                   /db_xref="GOA:Q1JNJ4"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ4"
FT                   /protein_id="ABF31405.1"
FT                   /translation="MTSKKQGLLHSLFKLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLFTTYSSYFKHYFKRGMRLGLIELLIMSICVLDLFLI
FT                   RNQSGLVFQGFKVLCIAVLFLVVILFLYAYPQAVRKELSLSTLFKRSFLLAGLFFPWSF
FT                   AFLALICLTIFSLQLSLLTLFGGVSLLAIIGISSLTYLYLIIMESLLRRFPLNNDIE"
FT   gene            228946..229860
FT                   /gene="nanH"
FT                   /locus_tag="MGAS9429_Spy0218"
FT   CDS_pept        228946..229860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanH"
FT                   /locus_tag="MGAS9429_Spy0218"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31406"
FT                   /db_xref="GOA:Q1JNJ3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ3"
FT                   /protein_id="ABF31406.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGAISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDHIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIVDKDLEKAKTLQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            229882..230820
FT                   /locus_tag="MGAS9429_Spy0219"
FT   CDS_pept        229882..230820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0219"
FT                   /product="N-acetylmannosamine kinase"
FT                   /EC_number="2.7.1.60"
FT                   /note="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31407"
FT                   /db_xref="GOA:Q1JNJ2"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ2"
FT                   /protein_id="ABF31407.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDKGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITPEKIENNLASS"
FT   gene            complement(230931..231773)
FT                   /locus_tag="MGAS9429_Spy0220"
FT   CDS_pept        complement(230931..231773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0220"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31408"
FT                   /db_xref="GOA:Q1JNJ1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ1"
FT                   /protein_id="ABF31408.1"
FT                   /translation="MCFAMPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTA
FT                   SEIVKRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDY
FT                   DALINKTYELVNEEKLLNLAKLIDASERVYFFGKGSSGLVAREMKLRFMRLGLICDAYS
FT                   DTDGFTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSL
FT                   DIIPVSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   gene            231950..232837
FT                   /gene="tatD"
FT                   /locus_tag="MGAS9429_Spy0221"
FT   CDS_pept        231950..232837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="MGAS9429_Spy0221"
FT                   /product="DNase, TatD family"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31409"
FT                   /db_xref="GOA:Q1JNJ0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNJ0"
FT                   /protein_id="ABF31409.1"
FT                   /translation="MSASKGFYDQPKRQKFSPSFLMWLRSLCYNNIMTNKVEKLTIFDT
FT                   HTHLNVAEFQGHETEELTLAQEMGVAYHNVVGFDQATISGALALADQYPNVYATIGWHP
FT                   TEAGSYSEAVEESIVSQLSHPKVIALGEIGLDYYWMEDPKEVQIEVFKRQMQLAKDHDL
FT                   PFVVHTRDALEDTYEVIKAAGVGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKK
FT                   ALDIQEAAQHLPLDKILVETDAPYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVA
FT                   KETTANAKRVFKLD"
FT   gene            232788..233399
FT                   /locus_tag="MGAS9429_Spy0222"
FT   CDS_pept        232788..233399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0222"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31410"
FT                   /db_xref="GOA:Q1JNI9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI9"
FT                   /protein_id="ABF31410.1"
FT                   /translation="MQKKRLLMQRGYLSLTEKINIQEVLVVEGKDDTANLRRFYEVDTY
FT                   ETRGSAITEEDLERINRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAV
FT                   PSSKSKGRSLGVEHANFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRR
FT                   EYLGEKLRIGYANGKQLLKRLELFGITLAEVEEVMETYEE"
FT   gene            233489..234385
FT                   /gene="ksgA"
FT                   /locus_tag="MGAS9429_Spy0223"
FT   CDS_pept        233489..234385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="MGAS9429_Spy0223"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31411"
FT                   /db_xref="GOA:Q1JNI8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNI8"
FT                   /protein_id="ABF31411.1"
FT                   /translation="MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQK
FT                   IVDTAEIDQNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQV
FT                   VNQDILKADLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQRE
FT                   VADRISAEPNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLI
FT                   EVKDEDFFFRVSRLSFVHRRKTLWNNLTSHFGKSEDIKAKLEKGLALADIKPSIRGEAL
FT                   SIQDFGKLADALKEVGL"
FT   gene            234809..235132
FT                   /locus_tag="MGAS9429_Spy0224"
FT   CDS_pept        234809..235132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0224"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31412"
FT                   /db_xref="GOA:Q1JNI7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI7"
FT                   /protein_id="ABF31412.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HLA"
FT   gene            235104..235706
FT                   /locus_tag="MGAS9429_Spy0225"
FT   CDS_pept        235104..235706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0225"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31413"
FT                   /db_xref="GOA:Q1JNI6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI6"
FT                   /protein_id="ABF31413.1"
FT                   /translation="MNTKPFILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYD
FT                   FVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAV
FT                   SFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVK
FT                   AALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK"
FT   gene            235716..236378
FT                   /gene="rpe"
FT                   /locus_tag="MGAS9429_Spy0226"
FT   CDS_pept        235716..236378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="MGAS9429_Spy0226"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31414"
FT                   /db_xref="GOA:Q1JNI5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI5"
FT                   /protein_id="ABF31414.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGTLQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALHD"
FT   gene            236371..237003
FT                   /locus_tag="MGAS9429_Spy0227"
FT   CDS_pept        236371..237003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0227"
FT                   /product="thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31415"
FT                   /db_xref="GOA:Q1JNI4"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI4"
FT                   /protein_id="ABF31415.1"
FT                   /translation="MTKVALFSGGDLSYFTREFDYFVGIDSGSLFLLENGLPLNMAVGD
FT                   FDSVSQEAFTDIKEKAELFITAHPEKNDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            237005..238276
FT                   /locus_tag="MGAS9429_Spy0228"
FT   CDS_pept        237005..238276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0228"
FT                   /product="RmuC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31416"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI3"
FT                   /protein_id="ABF31416.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEKINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            238266..239204
FT                   /gene="cbf"
FT                   /locus_tag="MGAS9429_Spy0229"
FT   CDS_pept        238266..239204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbf"
FT                   /locus_tag="MGAS9429_Spy0229"
FT                   /product="CMP-binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31417"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI2"
FT                   /protein_id="ABF31417.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVEEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            239471..240310
FT                   /gene="purR"
FT                   /locus_tag="MGAS9429_Spy0230"
FT   CDS_pept        239471..240310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="MGAS9429_Spy0230"
FT                   /product="pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31418"
FT                   /db_xref="GOA:Q1JNI1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI1"
FT                   /protein_id="ABF31418.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEANIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSENDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            240283..242922
FT                   /gene="prgA"
FT                   /locus_tag="MGAS9429_Spy0231"
FT   CDS_pept        240283..242922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prgA"
FT                   /locus_tag="MGAS9429_Spy0231"
FT                   /product="surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31419"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNI0"
FT                   /protein_id="ABF31419.1"
FT                   /translation="MEKGERMDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDR
FT                   ASGETKASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHL
FT                   KEQQDNEQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQADQHSKET
FT                   ALSEQKASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSS
FT                   ELEKAKADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMK
FT                   APQGYPLEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFV
FT                   DPDNLTPEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRP
FT                   SFVYGQPGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGI
FT                   YDSIKYMLFTDHLHGNTYGHAINFLRVDKHNPNAPVYLGFSTSNVGSLNEHFVMFPESN
FT                   IANHQRFNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQ
FT                   AKVSQLQGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKL
FT                   ASLKAALHQTEALAEQAAARVTALVAKKAHLQYLKDFKLNPNRLQVIRERIDNTKQDLA
FT                   KTTSSLLNAQEALAALQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDL
FT                   QVAPSLTGVKPLSYSKVETTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEM
FT                   VASNAIVSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTG
FT                   FRFRKESR"
FT   gene            243130..243543
FT                   /gene="rpsL"
FT                   /locus_tag="MGAS9429_Spy0232"
FT   CDS_pept        243130..243543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="MGAS9429_Spy0232"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31420"
FT                   /db_xref="GOA:Q1JNH9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNH9"
FT                   /protein_id="ABF31420.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            243564..244034
FT                   /gene="rpsG"
FT                   /locus_tag="MGAS9429_Spy0233"
FT   CDS_pept        243564..244034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="MGAS9429_Spy0233"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31421"
FT                   /db_xref="GOA:Q1JNH8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNH8"
FT                   /protein_id="ABF31421.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            244401..246479
FT                   /gene="fus"
FT                   /locus_tag="MGAS9429_Spy0234"
FT   CDS_pept        244401..246479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="MGAS9429_Spy0234"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31422"
FT                   /db_xref="GOA:Q1JNH7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNH7"
FT                   /protein_id="ABF31422.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            246800..247837
FT                   /gene="plr"
FT                   /locus_tag="MGAS9429_Spy0235"
FT   CDS_pept        246800..247837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /locus_tag="MGAS9429_Spy0235"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31423"
FT                   /db_xref="GOA:Q1JNH6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH6"
FT                   /protein_id="ABF31423.1"
FT                   /translation="MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLT
FT                   DPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLE
FT                   ATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTT
FT                   NCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTG
FT                   AAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFG
FT                   YTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYF
FT                   AKIAK"
FT   gene            complement(248063..248179)
FT                   /locus_tag="MGAS9429_Spy0236"
FT   CDS_pept        complement(248063..248179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH5"
FT                   /protein_id="ABF31424.1"
FT                   /translation="MAEKTDLSSAYRRLKSPNIKTRKRALKIIHEYKRYGKK"
FT   gene            complement(248321..249130)
FT                   /locus_tag="MGAS9429_Spy0237"
FT   CDS_pept        complement(248321..249130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0237"
FT                   /product="amino acid transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31425"
FT                   /db_xref="GOA:Q1JNH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH4"
FT                   /protein_id="ABF31425.1"
FT                   /translation="MNAVSMPILTPLEQTKCRLRRSQMSNSIIEIKNLKKSYGSNEVLK
FT                   DISLSVNKGEVISIIGSSGSGKSTLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYRE
FT                   KLGMVFQSFNLFENLNVLENAIVAQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPK
FT                   QLSGGQKQRVAIARALSVNPEAMLFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTH
FT                   EMEFARDVSDRIIFMDKGLIAEEGSPQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(249054..250640)
FT                   /locus_tag="MGAS9429_Spy0238"
FT   CDS_pept        complement(249054..250640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0238"
FT                   /product="ABC transporter amino acid-binding protein"
FT                   /note="amino acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31426"
FT                   /db_xref="GOA:Q1JNH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH3"
FT                   /protein_id="ABF31426.1"
FT                   /translation="MKQETYMKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPF
FT                   NWTQDDASNGAVPIEGTSQYANGYDVQVAKKVAKAMNKELLVVKTSWTGLIPALTSGKI
FT                   DMIAAGMSPTKERRNEISFSNSYYTSQPVLVVTANGKYAEAKSLKDFSGAKVTAQQGVW
FT                   HVNLLTQLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKK
FT                   GFAVAESDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKA
FT                   SFLGQMWAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALG
FT                   QKLFGWLLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSE
FT                   IVRGGIFAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLN
FT                   VISVVELYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRHIERRFDADTYTTGA
FT                   NQMQIAEVSNV"
FT   gene            250820..252745
FT                   /locus_tag="MGAS9429_Spy0239"
FT   CDS_pept        250820..252745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0239"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31427"
FT                   /db_xref="GOA:Q1JNH2"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH2"
FT                   /protein_id="ABF31427.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRTGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVIWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKNKIVALETKISRRRTLLQLLFGKVIPLVEVGFLLSQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEVRQSSEQVIKAMKKASATITNNVLETIKKLNLPDTYRQMTPAEKRKS
FT                   HSVQGLGCLLVVLNSSLLIYLTMKGSGLALIYLALMVLMMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGG
FT                   GGGGAF"
FT   gene            252811..253650
FT                   /gene="bacA"
FT                   /locus_tag="MGAS9429_Spy0240"
FT   CDS_pept        252811..253650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="MGAS9429_Spy0240"
FT                   /product="bacitracin resistance protein (putative
FT                   undecaprenol kinase)"
FT                   /EC_number="2.7.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31428"
FT                   /db_xref="GOA:Q1JNH1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNH1"
FT                   /protein_id="ABF31428.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTDLARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTHYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            253790..254557
FT                   /gene="mecA"
FT                   /locus_tag="MGAS9429_Spy0241"
FT   CDS_pept        253790..254557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="MGAS9429_Spy0241"
FT                   /product="negative regulator of genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31429"
FT                   /db_xref="GOA:Q1JNH0"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNH0"
FT                   /protein_id="ABF31429.1"
FT                   /translation="MRMEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYS
FT                   VMDELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPED
FT                   FFKSLEQSMREKGDVKAHEKLEKIEEIMEDVVEATLANQSEAADPSTNHESEPLDYVHY
FT                   VLDFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEH
FT                   ANPGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   gene            254564..255733
FT                   /locus_tag="MGAS9429_Spy0242"
FT   CDS_pept        254564..255733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0242"
FT                   /product="undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31430"
FT                   /db_xref="GOA:Q1JNG9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG9"
FT                   /protein_id="ABF31430.1"
FT                   /translation="MFSFTIDYVLVLIGALLMSLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFMSFLVASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAVIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQKDFFLTLTILVLISAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            255703..255828
FT                   /gene="rgpG"
FT                   /locus_tag="MGAS9429_Spy0243"
FT   CDS_pept        255703..255828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="MGAS9429_Spy0243"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31431"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG8"
FT                   /protein_id="ABF31431.1"
FT                   /translation="MERKEGFETLKKPSKAFFAIIDAVTIIKKAVQMTLSFLEMV"
FT   gene            255855..256625
FT                   /locus_tag="MGAS9429_Spy0244"
FT   CDS_pept        255855..256625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0244"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31432"
FT                   /db_xref="GOA:Q1JNG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG7"
FT                   /protein_id="ABF31432.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            256720..257982
FT                   /locus_tag="MGAS9429_Spy0245"
FT   CDS_pept        256720..257982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0245"
FT                   /product="SufD protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31433"
FT                   /db_xref="GOA:Q1JNG6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG6"
FT                   /protein_id="ABF31433.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPELELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKISANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDANIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRVLMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLNQETAERLVIRGFLGAVIAE
FT                   IPIPSVHQEIIKVLDEKLLNR"
FT   gene            258013..259239
FT                   /gene="nifS3"
FT                   /locus_tag="MGAS9429_Spy0246"
FT   CDS_pept        258013..259239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS3"
FT                   /locus_tag="MGAS9429_Spy0246"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /EC_number="4.4.1.16"
FT                   /note="selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31434"
FT                   /db_xref="GOA:Q1JNG5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG5"
FT                   /protein_id="ABF31434.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLANKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMINFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQPSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            259226..259705
FT                   /gene="nifU"
FT                   /locus_tag="MGAS9429_Spy0247"
FT   CDS_pept        259226..259705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="MGAS9429_Spy0247"
FT                   /product="IscU protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31435"
FT                   /db_xref="GOA:Q1JNG4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG4"
FT                   /protein_id="ABF31435.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   gene            259698..261116
FT                   /locus_tag="MGAS9429_Spy0248"
FT   CDS_pept        259698..261116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0248"
FT                   /product="ABC transporter-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31436"
FT                   /db_xref="GOA:Q1JNG3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG3"
FT                   /protein_id="ABF31436.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(261268..262449)
FT                   /locus_tag="MGAS9429_Spy0249"
FT   CDS_pept        complement(261268..262449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0249"
FT                   /product="D-alanyl-D-alanine serine-type carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31437"
FT                   /db_xref="GOA:Q1JNG2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG2"
FT                   /protein_id="ABF31437.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHAEDVMDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIVAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYTFLRKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNHNHTFLLICLAIFIITILLLSLVVFAMGRQ"
FT   gene            complement(262617..263849)
FT                   /gene="dacA2"
FT                   /locus_tag="MGAS9429_Spy0250"
FT   CDS_pept        complement(262617..263849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA2"
FT                   /locus_tag="MGAS9429_Spy0250"
FT                   /product="D-alanyl-D-alanine serine-type carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31438"
FT                   /db_xref="GOA:Q1JNG1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG1"
FT                   /protein_id="ABF31438.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFAGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            264171..266150
FT                   /gene="oppA"
FT                   /locus_tag="MGAS9429_Spy0251"
FT   CDS_pept        264171..266150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="MGAS9429_Spy0251"
FT                   /product="oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31439"
FT                   /db_xref="GOA:Q1JNG0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNG0"
FT                   /protein_id="ABF31439.1"
FT                   /translation="MTFMKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVF
FT                   VNDPKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLR
FT                   DGVSWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEV
FT                   GVKALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAY
FT                   FLSAFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYP
FT                   NDPTYKSAKKNYADNITYGMLTGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDF
FT                   RQAIQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEW
FT                   KDVNLADAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFK
FT                   QSVEASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDI
FT                   MSPVGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAY
FT                   LTDNAVDIPVVALGGTPRVTKAVPFSGGFSWAGSKGPLAYKGMKLQDKPVTAKQYENAK
FT                   EKWMKAKAKSNAKYAEKLADHVEK"
FT   gene            266203..267717
FT                   /gene="oppB"
FT                   /locus_tag="MGAS9429_Spy0252"
FT   CDS_pept        266203..267717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="MGAS9429_Spy0252"
FT                   /product="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31440"
FT                   /db_xref="GOA:Q1JNF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF9"
FT                   /protein_id="ABF31440.1"
FT                   /translation="MRITMKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDP
FT                   NYNKMTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYKK
FT                   YIDSLGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARY
FT                   IRLEKDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVIS
FT                   QGQGRTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVD
FT                   PSMIHNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYV
FT                   VRFLGGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRF
FT                   ARSKGLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSI
FT                   KSANNSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            267717..268643
FT                   /gene="oppC"
FT                   /locus_tag="MGAS9429_Spy0253"
FT   CDS_pept        267717..268643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="MGAS9429_Spy0253"
FT                   /product="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31441"
FT                   /db_xref="GOA:Q1JNF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF8"
FT                   /protein_id="ABF31441.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            268652..269722
FT                   /gene="oppD"
FT                   /locus_tag="MGAS9429_Spy0254"
FT   CDS_pept        268652..269722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="MGAS9429_Spy0254"
FT                   /product="oligopeptide transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31442"
FT                   /db_xref="GOA:Q1JNF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF7"
FT                   /protein_id="ABF31442.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGRQITEVIIKHQKVSNAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            269715..270638
FT                   /gene="oppF"
FT                   /locus_tag="MGAS9429_Spy0255"
FT   CDS_pept        269715..270638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="MGAS9429_Spy0255"
FT                   /product="oligopeptide transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31443"
FT                   /db_xref="GOA:Q1JNF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF6"
FT                   /protein_id="ABF31443.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   gene            complement(270787..271026)
FT                   /locus_tag="MGAS9429_Spy0256"
FT   CDS_pept        complement(270787..271026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0256"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31444"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF5"
FT                   /protein_id="ABF31444.1"
FT                   /translation="MRKQEQDHHKQDVNQKKPEEMTKLERPQEENEYLRTEVAYLKKPR
FT                   ELRLKEASLQRRRQKTIIKNGQRRALIRFSFKDG"
FT   gene            complement(271401..271535)
FT                   /locus_tag="MGAS9429_Spy0257"
FT   CDS_pept        complement(271401..271535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31445"
FT                   /db_xref="GOA:Q1JK14"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JK14"
FT                   /protein_id="ABF31445.1"
FT                   /translation="MVRLIQFSKVLTSPKKQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            271643..273471
FT                   /locus_tag="MGAS9429_SpyR0010"
FT   rRNA            271643..273471
FT                   /locus_tag="MGAS9429_SpyR0010"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            273225..273300
FT                   /locus_tag="MGAS9429_SpyT0042"
FT   tRNA            273225..273300
FT                   /locus_tag="MGAS9429_SpyT0042"
FT                   /product="tRNA-Ala"
FT   gene            273596..276498
FT                   /locus_tag="MGAS9429_SpyR0011"
FT   rRNA            273596..276498
FT                   /locus_tag="MGAS9429_SpyR0011"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            276583..276699
FT                   /locus_tag="MGAS9429_SpyR0012"
FT   rRNA            276583..276699
FT                   /locus_tag="MGAS9429_SpyR0012"
FT                   /product="5S RNA"
FT   gene            276705..276778
FT                   /locus_tag="MGAS9429_SpyT0043"
FT   tRNA            276705..276778
FT                   /locus_tag="MGAS9429_SpyT0043"
FT                   /product="tRNA-Asn"
FT   gene            276858..276931
FT                   /locus_tag="MGAS9429_SpyT0044"
FT   tRNA            276858..276931
FT                   /locus_tag="MGAS9429_SpyT0044"
FT                   /product="tRNA-Arg"
FT   gene            277023..277508
FT                   /gene="comX1-1"
FT                   /locus_tag="MGAS9429_Spy0258"
FT   CDS_pept        277023..277508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1-1"
FT                   /locus_tag="MGAS9429_Spy0258"
FT                   /product="competence-specific sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JK15"
FT                   /protein_id="ABF31446.1"
FT                   /translation="MSIETRAAFEKVKPIILKLKRHYYIQLWDRDDWLQEGHIILLQLL
FT                   ERYPELIEEEERLYRYFKTKFSSYLKDLLRRQESQKRQFHKLAYEEIGEVAHAIPSRGL
FT                   WLDDYVAYQEVIASLENQLNSQERMQFQALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   gene            278010..278594
FT                   /locus_tag="MGAS9429_Spy0259"
FT   CDS_pept        278010..278594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0259"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31447"
FT                   /db_xref="GOA:Q1JNF2"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF2"
FT                   /protein_id="ABF31447.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   gene            278594..279712
FT                   /locus_tag="MGAS9429_Spy0260"
FT   CDS_pept        278594..279712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0260"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31448"
FT                   /db_xref="GOA:Q1JNF1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF1"
FT                   /protein_id="ABF31448.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIERINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGNKDVITTSRFPGTTLDKIEIPLDDGTFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLSRFDFINGERQGFTAL
FT                   FDNQLELHRTKLAGADAFYDKHVGTLLTPPDKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            279737..280045
FT                   /locus_tag="MGAS9429_Spy0261"
FT   CDS_pept        279737..280045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0261"
FT                   /product="hypothetical RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31449"
FT                   /db_xref="GOA:Q1JNF0"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNF0"
FT                   /protein_id="ABF31449.1"
FT                   /translation="MLTSKQRAFLKSEAHSLKPIVQIGKNGLNDHIKTSIRQALDAREL
FT                   IKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSAKKENRKLSPKVKAI"
FT   gene            280114..280746
FT                   /gene="nadD"
FT                   /locus_tag="MGAS9429_Spy0262"
FT   CDS_pept        280114..280746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="MGAS9429_Spy0262"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31450"
FT                   /db_xref="GOA:Q1JNE9"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE9"
FT                   /protein_id="ABF31450.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   gene            280743..281336
FT                   /locus_tag="MGAS9429_Spy0263"
FT   CDS_pept        280743..281336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0263"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31451"
FT                   /db_xref="GOA:Q1JNE8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE8"
FT                   /protein_id="ABF31451.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECPDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LKDKDILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAKLDLNQAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEY"
FT   gene            281312..281713
FT                   /locus_tag="MGAS9429_Spy0264"
FT   CDS_pept        281312..281713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0264"
FT                   /product="iojap protein family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31452"
FT                   /db_xref="GOA:Q1JNE7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE7"
FT                   /protein_id="ABF31452.1"
FT                   /translation="MQLFKGILMDNDMRNKMKKEELLKIVVEATDEKRAKDILALDLEG
FT                   LTSLTDYFVIASATNSRQLEAIADNIREKVKETGGDASHVEGNSQAGWVLLDLTDVVVH
FT                   LFLEDERYHYNLEKLWHEAPAVALDAYLA"
FT   gene            281713..282504
FT                   /locus_tag="MGAS9429_Spy0265"
FT   CDS_pept        281713..282504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0265"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31453"
FT                   /db_xref="GOA:Q1JNE6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE6"
FT                   /protein_id="ABF31453.1"
FT                   /translation="MLQRDLVNTTGFLRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSL
FT                   RHLPKSKGRNRLLELACGTGIQSVRFAQAGFDVTGLDLSQDMLAIAKKRAQSAKKKIDF
FT                   IQGNMLDLSQVGQFDFVTCYSDSICYMQDEVDVGDVFKEVYDVLANDGIFIFDVHSTYQ
FT                   TDECFPGYSYHENADDFAMVWDTYADEVPHSVVHELTFFIQEDDGRFSRFDEVHEERTY
FT                   ELLTYDILLEQAGFKSFKLYADFEDKEPTETSKRWFFVAYK"
FT   gene            282726..283832
FT                   /locus_tag="MGAS9429_Spy0266"
FT   CDS_pept        282726..283832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0266"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31454"
FT                   /db_xref="GOA:Q1JNE5"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNE5"
FT                   /protein_id="ABF31454.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTENVIDYQ
FT                   KLIKVYEKKSEQMTAYLSTLEDTLSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILTYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKNERLN"
FT   gene            284169..284324
FT                   /locus_tag="MGAS9429_Spy0267"
FT   CDS_pept        284169..284324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE4"
FT                   /protein_id="ABF31455.1"
FT                   /translation="MVFIVMLKTILYFYFTKAFQSAIIRELESILVTLMLTIFNKILLK
FT                   GDKNGT"
FT   gene            284314..285030
FT                   /locus_tag="MGAS9429_Spy0268"
FT   CDS_pept        284314..285030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0268"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31456"
FT                   /db_xref="GOA:Q1JNE3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNE3"
FT                   /protein_id="ABF31456.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   gene            285233..286075
FT                   /locus_tag="MGAS9429_Spy0269"
FT   CDS_pept        285233..286075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0269"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31457"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE2"
FT                   /protein_id="ABF31457.1"
FT                   /translation="MIKKQYLGRATIALASTLVLAACGSSKTAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYRVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   gene            286402..287247
FT                   /locus_tag="MGAS9429_Spy0270"
FT   CDS_pept        286402..287247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0270"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31458"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNE1"
FT                   /protein_id="ABF31458.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            287502..288566
FT                   /locus_tag="MGAS9429_Spy0271"
FT   CDS_pept        287502..288566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0271"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31459"
FT                   /db_xref="GOA:Q1JNE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNE0"
FT                   /protein_id="ABF31459.1"
FT                   /translation="MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFDQGKVQLSANALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSNPKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            288567..289259
FT                   /locus_tag="MGAS9429_Spy0272"
FT   CDS_pept        288567..289259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0272"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31460"
FT                   /db_xref="GOA:Q1JND9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND9"
FT                   /protein_id="ABF31460.1"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSVFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(289313..290683)
FT                   /gene="braB"
FT                   /locus_tag="MGAS9429_Spy0273"
FT   CDS_pept        complement(289313..290683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braB"
FT                   /locus_tag="MGAS9429_Spy0273"
FT                   /product="branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31461"
FT                   /db_xref="GOA:Q1JND8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND8"
FT                   /protein_id="ABF31461.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAIFYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNTTNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDAFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFIDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKCFNNDPIVYRTTIGLTFIPAI
FT                   FDALLTLSQMTGLFHLPEAVVTFFQKTVPLGQFSMGWIIFAAIGFLIGLILSKTKKS"
FT   gene            290917..292131
FT                   /locus_tag="MGAS9429_Spy0274"
FT   CDS_pept        290917..292131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0274"
FT                   /product="serine/threonine sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31462"
FT                   /db_xref="GOA:Q1JND7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JND7"
FT                   /protein_id="ABF31462.1"
FT                   /translation="MKKIYDLWVRVSLIKKIGIGVVIGVMLGILAPDLTGFSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGKQTNMTLIIVLYLFGTFASALVAVLTAYLFPLTL
FT                   VLNTPVNTELSPPQGVAEVFQSLLLKLVDNPINALATANYIGVLSWAIIFGLALKAASQ
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFTTISENGVGILSDYAFLILVLVGTMV
FT                   FVALVVNPLIAVLITRQNPYPLVLRCLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIPIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKKA"
FT   gene            complement(292186..292860)
FT                   /locus_tag="MGAS9429_Spy0275"
FT   CDS_pept        complement(292186..292860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0275"
FT                   /product="potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31463"
FT                   /db_xref="GOA:Q1JND6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND6"
FT                   /protein_id="ABF31463.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(292870..294261)
FT                   /locus_tag="MGAS9429_Spy0276"
FT   CDS_pept        complement(292870..294261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0276"
FT                   /product="potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31464"
FT                   /db_xref="GOA:Q1JND5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND5"
FT                   /protein_id="ABF31464.1"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSIEAFAAIVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSTAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(294331..295044)
FT                   /gene="gidB"
FT                   /locus_tag="MGAS9429_Spy0277"
FT   CDS_pept        complement(294331..295044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="MGAS9429_Spy0277"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31465"
FT                   /db_xref="GOA:Q1JND4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JND4"
FT                   /protein_id="ABF31465.1"
FT                   /translation="MTPQDFYRTLEEDGFSLSSKQKEQFDTYFKLLVEWNTKINLTAIT
FT                   EENEVYPQHFYDSIAPILQAFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDVVTARAVARMQVLSELTIPF
FT                   LKIGGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            295194..295751
FT                   /gene="lemA"
FT                   /locus_tag="MGAS9429_Spy0278"
FT   CDS_pept        295194..295751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="MGAS9429_Spy0278"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31466"
FT                   /db_xref="GOA:Q1JND3"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND3"
FT                   /protein_id="ABF31466.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            295798..296694
FT                   /locus_tag="MGAS9429_Spy0279"
FT   CDS_pept        295798..296694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0279"
FT                   /product="endopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31467"
FT                   /db_xref="GOA:Q1JND2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JND2"
FT                   /protein_id="ABF31467.1"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            296925..297461
FT                   /locus_tag="MGAS9429_Spy0280"
FT   CDS_pept        296925..297461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0280"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31468"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND1"
FT                   /protein_id="ABF31468.1"
FT                   /translation="MMLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGN
FT                   VRYDKGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLV
FT                   LVLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQ
FT                   KENNPFASLQGLFDE"
FT   gene            297494..297598
FT                   /locus_tag="MGAS9429_Spy0281"
FT   CDS_pept        297494..297598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31469"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JND0"
FT                   /protein_id="ABF31469.1"
FT                   /translation="MKKQLFFDILFREYGYLSKVEGILTIEGKEGNDY"
FT   gene            297728..298414
FT                   /gene="covR"
FT                   /locus_tag="MGAS9429_Spy0282"
FT   CDS_pept        297728..298414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covR"
FT                   /locus_tag="MGAS9429_Spy0282"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31470"
FT                   /db_xref="GOA:Q1JNC9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC9"
FT                   /protein_id="ABF31470.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEK
FT                   EFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   NILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   gene            298420..299922
FT                   /gene="covS"
FT                   /locus_tag="MGAS9429_Spy0283"
FT   CDS_pept        298420..299922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covS"
FT                   /locus_tag="MGAS9429_Spy0283"
FT                   /product="transmembrane histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31471"
FT                   /db_xref="GOA:Q1JNC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC8"
FT                   /protein_id="ABF31471.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVGNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAGL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSKES"
FT   gene            300137..300631
FT                   /locus_tag="MGAS9429_Spy0284"
FT   CDS_pept        300137..300631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0284"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31472"
FT                   /db_xref="GOA:Q1JNC7"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNC7"
FT                   /protein_id="ABF31472.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            300615..301790
FT                   /gene="dnaB"
FT                   /locus_tag="MGAS9429_Spy0285"
FT   CDS_pept        300615..301790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="MGAS9429_Spy0285"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31473"
FT                   /db_xref="GOA:Q1JNC6"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC6"
FT                   /protein_id="ABF31473.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAVSIYQYFIHF
FT                   FDDGLQRHKFSDILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGDLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKATAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKTSQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            301791..302693
FT                   /gene="dnaI"
FT                   /locus_tag="MGAS9429_Spy0286"
FT   CDS_pept        301791..302693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="MGAS9429_Spy0286"
FT                   /product="primosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31474"
FT                   /db_xref="GOA:Q1JNC5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC5"
FT                   /protein_id="ABF31474.1"
FT                   /translation="MEKIGETMAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWATIKGSDETWQAKRV
FT                   MERVRYLAREFHLEGANRR"
FT   gene            302756..304066
FT                   /gene="pgdA"
FT                   /locus_tag="MGAS9429_Spy0287"
FT   CDS_pept        302756..304066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgdA"
FT                   /locus_tag="MGAS9429_Spy0287"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31475"
FT                   /db_xref="GOA:Q1JNC4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNC4"
FT                   /protein_id="ABF31475.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTIDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            304273..307371
FT                   /gene="snf"
FT                   /locus_tag="MGAS9429_Spy0288"
FT   CDS_pept        304273..307371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="MGAS9429_Spy0288"
FT                   /product="SWF/SNF family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31476"
FT                   /db_xref="GOA:Q1JNC3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC3"
FT                   /protein_id="ABF31476.1"
FT                   /translation="MMARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYG
FT                   ADDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKMTSFG
FT                   SLFLDSLAMNEDDSVKYRLSALGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLI
FT                   KKEGFYQIGKNYFEQLSWLQFDPSSQDLIEFLWRLASNTDKGDNENIFPNHARHLRLPS
FT                   GFFEEGIHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVYRKSIELQIAEKN
FT                   VQYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSD
FT                   FKQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASH
FT                   LKKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQ
FT                   VKEMPKIAIRRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQ
FT                   KVSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFS
FT                   IKPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKV
FT                   LILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQIRDQIIEEGHQITITSYSSFRQDFET
FT                   YQAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVL
FT                   PGLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIETNYSNEMTDEQKAIYL
FT                   AQLRQMKDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMDYQGKSGKLDSLRILL
FT                   TQIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKD
FT                   AFLISLKAGGVGINLPGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGT
FT                   IEEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   gene            307614..308216
FT                   /locus_tag="MGAS9429_Spy0289"
FT   CDS_pept        307614..308216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0289"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31477"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC2"
FT                   /protein_id="ABF31477.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IARNEEFTAKATSRQAPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMAYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            308256..309584
FT                   /gene="murC"
FT                   /locus_tag="MGAS9429_Spy0290"
FT   CDS_pept        308256..309584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="MGAS9429_Spy0290"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31478"
FT                   /db_xref="GOA:Q1JNC1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNC1"
FT                   /protein_id="ABF31478.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIINDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            309630..310112
FT                   /locus_tag="MGAS9429_Spy0291"
FT   CDS_pept        309630..310112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0291"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31479"
FT                   /db_xref="GOA:Q1JNC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNC0"
FT                   /protein_id="ABF31479.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEERIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            310224..311798
FT                   /locus_tag="MGAS9429_Spy0292"
FT   CDS_pept        310224..311798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0292"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31480"
FT                   /db_xref="GOA:Q1JNB9"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB9"
FT                   /protein_id="ABF31480.1"
FT                   /translation="MALTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKEL
FT                   EAKEAAKRTAQLYAEYKRQDAFQKESIAHNNKTAKHFQAIKGAVMTSEALKPTLLSEKE
FT                   NSSLKTTNKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLI
FT                   SSIIITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNS
FT                   TVFSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTI
FT                   KQIAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIY
FT                   RLEGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVE
FT                   KEGSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPY
FT                   NIYTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEK
FT                   YVNSQIQ"
FT   gene            311823..312353
FT                   /gene="greA"
FT                   /locus_tag="MGAS9429_Spy0293"
FT   CDS_pept        311823..312353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="MGAS9429_Spy0293"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31481"
FT                   /db_xref="GOA:Q1JNB8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB8"
FT                   /protein_id="ABF31481.1"
FT                   /translation="MFVFLIRSKKKREKTIMAEKTYPMTLTEKEQLEKELEELKLVRRP
FT                   EIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVA
FT                   IGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAA
FT                   TYDVEIISVEKTN"
FT   gene            complement(312568..312711)
FT                   /locus_tag="MGAS9429_Spy0294"
FT   CDS_pept        complement(312568..312711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0294"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31482"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB7"
FT                   /protein_id="ABF31482.1"
FT                   /translation="MESIVLRKETYQTYSFKIKQEIINKVLQNGQSLVSVSLDYTLPIL
FT                   KI"
FT   gene            complement(312977..313900)
FT                   /locus_tag="MGAS9429_Spy0295"
FT   CDS_pept        complement(312977..313900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0295"
FT                   /product="60 kDa inner membrane protein YIDC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31483"
FT                   /db_xref="GOA:Q1JNB6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB6"
FT                   /protein_id="ABF31483.1"
FT                   /translation="MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPIN
FT                   KRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(313982..314293)
FT                   /locus_tag="MGAS9429_Spy0296"
FT   CDS_pept        complement(313982..314293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0296"
FT                   /product="acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31484"
FT                   /db_xref="GOA:Q1JNB5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB5"
FT                   /protein_id="ABF31484.1"
FT                   /translation="MCYNKSKEALLMQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGR
FT                   VWNNNDGTVEILAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGN"
FT   gene            314521..315258
FT                   /locus_tag="MGAS9429_Spy0297"
FT   CDS_pept        314521..315258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0297"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31485"
FT                   /db_xref="GOA:Q1JNB4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB4"
FT                   /protein_id="ABF31485.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMVERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFDGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYETPILATTLSKKSVDYKSLTHHERLALVLGNEGQGISAEMAALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            315297..315797
FT                   /locus_tag="MGAS9429_Spy0298"
FT   CDS_pept        315297..315797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0298"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31486"
FT                   /db_xref="GOA:Q1JNB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB3"
FT                   /protein_id="ABF31486.1"
FT                   /translation="MHYTEDKEYMEHVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLHRKTLQS
FT                   HNR"
FT   gene            315812..316501
FT                   /locus_tag="MGAS9429_Spy0299"
FT   CDS_pept        315812..316501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0299"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31487"
FT                   /db_xref="GOA:Q1JNB2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB2"
FT                   /protein_id="ABF31487.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            316679..316921
FT                   /locus_tag="MGAS9429_Spy0300"
FT   CDS_pept        316679..316921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0300"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31488"
FT                   /db_xref="GOA:Q1JNB1"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNB1"
FT                   /protein_id="ABF31488.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            complement(316979..317074)
FT                   /locus_tag="MGAS9429_Spy0301"
FT   CDS_pept        complement(316979..317074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNB0"
FT                   /protein_id="ABF31489.1"
FT                   /translation="MKNSVGNSQLSFFLNPEQLTNLTDKTSATEH"
FT   gene            317099..317893
FT                   /gene="glr"
FT                   /locus_tag="MGAS9429_Spy0302"
FT   CDS_pept        317099..317893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /locus_tag="MGAS9429_Spy0302"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31490"
FT                   /db_xref="GOA:Q1JNA9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNA9"
FT                   /protein_id="ABF31490.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVKHRFFTTANPEIFQEIASIWLKQKINVEHVTL"
FT   gene            317851..318876
FT                   /locus_tag="MGAS9429_Spy0303"
FT   CDS_pept        317851..318876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0303"
FT                   /product="xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31491"
FT                   /db_xref="GOA:Q1JNA8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNA8"
FT                   /protein_id="ABF31491.1"
FT                   /translation="MAETKNKCGACHLMSEKIYEYKDENNWFIGKMTGHNLISGWGVKH
FT                   TTIKKIDDLLDGIAATLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETQREIKVIPH
FT                   AGTILLMENAKLLAVYLPEGGVSTATFFATSEQGFGDTILIATRNEGKTKEFRNLFGQL
FT                   GYRVENLNDYPELPEVAETGTTFEENARLKAETISRLTGKMVLADDSGLKVDALGGLPG
FT                   VWSARFSGPDATDAKNNAKLLHELAMVFDQKKRSAQFHTTLVVAAPNKDSLVVEAEWPG
FT                   YIATQPKGENGFGYDPVFIVGETGRHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQ
FT                   S"
FT   gene            318855..319376
FT                   /locus_tag="MGAS9429_Spy0304"
FT   CDS_pept        318855..319376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0304"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31492"
FT                   /db_xref="GOA:Q1JNA7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNA7"
FT                   /protein_id="ABF31492.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAAD
FT                   ICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            319373..319834
FT                   /locus_tag="MGAS9429_Spy0305"
FT   CDS_pept        319373..319834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0305"
FT                   /product="CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31493"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNA6"
FT                   /protein_id="ABF31493.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDFPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            319831..320577
FT                   /locus_tag="MGAS9429_Spy0306"
FT   CDS_pept        319831..320577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0306"
FT                   /product="DNA integration/recombination/inversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31494"
FT                   /db_xref="GOA:Q1JNA5"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNA5"
FT                   /protein_id="ABF31494.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLVGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLNFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLVGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPVTLEKYYKS"
FT   gene            320577..321281
FT                   /locus_tag="MGAS9429_Spy0307"
FT   CDS_pept        320577..321281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0307"
FT                   /product="segregation and condensation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31495"
FT                   /db_xref="GOA:Q1JNA4"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNA4"
FT                   /protein_id="ABF31495.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEEDLEQDLLEKIEEYSRFKAVSQA
FT                   LAKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKTNHTVIER
FT                   DDYKIEDMMASIKQRLEKENVISLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQLS
FT                   NFGAIILRKEKK"
FT   gene            321278..321829
FT                   /locus_tag="MGAS9429_Spy0308"
FT   CDS_pept        321278..321829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0308"
FT                   /product="segregation and condensation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31496"
FT                   /db_xref="GOA:Q1JNA3"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNA3"
FT                   /protein_id="ABF31496.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAGLLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            321927..322673
FT                   /locus_tag="MGAS9429_Spy0309"
FT   CDS_pept        321927..322673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0309"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31497"
FT                   /db_xref="GOA:Q1JNA2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNA2"
FT                   /protein_id="ABF31497.1"
FT                   /translation="MLKRKKNIMRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDL
FT                   ATTVKSGDVVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYP
FT                   VGRLDWDTSGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDG
FT                   KKTKPARYNIVRVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLK
FT                   GLRPGEARRLNKKEISQLHNLANTKK"
FT   gene            322670..322933
FT                   /locus_tag="MGAS9429_Spy0310"
FT   CDS_pept        322670..322933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0310"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31498"
FT                   /db_xref="GOA:Q1JNA1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JNA1"
FT                   /protein_id="ABF31498.1"
FT                   /translation="MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTK
FT                   GILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNAEKA"
FT   gene            323075..323659
FT                   /locus_tag="MGAS9429_Spy0311"
FT   CDS_pept        323075..323659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0311"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31499"
FT                   /db_xref="GOA:Q1JNA0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JNA0"
FT                   /protein_id="ABF31499.1"
FT                   /translation="MWFFKLKRVNEIMTTKELINKNDKVKKARNHIVLFQPQIPQNTGN
FT                   IARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHL
FT                   ISKFAVNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVS
FT                   NTVCMVIYEALRQQGFQGLELKHTYEHDKLK"
FT   gene            323971..324534
FT                   /locus_tag="MGAS9429_Spy0312"
FT   CDS_pept        323971..324534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0312"
FT                   /product="riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31500"
FT                   /db_xref="GOA:Q1JN99"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN99"
FT                   /protein_id="ABF31500.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            324536..325189
FT                   /locus_tag="MGAS9429_Spy0313"
FT   CDS_pept        324536..325189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0313"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31501"
FT                   /db_xref="GOA:Q1JN98"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN98"
FT                   /protein_id="ABF31501.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQVLLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILVIGLSRIYLGVHYPSDILAGFVLGFGILQFIYPFYKQKRFEWRFLLKQD"
FT   gene            325464..326402
FT                   /locus_tag="MGAS9429_Spy0314"
FT   CDS_pept        325464..326402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0314"
FT                   /product="radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31502"
FT                   /db_xref="GOA:Q1JN97"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN97"
FT                   /protein_id="ABF31502.1"
FT                   /translation="MCYNRNMKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVA
FT                   HGGCTFCTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVD
FT                   VIRDRYEQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSR
FT                   LINRAHSYDLYKETVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIK
FT                   LHLLHLMTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLI
FT                   GPMWSLNKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            326414..326995
FT                   /locus_tag="MGAS9429_Spy0315"
FT   CDS_pept        326414..326995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0315"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31503"
FT                   /db_xref="GOA:Q1JN96"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN96"
FT                   /protein_id="ABF31503.1"
FT                   /translation="MTDLDRRKVMLKRPIHLSHDFLAEVVDKSSVVVDATMGNGNDTAF
FT                   LAQLAKKVYAFDVQEQAIRKTSERLAQLGLLNAELILAGHEAVDQYVTEPVRAAIFNLG
FT                   YLPSADKSIITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLD
FT                   QRKVSAMLYQPLNQVNTPPFLIMLEKLADV"
FT   gene            327089..328462
FT                   /gene="hlyX"
FT                   /locus_tag="MGAS9429_Spy0316"
FT   CDS_pept        327089..328462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyX"
FT                   /locus_tag="MGAS9429_Spy0316"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31504"
FT                   /db_xref="GOA:Q1JN95"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN95"
FT                   /protein_id="ABF31504.1"
FT                   /translation="MKSLYYFFRSYINMEDPVSQPLVIQFLLLVVLTLLNAFFSASEMA
FT                   LVSLNRSRVEQKAADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKV
FT                   ISGWLGNSATARTAGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGR
FT                   LVSPFVWLLSASTNLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVF
FT                   SLDEMMAREVMVPRTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKR
FT                   LLESGFRQGFDQINMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLV
FT                   TLEDLLEEIVGEIDDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTI
FT                   AGFYLTGIGTIPSQEQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            328468..329331
FT                   /gene="pflC"
FT                   /locus_tag="MGAS9429_Spy0317"
FT   CDS_pept        328468..329331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflC"
FT                   /locus_tag="MGAS9429_Spy0317"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31505"
FT                   /db_xref="GOA:Q1JN94"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN94"
FT                   /protein_id="ABF31505.1"
FT                   /translation="MPSLFDEKCYNENVKTFTSNEGDAMTEKDYEQVTGMVHSTESFGS
FT                   VDGPGIRFIIFLQGCKLRCQYCHNPDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGG
FT                   ITVSGGEAMLQIDFITALFIEAKKLGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLIL
FT                   LDLKEIDEKQHKIVTRQPNKNILQFARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEF
FT                   VKTLKNVDKFEVLPYHTMGEFKWRELGIPYQLEGVKPPTKERVQNAKNLMQTESYTEYM
FT                   NRIHQS"
FT   gene            329456..330397
FT                   /gene="ppaC"
FT                   /locus_tag="MGAS9429_Spy0318"
FT   CDS_pept        329456..330397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="MGAS9429_Spy0318"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31506"
FT                   /db_xref="GOA:Q1JN93"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN93"
FT                   /protein_id="ABF31506.1"
FT                   /translation="MIMSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTP
FT                   NEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRV
FT                   ANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTH
FT                   VSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQ
FT                   VNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAA
FT                   FNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            330473..331126
FT                   /locus_tag="MGAS9429_Spy0319"
FT   CDS_pept        330473..331126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0319"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31507"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN92"
FT                   /protein_id="ABF31507.1"
FT                   /translation="MITIFHSDKLTRQPFFQDLINYLDQHDHVILREIKKAFPNVTGID
FT                   KAIESYVQAGYIRRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYENILAVVFETQL
FT                   TNQTNHVMIKEKTNITRSQLTLANYFYRLKRGEKPSAEQMDLYDLLGDVNQEYALKYMT
FT                   TFLLKFTRKDLVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMTLDKESLTFIAP"
FT   gene            complement(331171..332208)
FT                   /gene="fhuG"
FT                   /locus_tag="MGAS9429_Spy0320"
FT   CDS_pept        complement(331171..332208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="MGAS9429_Spy0320"
FT                   /product="ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31508"
FT                   /db_xref="GOA:Q1JN91"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN91"
FT                   /protein_id="ABF31508.1"
FT                   /translation="MLFMVNKKRRPLLKSHRHLLRLYTSLILLLVSLMGLALSLGESHL
FT                   SFLDLIHVFLGKSSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGV
FT                   LGITIGAGISLAIVVSFSFFEQAHISHYLPLFAMLGAIVTTFSVYWLSLTKQGQIDPTR
FT                   LILTGVAVTTILSSLMVALVGHINRYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWL
FT                   LTYSQAHFLNIMGLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAG
FT                   HFSTYLVGSNHKITIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYL
FT                   MAKTK"
FT   gene            complement(332169..333221)
FT                   /gene="fhuB"
FT                   /locus_tag="MGAS9429_Spy0321"
FT   CDS_pept        complement(332169..333221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="MGAS9429_Spy0321"
FT                   /product="ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31509"
FT                   /db_xref="GOA:Q1JN90"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN90"
FT                   /protein_id="ABF31509.1"
FT                   /translation="MKTKHPFLCLERFCLKKTQIITKSHIFWLVFVLLSFSLCVAIYCH
FT                   LRFGAVALSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITR
FT                   NPIAEPGLLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKG
FT                   YHQLRLVLAGAMVSILLSALGQGITNYYHLTNAVIGWQAGGLVGVNWQMIGYIAPLIIL
FT                   SLCLAQLLSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGL
FT                   VIPHLMKHFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCF
FT                   LWLIRRGGRY"
FT   gene            complement(333211..334143)
FT                   /gene="fhuD"
FT                   /locus_tag="MGAS9429_Spy0322"
FT   CDS_pept        complement(333211..334143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="MGAS9429_Spy0322"
FT                   /product="ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31510"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN89"
FT                   /protein_id="ABF31510.1"
FT                   /translation="MKKLTLLLTLCLTTITLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVTATDLE
FT                   AITTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVLSDFGRIFNKEGKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEVIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVVAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLESLREAILSSEN"
FT   gene            complement(334169..334951)
FT                   /gene="fhuA"
FT                   /locus_tag="MGAS9429_Spy0323"
FT   CDS_pept        complement(334169..334951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="MGAS9429_Spy0323"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31511"
FT                   /db_xref="GOA:Q1JN88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN88"
FT                   /protein_id="ABF31511.1"
FT                   /translation="MTTISAEDLTIAYEQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGVVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKAIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIVMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFQIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(335197..336642)
FT                   /gene="murE"
FT                   /locus_tag="MGAS9429_Spy0324"
FT   CDS_pept        complement(335197..336642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="MGAS9429_Spy0324"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31512"
FT                   /db_xref="GOA:Q1JN87"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN87"
FT                   /protein_id="ABF31512.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDADGYHYHYQGLSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFSFLADQVADQEHVFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISKEIASHIARPVEIISDREQAIQKAMSLCQGAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIAKHYL"
FT   gene            336730..338364
FT                   /locus_tag="MGAS9429_Spy0325"
FT   CDS_pept        336730..338364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0325"
FT                   /product="export protein for polysaccharides and teichoic
FT                   acids"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31513"
FT                   /db_xref="GOA:Q1JN86"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN86"
FT                   /protein_id="ABF31513.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSVIMYLGSPLFASLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAISQIAEQLIRVIWMLLTTFLIMKLGSGDYASAVTQSTFAAFIGMVASMGVLGYYLWK
FT                   QGLLAAIFSKPDHTVSIDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEDRAIHLFVAVLFQTLLMALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGVGMTVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            338532..339161
FT                   /gene="upp"
FT                   /locus_tag="MGAS9429_Spy0326"
FT   CDS_pept        338532..339161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="MGAS9429_Spy0326"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31514"
FT                   /db_xref="GOA:Q1JN85"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN85"
FT                   /protein_id="ABF31514.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            339130..339264
FT                   /locus_tag="MGAS9429_Spy0327"
FT   CDS_pept        339130..339264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0327"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN84"
FT                   /protein_id="ABF31515.1"
FT                   /translation="MLVIVYLGQNKRDNHQIVAFLGQSFLILLKKSERFLFFKGKASL"
FT   gene            339385..339975
FT                   /gene="clpP"
FT                   /locus_tag="MGAS9429_Spy0328"
FT   CDS_pept        339385..339975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="MGAS9429_Spy0328"
FT                   /product="ATP-dependent endopeptidase clp proteolytic
FT                   subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31516"
FT                   /db_xref="GOA:Q1JN83"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN83"
FT                   /protein_id="ABF31516.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            340470..340763
FT                   /locus_tag="MGAS9429_Spy0329"
FT   CDS_pept        340470..340763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0329"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31517"
FT                   /db_xref="GOA:Q1JN82"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN82"
FT                   /protein_id="ABF31517.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKGYQPPSY"
FT   gene            341014..342156
FT                   /locus_tag="MGAS9429_Spy0330"
FT   CDS_pept        341014..342156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0330"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31518"
FT                   /db_xref="GOA:Q1JN81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN81"
FT                   /protein_id="ABF31518.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETSKEMEDFIEMNEPLFATYVDLSEGCPSHDTLERVISLVNSGRLKELKVQFEQSLTSL
FT                   DAVHQLISVDGKTIRGNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIGVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLKVMVFPKKDLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            342140..342292
FT                   /locus_tag="MGAS9429_Spy0331"
FT   CDS_pept        342140..342292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31519"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN80"
FT                   /protein_id="ABF31519.1"
FT                   /translation="MEKEAKQMIDLKRNLFKIDVRAQKDEEKVFMRTACTAKICQCFLA
FT                   HFLIK"
FT   gene            342241..342954
FT                   /gene="tmk"
FT                   /locus_tag="MGAS9429_Spy0332"
FT   CDS_pept        342241..342954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="MGAS9429_Spy0332"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31520"
FT                   /db_xref="GOA:Q1JN79"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN79"
FT                   /protein_id="ABF31520.1"
FT                   /translation="MHCKDMPVLFSSFFDKIELLKSEGNKMITGKLITVEGPDGAGKTT
FT                   VLEQLIPLLKQKVAQEILTTREPGGVAISEYIRELILDINHTTMDPKTELLLYIAARRQ
FT                   HLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYF
FT                   DVPSEIGLARINANQQREVNRLDLETIEIHQRVRKGYLALAKEHPKRIVTIDATKPLKE
FT                   VVSVALEHVLALLLA"
FT   gene            342972..343847
FT                   /gene="dnaX"
FT                   /locus_tag="MGAS9429_Spy0333"
FT   CDS_pept        342972..343847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="MGAS9429_Spy0333"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31521"
FT                   /db_xref="GOA:Q1JN78"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN78"
FT                   /protein_id="ABF31521.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQKPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYENK
FT                   RQVFIIKDCDKMHINAANSLLKYIEEPQGEAYIFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLYQLAQEKGLLNHQAKLVAKLATNTSHLERLLQTSKLLELITQAERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMSE"
FT   gene            343969..344106
FT                   /locus_tag="MGAS9429_Spy0334"
FT   CDS_pept        343969..344106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0334"
FT                   /product="Tpl protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN77"
FT                   /protein_id="ABF31522.1"
FT                   /translation="MMKEVSRLITQNQLKMTFINSVFPLDQHVVLIPFSAEEHMDFYNC
FT                   "
FT   gene            344195..344356
FT                   /locus_tag="MGAS9429_Spy0335"
FT   CDS_pept        344195..344356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN76"
FT                   /protein_id="ABF31523.1"
FT                   /translation="MWQATVLLSFLGKFLTVSIKILKNQGLSLTLGKATSPYGRLLCCL
FT                   YDEGGFYQ"
FT   gene            344453..344518
FT                   /locus_tag="MGAS9429_Spy0336"
FT   CDS_pept        344453..344518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN75"
FT                   /protein_id="ABF31524.1"
FT                   /translation="MRLKDQLTLVTYALEEVKVGE"
FT   gene            344511..344834
FT                   /locus_tag="MGAS9429_Spy0337"
FT   CDS_pept        344511..344834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0337"
FT                   /product="initiation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31525"
FT                   /db_xref="GOA:Q1JN74"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN74"
FT                   /protein_id="ABF31525.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETVAKNPSKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            344839..345702
FT                   /locus_tag="MGAS9429_Spy0338"
FT   CDS_pept        344839..345702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0338"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31526"
FT                   /db_xref="GOA:Q1JN73"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN73"
FT                   /protein_id="ABF31526.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNAYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDSDIAVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFFEDKHH
FT                   YPETQMFYESPYRIKDTLTNMLACYGDRQVVLVRELTKLFEEYQRGSILEILSYLEETP
FT                   LKGECLLIVAGAQVDSEVELTADVDLVSLVQKEIQAGAKPNQAIKTIAKAYQVNRQELY
FT                   QQFHDL"
FT   gene            345729..346121
FT                   /locus_tag="MGAS9429_Spy0339"
FT   CDS_pept        345729..346121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0339"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31527"
FT                   /db_xref="GOA:Q1JN72"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN72"
FT                   /protein_id="ABF31527.1"
FT                   /translation="MTEDQATILILGVYGIILAVFLLSALLCLIANWRLFKRAGYKGWY
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(346168..346797)
FT                   /gene="cutC"
FT                   /locus_tag="MGAS9429_Spy0340"
FT   CDS_pept        complement(346168..346797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="MGAS9429_Spy0340"
FT                   /product="copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31528"
FT                   /db_xref="GOA:Q1JN71"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN71"
FT                   /protein_id="ABF31528.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENHLD
FT                   TDAIEQLLPATQGLPLVFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGVTAENCQNLSQLTGTAIVHGTKII"
FT   gene            347096..347452
FT                   /locus_tag="MGAS9429_Spy0341"
FT   CDS_pept        347096..347452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0341"
FT                   /product="arsenate reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31529"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN70"
FT                   /protein_id="ABF31529.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLVSDFEVIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGRVL
FT                   QVGYRKPYQELDLG"
FT   gene            complement(347526..348437)
FT                   /gene="exoA"
FT                   /locus_tag="MGAS9429_Spy0342"
FT   CDS_pept        complement(347526..348437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="MGAS9429_Spy0342"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31530"
FT                   /db_xref="GOA:Q1JN69"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN69"
FT                   /protein_id="ABF31530.1"
FT                   /translation="MGARCPKSLIVSFFVTITTRLSVRKRYQMKLISWNIDSLNAALTG
FT                   ESPRALLSRAVLDTLVAQDADIIAIQETKLSAKGPTKKHIETLLSYFPNYLHVWRSSVE
FT                   PARKGYAGTMFLYKNTLNPVITFPEIGAPTTMDAEGRIITLEFEDFFVTQVYTPNAGDG
FT                   LRRLDDRQIWDHKYADYLTELDAQKPVLATGDYNVAHKEIDLANPSSNRRSPGFTDEER
FT                   QGFTNLLARGFTDTFRHLHGDIPHVYTWWAQRSKTSKINNTGWRIDYWLASNRLVDKVK
FT                   RSEMISSGERQDHTPILLDIDL"
FT   gene            348581..349768
FT                   /gene="lctO"
FT                   /locus_tag="MGAS9429_Spy0343"
FT   CDS_pept        348581..349768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="MGAS9429_Spy0343"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.13.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31531"
FT                   /db_xref="GOA:Q1JN68"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN68"
FT                   /protein_id="ABF31531.1"
FT                   /translation="MSMAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVI
FT                   PKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDHLTSPLILA
FT                   PVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDD
FT                   GINRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTM
FT                   DYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQL
FT                   DGGPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGLAMG
FT                   GSTGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            350033..354976
FT                   /gene="spyCEP"
FT                   /locus_tag="MGAS9429_Spy0344"
FT   CDS_pept        350033..354976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spyCEP"
FT                   /locus_tag="MGAS9429_Spy0344"
FT                   /product="interleukin-8 protease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31532"
FT                   /db_xref="GOA:Q1JN67"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN67"
FT                   /protein_id="ABF31532.1"
FT                   /translation="MEKKQRFSLRKYKSGTFSVLIGSVFLMMTTTVAADELTTTSEPTI
FT                   TNHTQQQAQHLTNTELSSAESKPQDTSQITLKTNREKEQPQGLVSEPTTTELADTDAAP
FT                   MANTGPDATQKSASLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSMRI
FT                   SDVSTAKVKSKEDMLARQKAAGINYGSWINDKVVFAHNYVENSDNIKENQFEDFDEDWE
FT                   NFEFDAEAEPKAIKKHKIYRPQSTQAPKETVIKTEETDGSHDIDWTQTDDDTKYESHGM
FT                   HVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVFANDVMGSAESLFIKAIEDAVALGA
FT                   DVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYGSDHDDPLATNPDY
FT                   GLVGSPSTGRTPTSVAAINSKWVIQRLMTVKELENRADLNHGKAIYSESVDFKNIKDSL
FT                   GYDKSHQFAYVKESTDAGYNAQNVKGKIALIERDPNKTYDEMIALAKKHGALGVLIFNN
FT                   KPGQSNRSMRLTANGMGIPSAFISHEFGKAMSQLNGNGTGSLEFDSVVSKAPSQKGNEM
FT                   NHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTSMASPQIAGASLLVKQYLE
FT                   KTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVTG
FT                   KDNYGSISLGNITDTMTFDVTVHNLSNKAKTLRYDTELLTDHVDPQKGRFTLTSRSLKT
FT                   YQGGEVTVPANGKVTVRVTMDVSQFTKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNIP
FT                   FVGFKGQFENLAVAEESIYRLKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVS
FT                   TKTISDNGLHTLGTFKNVDGKFILEKNAQGNPVLAISPNGDNNQDFAAFKGVFLRKYQG
FT                   LKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKSTTLLGTAFSGKSLTGAELPD
FT                   GYYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATFDPETNRFKPEPLKDRGLAGV
FT                   RKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQADGSFILPLDKAKLGDFYYM
FT                   VEDFAGNVAIAKLGDHLPQTLGKTPIKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQA
FT                   QLAVVHRNQPQSQLTKMNQDFFISPNEDGNKDFVAFKGLKNNVYNDLTVNVYAKDDHQK
FT                   QTPIWSSQAGASASAIESTAWYGITARGSKVMPGDYQYVVTYRDEHGKEHQKQYTISVN
FT                   DKKPMITQGRFDTINGVDHFTPDKTKALGSSGIVREEVFYLAKKNGRKFDVTEGKDGIT
FT                   VSDNKVYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGNVSFATLRDLKAVGKDKAVVN
FT                   FGLDLPVPEDKQIVNFTYLVRDADGKPIENLEYYNNSGNSLILPYGKYTVELLTYDTNA
FT                   AKLESDKIVSFTLSADNNFQQVTFKMTMLATSQITAHFDHLLPEGSRVSLKTAQGQLIP
FT                   LEQSLYVPKAYGKTVQEGTYEVVVSLPKGYRIEGNTKVNTLPNEVHELSLRLVKVGDAS
FT                   DSTGDHKVMSKNNSQALTASATPTKTTTSATAKALPSAGEKMGLKLRIVGLVLLGLTCV
FT                   FSRKKSTKD"
FT   gene            355344..355439
FT                   /locus_tag="MGAS9429_Spy0345"
FT   CDS_pept        355344..355439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31533"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN66"
FT                   /protein_id="ABF31533.1"
FT                   /translation="MIKVIKQTGLSLPEQVSKKEAFGFVIQHTEL"
FT   gene            355467..355646
FT                   /locus_tag="MGAS9429_Spy0346"
FT   CDS_pept        355467..355646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31534"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN65"
FT                   /protein_id="ABF31534.1"
FT                   /translation="MYSKSINSSADVTSDFYVRSDPKQLLFAMVKVAPIGIFETLGSKI
FT                   RHRIPKEVAAVSTT"
FT   gene            355724..356455
FT                   /locus_tag="MGAS9429_Spy0347"
FT   CDS_pept        355724..356455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0347"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31535"
FT                   /db_xref="GOA:Q1JN64"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN64"
FT                   /protein_id="ABF31535.1"
FT                   /translation="MNEVKKATMSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQG
FT                   KRFAGVQTGNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWAIKKGLHWYL
FT                   LSSFILTGIAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKN
FT                   AAYLLTKGLYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYV
FT                   NYLLAQEFYHIQTKIKPIKRT"
FT   gene            356695..358695
FT                   /gene="metS"
FT                   /locus_tag="MGAS9429_Spy0348"
FT   CDS_pept        356695..358695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="MGAS9429_Spy0348"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="protein secretion chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31536"
FT                   /db_xref="GOA:Q1JN63"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN63"
FT                   /protein_id="ABF31536.1"
FT                   /translation="MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVF
FT                   YLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEV
FT                   VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVE
FT                   WVSEESYFLRLSKYADRLVAFFKERPDFIQPDDRMNEMVKNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDSLRYYLMRSL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLS
FT                   QLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVM
FT                   AHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIF
FT                   PRLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKE
FT                   VSKVEGSEKLLRFRVDAGDGQDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKY
FT                   ISQGMILSAEHGDQLTVLTVDSSVPNGSIIG"
FT   gene            359058..359192
FT                   /locus_tag="MGAS9429_Spy0349"
FT   CDS_pept        359058..359192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31537"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN62"
FT                   /protein_id="ABF31537.1"
FT                   /translation="MLFSRSFCVAQKKTIPVCLASSDDLGLALLDFCLKNTSSLEGDK"
FT   gene            359189..360202
FT                   /gene="nrdF1"
FT                   /locus_tag="MGAS9429_Spy0350"
FT   CDS_pept        359189..360202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF1"
FT                   /locus_tag="MGAS9429_Spy0350"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31538"
FT                   /db_xref="GOA:Q1JN61"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN61"
FT                   /protein_id="ABF31538.1"
FT                   /translation="MTQHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYESPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            360206..360694
FT                   /gene="nrdI"
FT                   /locus_tag="MGAS9429_Spy0351"
FT   CDS_pept        360206..360694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="MGAS9429_Spy0351"
FT                   /product="NrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31539"
FT                   /db_xref="GOA:Q1JN60"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN60"
FT                   /protein_id="ABF31539.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQKQTNNLITERTHPCHKPMRHTSH"
FT   gene            360661..362841
FT                   /gene="nrdE1"
FT                   /locus_tag="MGAS9429_Spy0352"
FT   CDS_pept        360661..362841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE1"
FT                   /locus_tag="MGAS9429_Spy0352"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31540"
FT                   /db_xref="GOA:Q1JN59"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN59"
FT                   /protein_id="ABF31540.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKRVYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KLFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAA
FT                   NHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYHAFKASCQLAKEKGAFAGF
FT                   SLSTYADGTYFAKYLQEDAKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECHSCMI"
FT   gene            362861..363040
FT                   /locus_tag="MGAS9429_Spy0353"
FT   CDS_pept        362861..363040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31541"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN58"
FT                   /protein_id="ABF31541.1"
FT                   /translation="MSPTTCIGSVRSTFQDKQASALACLFLASKPVSLLLCEAFFEHQN
FT                   LKKRTWSPFWGDRC"
FT   gene            complement(363046..363813)
FT                   /gene="spyA"
FT                   /locus_tag="MGAS9429_Spy0354"
FT   CDS_pept        complement(363046..363813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spyA"
FT                   /locus_tag="MGAS9429_Spy0354"
FT                   /product="C3 family ADP-ribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31542"
FT                   /db_xref="GOA:Q1JN57"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR016678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN57"
FT                   /protein_id="ABF31542.1"
FT                   /translation="MSGGTMLKKRYQLAMILLLSCFSLVWQTEGLVELFVCEHYERAVC
FT                   EGTPAYFTFSDQKGAETLIKKRWGKGLLYPRAEQEAMAAYTCQQAALINTSLDKTKGEL
FT                   SQLTPELRDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNHQFDP
FT                   HILCKIKLGTRYTKHSFMSTTALKNGAMTHRPVEVRICVKKGAKAAFVEPYSAVPSEVE
FT                   LLFPRGCQLEVVGAYVSQDHKKLHIEAYFKGSL"
FT   gene            364240..364692
FT                   /locus_tag="MGAS9429_Spy0355"
FT   CDS_pept        364240..364692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0355"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN56"
FT                   /protein_id="ABF31543.1"
FT                   /translation="MKWSDFMKTKSKRFLNLATLCLALLGTTLLMGRPVNAEVTYTGER
FT                   STSVNGPGEDSSSEKTEQTSDSDKRDRNRGYEEGYKRGQESDNRVLDRGTIEVPYNVID
FT                   GVEYKDGYEQGFAAGWYDGHPITALLDIAWSYLTYAFDVLFGGTNS"
FT   gene            365135..365548
FT                   /locus_tag="MGAS9429_Spy0356"
FT   CDS_pept        365135..365548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0356"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN55"
FT                   /protein_id="ABF31544.1"
FT                   /translation="MTKAIKLVILSLILFTTVFLSVRQASADLMMDGVTYSESTDSNTF
FT                   LSNSGEVDNIWEKDRDFGKQRGLEAGKNGLGPTINRGDIPVPEKVKHKDKYQDGYQEGY
FT                   IQAWHQEHPFQGVIFAVFDVFSLIWGVISELFT"
FT   gene            complement(365668..365823)
FT                   /locus_tag="MGAS9429_Spy0358"
FT   CDS_pept        complement(365668..365823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31545"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN54"
FT                   /protein_id="ABF31545.1"
FT                   /translation="MLRTGNTFFSGIHAPFSTHGSLKPKKATPIRGGLTTKGTIPIIAD
FT                   LCGNGL"
FT   gene            365741..366040
FT                   /locus_tag="MGAS9429_Spy0357"
FT   CDS_pept        365741..366040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0357"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31546"
FT                   /db_xref="GOA:Q1JN53"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN53"
FT                   /protein_id="ABF31546.1"
FT                   /translation="MAFLGFSDPCVEKGACMPEKKVLPVLSMVVSLVSLFDHIFFFATY
FT                   SYLYLPLVASSLALIGLVQNKGRQKVWSLAGLILAALAVAVVAYAYYDPTVIPY"
FT   gene            complement(366134..366766)
FT                   /locus_tag="MGAS9429_Spy0359"
FT   CDS_pept        complement(366134..366766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31547"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN52"
FT                   /protein_id="ABF31547.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDEQSSKQKPVKFDLDEPQQKIK
FT                   DYSGNTITLEDLYVGSKVVKIYIPQGWWVYLYRQCDHNSKERGILASPILEKNMTKTDP
FT                   YRQYYTGVPYILNLGEDPLKKGEKLTFSFKGEDGFYVGSYIYRDSDTIKKEKEAEEALQ
FT                   KKEEEKQQKQLEESMLKQIREEDHKPWHQRLSESIQDQWWNFKGLFQ"
FT   gene            complement(367278..368246)
FT                   /locus_tag="MGAS9429_Spy0360"
FT   CDS_pept        complement(367278..368246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31548"
FT                   /db_xref="InterPro:IPR022104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN51"
FT                   /protein_id="ABF31548.1"
FT                   /translation="MENLSERLVLKSVEAFIMGLEIYNKPTIKYRIEGFSFFICNAWEL
FT                   MLKAEMLNRGFSIYYSDNPERTLSLEYVLKKIYSDENTRIRLNLEKIIELRNISTHFIT
FT                   EDYEIKYAPLFQACVLNLASEMKRFHNKDITESIAHNFLTISASYEPLSNEEIKLKYPS
FT                   EIAEKFIKQANEVDVLSKEYNSEKFSIDIRQNLYITKKKDEADFVVSISKDAETPVSLV
FT                   KELKDPSDTHKYSYSNVVTAVQERLKKSAIKLGYEKGFNTYVLNLVIDFYNIKSETKFS
FT                   YCHLIGSTQTYTYSQQFVEFIVNEIKKDPQNFVESLKKSNK"
FT   gene            368858..369094
FT                   /locus_tag="MGAS9429_Spy0361"
FT   CDS_pept        368858..369094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31549"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN50"
FT                   /protein_id="ABF31549.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTLEVDGKVLQATP
FT                   YFLIHVTGAGEGFSMWAPTPCDVLAEDWIEVND"
FT   gene            369087..369785
FT                   /locus_tag="MGAS9429_Spy0362"
FT   CDS_pept        369087..369785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0362"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31550"
FT                   /db_xref="GOA:Q1JN49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN49"
FT                   /protein_id="ABF31550.1"
FT                   /translation="MTKVVLVTGCASGIGCAQARYFLRQGYHVYGVDKSDKPDLNGNFH
FT                   FIKLDLSSELSPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRRMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTASDFEPGGLADWVARETPIGRWTEPDEVAELTGFLASGKARSMQGEI
FT                   VKIDGGWSLK"
FT   gene            369828..370820
FT                   /locus_tag="MGAS9429_Spy0363"
FT   CDS_pept        369828..370820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0363"
FT                   /product="NAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31551"
FT                   /db_xref="GOA:Q1JN48"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN48"
FT                   /protein_id="ABF31551.1"
FT                   /translation="MMSQTVKGDEQMKLAVLGTGMIVKEVLPVLQKIDGIDLVAILSTV
FT                   RSLKTAKDLAKAYHMPLATSKYEAVLGNEEIDTVYIGLPNHLHFAYAKEALLAGKHVIC
FT                   EKPFTMTAGELDELVVIAKKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQ
FT                   YSSRYDAFKRGDIAPAFNPKMGGGALRDLNIYNIHFVVGLFGRPKTVQYLANVEKGIDT
FT                   SGMLVMDYEQFKVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVQLSLHGQKPQV
FT                   INHNKHDHRMYEEFVAFKDMIDQKDFKKVNQALEHSRAVMAVLERAVHS"
FT   gene            371147..372490
FT                   /locus_tag="MGAS9429_Spy0364"
FT   CDS_pept        371147..372490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0364"
FT                   /product="phosphoglycerate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31552"
FT                   /db_xref="GOA:Q1JN47"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN47"
FT                   /protein_id="ABF31552.1"
FT                   /translation="MFMEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKL
FT                   MSNTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICI
FT                   LIGFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSA
FT                   LLPLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTM
FT                   YGDAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYL
FT                   SQVANMSEAHIHFAISILEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYE
FT                   RLTATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIG
FT                   NMGANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            372664..374046
FT                   /gene="gcaD"
FT                   /locus_tag="MGAS9429_Spy0365"
FT   CDS_pept        372664..374046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="MGAS9429_Spy0365"
FT                   /product="glucosamine-1-phosphate acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /EC_number="2.7.7.23"
FT                   /note="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31553"
FT                   /db_xref="GOA:Q1JN46"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN46"
FT                   /protein_id="ABF31553.1"
FT                   /translation="MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISP
FT                   EKAVTVIGHKSEKVRAVLADQSAFVHQTEQLGTGHAVMMAETQLEGLEGHTLVIAGDTP
FT                   LITGESLKSLIDFHVNHKNVATILTATAQDPFGYGRIVRNKDGEVIKIVEQKDANEYEQ
FT                   QLKEINTGTYVFDNKRLFEALKCITTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNE
FT                   SLGVNDRVALATAETVMRQRITQKHMVNGVTFQNPETVYIESDVEIAPDVLIEGNVTLK
FT                   GRTHIGSGTVLTNGTYIVDSEIGQGSIITNSMIESSVLAAGVTVGPYAHLRPGTTLGRE
FT                   VHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDGQNKYETVIGDH
FT                   AFIGSNSTLIAPLEVGDNALTAAGSTISKTVPADSIVIGRSRQVTKEGYAKRLAHHPSR
FT                   SK"
FT   gene            374080..374634
FT                   /locus_tag="MGAS9429_Spy0366"
FT   CDS_pept        374080..374634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0366"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31554"
FT                   /db_xref="GOA:Q1JN45"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN45"
FT                   /protein_id="ABF31554.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPERKIVLVKQYRKAIESVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLTQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFGGEQ"
FT   gene            374631..374885
FT                   /locus_tag="MGAS9429_Spy0367"
FT   CDS_pept        374631..374885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0367"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31555"
FT                   /db_xref="GOA:Q1JN44"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN44"
FT                   /protein_id="ABF31555.1"
FT                   /translation="MMGRPLLTDDIIEKARRMETFEPDDAVDFDTKVMTLPEKDEKARI
FT                   YKSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            374905..375600
FT                   /gene="pfs"
FT                   /locus_tag="MGAS9429_Spy0368"
FT   CDS_pept        374905..375600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="MGAS9429_Spy0368"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31556"
FT                   /db_xref="GOA:Q1JN43"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN43"
FT                   /protein_id="ABF31556.1"
FT                   /translation="MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELIL
FT                   VQSGVGKVMSAMTVAILAEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQIL
FT                   MTFLENLPV"
FT   gene            375713..375931
FT                   /locus_tag="MGAS9429_Spy0369"
FT   CDS_pept        375713..375931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN42"
FT                   /protein_id="ABF31557.1"
FT                   /translation="MTGPKSHLQYSKDNTKLQLRNILNGYQSDLGRHYSSYYYYNLRTV
FT                   MGLSSEQEIEEHYEKLKNKLHDMYNHY"
FT   gene            complement(376028..376675)
FT                   /gene="scaR"
FT                   /locus_tag="MGAS9429_Spy0370"
FT   CDS_pept        complement(376028..376675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scaR"
FT                   /locus_tag="MGAS9429_Spy0370"
FT                   /product="iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31558"
FT                   /db_xref="GOA:Q1JN41"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN41"
FT                   /protein_id="ABF31558.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQEPKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNTQEVHQEAEVLEHT
FT                   VSDTFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLEAHHLSINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            376818..377753
FT                   /gene="mtsA"
FT                   /locus_tag="MGAS9429_Spy0371"
FT   CDS_pept        376818..377753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="MGAS9429_Spy0371"
FT                   /product="manganese-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31559"
FT                   /db_xref="GOA:Q1JN40"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN40"
FT                   /protein_id="ABF31559.1"
FT                   /translation="MMGKRMSLILGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIA
FT                   DMTKAIAGDKIDLHSIVPIGQDPHEYGPLPEDVEKTSNADVIFYNGINLEDGGQAWFTK
FT                   LVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAK
FT                   DPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSA
FT                   YIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFT
FT                   DSIAKKGKPGDSYYAMMKWNLDKISEGLAK"
FT   gene            377790..378542
FT                   /gene="mtsB"
FT                   /locus_tag="MGAS9429_Spy0372"
FT   CDS_pept        377790..378542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="MGAS9429_Spy0372"
FT                   /product="manganese transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31560"
FT                   /db_xref="GOA:Q1JN39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN39"
FT                   /protein_id="ABF31560.1"
FT                   /translation="MFYLCKGDKMITTNNLCVTYDGNSNALEAINVTIEGPSIVGIIGP
FT                   NGAGKSTFMKAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVAL
FT                   GTYSKLGLFRRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESD
FT                   YIFLDEPFVGIDSVSEKIIVDLLKELKMAGKTILIVHHDLSKVEHYFDKLMILNKHLVA
FT                   YGNVCEVFTVDTLSKAYGNHLILGKEMV"
FT   gene            378543..379397
FT                   /gene="mtsC"
FT                   /locus_tag="MGAS9429_Spy0373"
FT   CDS_pept        378543..379397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="MGAS9429_Spy0373"
FT                   /product="manganese transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31561"
FT                   /db_xref="GOA:Q1JN38"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN38"
FT                   /protein_id="ABF31561.1"
FT                   /translation="MSMKFFEGLMSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGVNFFIGAIIFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFD
FT                   PILAKSMGVKVNAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(379545..380351)
FT                   /locus_tag="MGAS9429_Spy0374"
FT   CDS_pept        complement(379545..380351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0374"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31562"
FT                   /db_xref="GOA:Q1JN37"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN37"
FT                   /protein_id="ABF31562.1"
FT                   /translation="MKKLLSLSLVAISLLSLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTSQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPEQDITITSIDIVKDYRFKN"
FT   gene            380568..382973
FT                   /gene="ftsK"
FT                   /locus_tag="MGAS9429_Spy0375"
FT   CDS_pept        380568..382973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="MGAS9429_Spy0375"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31563"
FT                   /db_xref="GOA:Q1JN36"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN36"
FT                   /protein_id="ABF31563.1"
FT                   /translation="MVKRNQRRKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAML
FT                   RLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEW
FT                   HAFLFAMPRMFDQDIFLSTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSY
FT                   FIGFLFILLGLFLMTPWDIYDVSHFVKEAVDKLAVAYQENKEKRFIKREEHRLQAEKEA
FT                   LEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDEAS
FT                   LFDQEDLAYAHEKIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPD
FT                   KPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISN
FT                   LADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPL
FT                   GKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFLMVDPKMV
FT                   ELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKVGVRNIAGYNAKVEDYN
FT                   RQSEQKQMPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVD
FT                   VISGLIKANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSF
FT                   ISDDDVERIVNFIKDQAEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLE
FT                   TQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN"
FT   gene            complement(383043..383396)
FT                   /locus_tag="MGAS9429_Spy0376"
FT   CDS_pept        complement(383043..383396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0376"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31564"
FT                   /db_xref="GOA:Q1JN35"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN35"
FT                   /protein_id="ABF31564.1"
FT                   /translation="MMIYKLTALAFLIVTPLFAMIVTPLFKLNKKGFKFPDVALLLFAI
FT                   EIVLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVI
FT                   FYLILVIFIFTLA"
FT   gene            383568..384065
FT                   /gene="rplK"
FT                   /locus_tag="MGAS9429_Spy0377"
FT   CDS_pept        383568..384065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="MGAS9429_Spy0377"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31565"
FT                   /db_xref="GOA:Q1JN34"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN34"
FT                   /protein_id="ABF31565.1"
FT                   /translation="MQYCISVGGKNLNYRQNHNRRIFKMAKKVEKLVKLQIPAGKATPA
FT                   PPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLK
FT                   KAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTV
FT                   TD"
FT   gene            384171..384860
FT                   /gene="rplA"
FT                   /locus_tag="MGAS9429_Spy0378"
FT   CDS_pept        384171..384860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="MGAS9429_Spy0378"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31566"
FT                   /db_xref="GOA:Q1JN33"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN33"
FT                   /protein_id="ABF31566.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            385182..385910
FT                   /gene="pyrH"
FT                   /locus_tag="MGAS9429_Spy0379"
FT   CDS_pept        385182..385910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="MGAS9429_Spy0379"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31567"
FT                   /db_xref="GOA:Q1JN32"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN32"
FT                   /protein_id="ABF31567.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            385939..386496
FT                   /gene="rrf"
FT                   /locus_tag="MGAS9429_Spy0380"
FT   CDS_pept        385939..386496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="MGAS9429_Spy0380"
FT                   /product="ribosome recycling factor (RRF)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31568"
FT                   /db_xref="GOA:Q1JN31"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN31"
FT                   /protein_id="ABF31568.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   gene            386605..387462
FT                   /locus_tag="MGAS9429_Spy0381"
FT   CDS_pept        386605..387462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0381"
FT                   /product="S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31569"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN30"
FT                   /protein_id="ABF31569.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIQKEGFTFTLSKAEGERQIGDMV
FT                   TGFAYTDIKQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVDTGIPNKEIVVSLDVLP
FT                   EMKELWPKKGDKLYISLDVDKKDRIWGLPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEEIKATFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   gene            387535..388044
FT                   /gene="msrA2"
FT                   /locus_tag="MGAS9429_Spy0382"
FT   CDS_pept        387535..388044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA2"
FT                   /locus_tag="MGAS9429_Spy0382"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31570"
FT                   /db_xref="GOA:Q1JN29"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN29"
FT                   /protein_id="ABF31570.1"
FT                   /translation="MERAIFAGGCFWCMGQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPKQIAYKDLVELYWAQTDPTDAFGQFEDRGDNYRPVIYYTTERQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQF
FT                   LEENWS"
FT   gene            388041..388256
FT                   /locus_tag="MGAS9429_Spy0383"
FT   CDS_pept        388041..388256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0383"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31571"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN28"
FT                   /protein_id="ABF31571.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELIS
FT                   RYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            388413..389582
FT                   /locus_tag="MGAS9429_Spy0384"
FT   CDS_pept        388413..389582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0384"
FT                   /product="surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31572"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN27"
FT                   /protein_id="ABF31572.1"
FT                   /translation="MIITKKSLFVTSVALSLAPLATAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATTLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQSTVPMAPSATPSDVPTTPLASAKPDSFVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVPQEAVPTPKAAETTEVEPKTDISEDPTSANRPVPNE
FT                   SASEEVSSAAPAQAPAEKEETSAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNAGLQP
FT                   QTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPENSALGDQVAQYAIDHMAE
FT                   RGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            389855..391669
FT                   /locus_tag="MGAS9429_Spy0385"
FT   CDS_pept        389855..391669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0385"
FT                   /product="myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31573"
FT                   /db_xref="GOA:Q1JN26"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN26"
FT                   /protein_id="ABF31573.1"
FT                   /translation="MMISLCLTIQGGLEMYYTSGNYEAFATPRKPEGVDQKSAYIVGTG
FT                   LAGLAAAVFLIRDGHMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREMENHFECM
FT                   WDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQSKEL
FT                   IHLIMKTEESLGDQTIEEFFSEDFFKSNFWVYWATMFAFEKWHSAVEMRRYAMRFIHHI
FT                   DGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKVAKTIH
FT                   MTVSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKALGGSWNLWENLAAQSD
FT                   DFGHPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSN
FT                   WMMSFAIHRQPHFKEQKENETTVWIYGLYSNSKGNYVHKKIEECTGQEITEEWLYHLGV
FT                   PVDKIKDLASQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAESPSR
FT                   DTVFTTEYSIRTAMEAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLNDKKAIKDMDLP
FT                   IPALIEKIGHKKIKDTFIEELLKDANLI"
FT   gene            391828..392880
FT                   /gene="phoH"
FT                   /locus_tag="MGAS9429_Spy0386"
FT   CDS_pept        391828..392880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="MGAS9429_Spy0386"
FT                   /product="PhoH protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31574"
FT                   /db_xref="GOA:Q1JN25"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN25"
FT                   /protein_id="ABF31574.1"
FT                   /translation="MQEYSIDITLTHPDDVLALFGSNERHLKLIEAHLGVIVHARTERV
FT                   QVIGDDEEAVELARLTIKALLVLVGRGMVVNTSDVVTALSMAESHQIDQFMALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEETKDLLKPKASDVEADYQPGL
FT                   TKYPVIGQEH"
FT   gene            392926..393501
FT                   /locus_tag="MGAS9429_Spy0387"
FT   CDS_pept        392926..393501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0387"
FT                   /product="uracil DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31575"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN24"
FT                   /protein_id="ABF31575.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFEEYLPDYFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            393609..394157
FT                   /locus_tag="MGAS9429_Spy0388"
FT   CDS_pept        393609..394157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0388"
FT                   /product="hypothetical metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31576"
FT                   /db_xref="GOA:Q1JN23"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN23"
FT                   /protein_id="ABF31576.1"
FT                   /translation="MPNIPNEVGSPSLTINLMYIEMIDETGQVSQEIMEQTLDLLNFAA
FT                   QKTGKEEKEMSVTFVTNERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPS
FT                   LAEMMAEFDAYIGELFISIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEE
FT                   KEMFTLQEEILTAYGLTRQ"
FT   gene            394138..394545
FT                   /gene="dgk"
FT                   /locus_tag="MGAS9429_Spy0389"
FT   CDS_pept        394138..394545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="MGAS9429_Spy0389"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31577"
FT                   /db_xref="GOA:Q1JN22"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN22"
FT                   /protein_id="ABF31577.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLLS
FT                   ACLACVAGLSFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            394665..395561
FT                   /gene="era"
FT                   /locus_tag="MGAS9429_Spy0390"
FT   CDS_pept        394665..395561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="MGAS9429_Spy0390"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31578"
FT                   /db_xref="GOA:Q1JN21"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN21"
FT                   /protein_id="ABF31578.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            395536..396057
FT                   /locus_tag="MGAS9429_Spy0391"
FT   CDS_pept        395536..396057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0391"
FT                   /product="phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31579"
FT                   /db_xref="GOA:Q1JN20"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN20"
FT                   /protein_id="ABF31579.1"
FT                   /translation="MAIMRKNTNIVKRDHMPQDYISYIRSKVGHDKIILNFAGGILTND
FT                   DGKVLMQLRGDKKTWAIPGGTMELGESSLETCKREFLEETGIEVEAVRLLNVYTHFEEV
FT                   YPNGDAVQTIVFIYELTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEE
FT                   YFSDSFAMGH"
FT   gene            complement(396363..396617)
FT                   /locus_tag="MGAS9429_Spy0392"
FT   CDS_pept        complement(396363..396617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31580"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN19"
FT                   /protein_id="ABF31580.1"
FT                   /translation="MSGLFYHKSYFFKSEQVYDLLNEIRMRYPHAHIILIGNHINYEEI
FT                   FKNHYRVFGVIDTTSHKSSKSIRDQIQLYLDELYNSNNG"
FT   gene            complement(396845..397426)
FT                   /locus_tag="MGAS9429_Spy0393"
FT   CDS_pept        complement(396845..397426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0393"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31581"
FT                   /db_xref="GOA:Q1JN18"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN18"
FT                   /protein_id="ABF31581.1"
FT                   /translation="MCKHTKRNKSCIVELRHFTRKRFIPMTQFTTELLNFLAQKQDIDE
FT                   FFRSSLEIAMNDLLQVELSAFLGYEPYEKEGYNTGNSRNGTYSRQFETKYGLVNLIIPR
FT                   DRNGEFSPVLLPSYARRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHLFLSGSLVIK
FT                   RSWHHLKRRKISLLSINSHITFGLAFTLQT"
FT   gene            397586..397897
FT                   /locus_tag="MGAS9429_Spy0394"
FT   CDS_pept        397586..397897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0394"
FT                   /product="bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31582"
FT                   /db_xref="GOA:Q1JN17"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN17"
FT                   /protein_id="ABF31582.1"
FT                   /translation="MILFFMIFCTSSRLQRDKFKNYEKKLFDMEVKKLETFHQMTIEKL
FT                   AKVEGGKNNWQANVSGVIAAGSAGAAIGFPVCGVACGYIGAKTAITLWAGVTGATGGF"
FT   gene            397910..398110
FT                   /locus_tag="MGAS9429_Spy0395"
FT   CDS_pept        397910..398110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0395"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31583"
FT                   /db_xref="GOA:Q1JN16"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN16"
FT                   /protein_id="ABF31583.1"
FT                   /translation="MTTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLLHPV
FT                   LAGGCVVGFTVGGAYLGYTAN"
FT   gene            398404..398598
FT                   /gene="silD"
FT                   /locus_tag="MGAS9429_Spy0396"
FT   CDS_pept        398404..398598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silD"
FT                   /locus_tag="MGAS9429_Spy0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31584"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN15"
FT                   /protein_id="ABF31584.1"
FT                   /translation="MEVLKNGLAIINGGGKDGANIFLTGMAGAAQGVTVCAQTGVFIPW
FT                   QGYILCGAAGAATNIIWPH"
FT   gene            398648..398944
FT                   /locus_tag="MGAS9429_Spy0397"
FT   CDS_pept        398648..398944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31585"
FT                   /db_xref="GOA:Q1JN14"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN14"
FT                   /protein_id="ABF31585.1"
FT                   /translation="MKTLDIIFNLSDRKMIFLENVEKLGGYIVPFTLIILSVAYNFRHP
FT                   YPIWAAVLGGISLIVIFIYFILIVYLYLRYRYLVWKKIPEIKINSTELSCNHI"
FT   gene            399123..399524
FT                   /locus_tag="MGAS9429_Spy0398"
FT   CDS_pept        399123..399524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31586"
FT                   /db_xref="GOA:Q1JN13"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN13"
FT                   /protein_id="ABF31586.1"
FT                   /translation="MRNILRFLGIVIISAVILFSIGSFYDLPLMKNIQLICWSFILDLF
FT                   VFVYKQRQTTEVLTWYQVVKQFWLFIKCTILIPTLIAFIIIIGCLTSISEVSIYFYLHL
FT                   TVVCYTIGMILSLGRLISPNHSIFNKLKK"
FT   gene            complement(399563..399679)
FT                   /locus_tag="MGAS9429_Spy0399"
FT   CDS_pept        complement(399563..399679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0399"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN12"
FT                   /protein_id="ABF31587.1"
FT                   /translation="MTSFGKDEYSRMENRLFLKLQRYLLVTNYSLIESVTLN"
FT   gene            399775..400845
FT                   /locus_tag="MGAS9429_Spy0400"
FT   CDS_pept        399775..400845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31588"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN11"
FT                   /protein_id="ABF31588.1"
FT                   /translation="MMMLRDVKVKTSSLLVGCAATLLVSLSSTVAADSVHSSDRRFGVG
FT                   YKEETTSQFSSDQPSQVVLYRGEANTVRFTYTNQMYLMKDIRIALDGSGKSLTAQTVPG
FT                   MGHVYEGFQTSARGIFTMSGVPESTVPVANPNVQTKYTRYFKVIDDMHNTMYKGTVFLV
FT                   QPQAWKYTMKSVDQLPVDDLNHIGVAGIERMTTLIKNAGALLTTGGSGAFPDNIKVSIN
FT                   PKGRQATITYGDGSTDIIPPAVLWKKGSVKEPTEADQSVGTPTPGIPGKFKRDQSLNEH
FT                   EAMVNVEPLSHVVKDNIKVIDEKSTGRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPA
FT                   TALPSVEMSAEDRLKS"
FT   gene            400938..401336
FT                   /locus_tag="MGAS9429_Spy0401"
FT   CDS_pept        400938..401336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31589"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN10"
FT                   /protein_id="ABF31589.1"
FT                   /translation="MHRLLNRLIPEEDNNKLSRAAKEVVTEPRLNNPFLLPKKVLSLED
FT                   DAAILNHLEEDRNVNKLFLEPVAAEAKREINFHPSDQQVTAKVKESSDFHQKQHQTGIT
FT                   YGDDTLADLAHHLLHSDGVIPSLNDKSA"
FT   gene            complement(401684..401953)
FT                   /locus_tag="MGAS9429_Spy0402"
FT   CDS_pept        complement(401684..401953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN09"
FT                   /protein_id="ABF31590.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPIPKHTIERKRTTMTIGHSK
FT                   QNPHKKEALKHKKNKNKALFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            402154..402261
FT                   /locus_tag="MGAS9429_Spy0403"
FT   CDS_pept        402154..402261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31591"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN08"
FT                   /protein_id="ABF31591.1"
FT                   /translation="MNGNDVSSMVLIQSFFITYQVDKPAASAISLNMTA"
FT   gene            402264..402380
FT                   /locus_tag="MGAS9429_Spy0404"
FT   CDS_pept        402264..402380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31592"
FT                   /db_xref="GOA:Q1JN07"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN07"
FT                   /protein_id="ABF31592.1"
FT                   /translation="MTSTTLATIKSFRSMIVDAAYGFAIGAKLFCGVSVFVD"
FT   gene            complement(402475..402717)
FT                   /locus_tag="MGAS9429_Spy0405"
FT   CDS_pept        complement(402475..402717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31593"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN06"
FT                   /protein_id="ABF31593.1"
FT                   /translation="MKQQGHTVMMCLNKTLTIKLSAPLTSNDLVPLSTNEVIIMEPLLH
FT                   LLPKVVPVLIHLVDKANVSWLTVILQLPILLKTIW"
FT   gene            403009..403890
FT                   /gene="mutR"
FT                   /locus_tag="MGAS9429_Spy0406"
FT   CDS_pept        403009..403890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="MGAS9429_Spy0406"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31594"
FT                   /db_xref="GOA:Q1JN05"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN05"
FT                   /protein_id="ABF31594.1"
FT                   /translation="MKVGKMEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGE
FT                   SEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDY
FT                   AHKDYERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYN
FT                   TLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRD
FT                   ELNFYEKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLG
FT                   GKGDEDWSEADL"
FT   gene            404062..404889
FT                   /gene="fpg"
FT                   /locus_tag="MGAS9429_Spy0407"
FT   CDS_pept        404062..404889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="MGAS9429_Spy0407"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31595"
FT                   /db_xref="GOA:Q1JN04"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN04"
FT                   /protein_id="ABF31595.1"
FT                   /translation="MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP"
FT   gene            404799..405479
FT                   /locus_tag="MGAS9429_Spy0408"
FT   CDS_pept        404799..405479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0408"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31596"
FT                   /db_xref="GOA:Q1JN03"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN03"
FT                   /protein_id="ABF31596.1"
FT                   /translation="MSSLWTGYCQIKSWRKGDAHLSKMPEKKTMIIGITGGIASGKSTV
FT                   VKVIRKAGYQVIDADQVVHDLQEKGGRLYEALREAFGNQILKADGELDRTKLSEMLFSN
FT                   PNNMATSSAIQNQIIKEELAAKRDHLAQSQAIFFMDIPLLMELGYQDWFDAIWLVYVDA
FT                   QTQLQRLMARNRLDKGKARQRIASQLPIEEKKPYASLVIDNNGDMETLIKQVQSALLSL
FT                   ANPR"
FT   gene            405669..407171
FT                   /locus_tag="MGAS9429_Spy0409"
FT   CDS_pept        405669..407171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0409"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31597"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN02"
FT                   /protein_id="ABF31597.1"
FT                   /translation="MTTMTIAKGSQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRMWDVFGQNGQ
FT                   PLRTTISEMGPMMLSRLLNLNDTQTGVLNIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNIAKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGYGAINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHALRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSDIESQQLVQ
FT                   SSPFASKYSQSIDRDSAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQAATKKAN
FT                   RRSVGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            407293..408486
FT                   /locus_tag="MGAS9429_Spy0410"
FT   CDS_pept        407293..408486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0410"
FT                   /product="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31598"
FT                   /db_xref="GOA:Q1JN01"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JN01"
FT                   /protein_id="ABF31598.1"
FT                   /translation="MNWRQNLKVAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYY
FT                   AGLAVAVTALASALFAPVWGKLADRYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILR
FT                   LLTGVFAGYVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQ
FT                   VFLLVGVILFLCSLMTAVYVKEEFKPIRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQ
FT                   ISAQSVTPILSLYIRHLGQTHNLMFTSGLVVSAMGFSSLFSSSYLGKLGDRFGNHRLLL
FT                   AALCYSFIMYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAY
FT                   NQMFSNLGQVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            408483..408629
FT                   /locus_tag="MGAS9429_Spy0411"
FT   CDS_pept        408483..408629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0411"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31599"
FT                   /db_xref="GOA:Q1JN00"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JN00"
FT                   /protein_id="ABF31599.1"
FT                   /translation="MRVKINLECSECGSNNYLTSKNKSSHPEKIKVPKYCPKERKVTLH
FT                   VET"
FT   gene            408675..408911
FT                   /gene="secG"
FT                   /locus_tag="MGAS9429_Spy0412"
FT   CDS_pept        408675..408911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="MGAS9429_Spy0412"
FT                   /product="protein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31600"
FT                   /db_xref="GOA:Q1JMZ9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ9"
FT                   /protein_id="ABF31600.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            409005..411338
FT                   /locus_tag="MGAS9429_Spy0413"
FT   CDS_pept        409005..411338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0413"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31601"
FT                   /db_xref="GOA:Q1JMZ8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ8"
FT                   /protein_id="ABF31601.1"
FT                   /translation="MMKERIMTYLKEHGKSNVNDLAAALEMAGAKHFPSLIKTISKMES
FT                   QSLLRFSDDGSLALRKEREKKKEPTVQGVFRANKAGFGFLHVDENEDDMFIGRNDVGYA
FT                   IDGDTVEVVVKKPADRLKGTAAEAKVVAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQ
FT                   KIQQKIYIKKEPVVLKGTEIIKVDIDKYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLE
FT                   SMDIVSEFPAEVLAEANAISEAPTAKDLIGRVDLRQETTITIDGADAKDLDDAIHIKLL
FT                   DNGNYELGVHIADVSYYVTEGSALDKEAIARGTSVYVTDRVVPMLPERLSNGICSLNPN
FT                   VDRLTQSALMEINSQGHVVNYQICQSVIKTTYRMTYSTVNDMIAGDEEALQEFASIADD
FT                   VTLMVALHRILEAMRSKRGALNFDTQEAKVIVNDKGIPVDVVLRQRGIAERMIESFMLA
FT                   ANECVAEHFAKAKLPFIYRIHEEPKAEKLQQFIDYASTFGIHIQGTANKISQEALQAFM
FT                   AKVEGQPGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMV
FT                   REYSQPSQEKRDHFTQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGI
FT                   VASVVKFGFFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLV
FT                   KADKETGDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGIKKKEPKEVAKAKTK
FT                   GKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            411341..411808
FT                   /locus_tag="MGAS9429_Spy0414"
FT   CDS_pept        411341..411808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0414"
FT                   /product="ssrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31602"
FT                   /db_xref="GOA:Q1JMZ7"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMZ7"
FT                   /protein_id="ABF31602.1"
FT                   /translation="MAKGEGHILAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLANELKGSGMT
FT                   LAPLKVYLKDGFAKVLIGLAKGKHEYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            411814..412533
FT                   /locus_tag="MGAS9429_Spy0415"
FT   CDS_pept        411814..412533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0415"
FT                   /product="glutaminyl-peptide cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31603"
FT                   /db_xref="GOA:Q1JMZ6"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ6"
FT                   /protein_id="ABF31603.1"
FT                   /translation="MSIMITKGQVCLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFS
FT                   KVGVYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKATCNCLGAYP
FT                   FEGDGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVD
FT                   GYLYANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQR
FT                   FLITGKLYPLMLEVVLD"
FT   gene            complement(412648..413295)
FT                   /gene="pcp"
FT                   /locus_tag="MGAS9429_Spy0416"
FT   CDS_pept        complement(412648..413295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="MGAS9429_Spy0416"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31604"
FT                   /db_xref="GOA:Q1JMZ5"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMZ5"
FT                   /protein_id="ABF31604.1"
FT                   /translation="MKILVTGFDPFGGEAINPALEAIKKLPATIHGAEIKYIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRA
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(413345..414271)
FT                   /locus_tag="MGAS9429_Spy0417"
FT   CDS_pept        complement(413345..414271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0417"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31605"
FT                   /db_xref="GOA:Q1JMZ4"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ4"
FT                   /protein_id="ABF31605.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPAFNEQKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGDVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIISHIALMYLLAYY"
FT   gene            complement(414271..415011)
FT                   /locus_tag="MGAS9429_Spy0418"
FT   CDS_pept        complement(414271..415011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0418"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31606"
FT                   /db_xref="GOA:Q1JMZ3"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ3"
FT                   /protein_id="ABF31606.1"
FT                   /translation="MQILATNVIIVILLKKEFFMEWIKLIGIVIIVLGFILKCDAIATV
FT                   VVAGLVTALVSGISFIDFLDILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQ
FT                   RVQALTVGRLLTLYLIIRELAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDAE
FT                   KDDIKAMAAANENFGNFFAQNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIIS
FT                   IIIVAIYNYLFEKKMERQHQKGDN"
FT   gene            complement(415165..416151)
FT                   /locus_tag="MGAS9429_Spy0419"
FT   CDS_pept        complement(415165..416151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0419"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31607"
FT                   /db_xref="GOA:Q1JMZ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ2"
FT                   /protein_id="ABF31607.1"
FT                   /translation="MKYLSFCVTIALKFHLKEKSMTLLSIIVPCFNEEANILPYFEEMH
FT                   QLETSMSNQLAFEYIFIDDGSKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLK
FT                   EAKGNYITVMDVDLQDPPELLPVMYAKLKEGYDIVGTRRQNRQGEPLIRSMCSNLFYGL
FT                   IKHLSDTEMVNGVRDYRLMTRQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRK
FT                   YGKSRWHFWELLRYSLDGFINFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPV
FT                   SGWASTVSIILFMGGIQLFCMGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(416236..416613)
FT                   /gene="gloA"
FT                   /locus_tag="MGAS9429_Spy0420"
FT   CDS_pept        complement(416236..416613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="MGAS9429_Spy0420"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31608"
FT                   /db_xref="GOA:Q1JMZ1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ1"
FT                   /protein_id="ABF31608.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(416624..417289)
FT                   /locus_tag="MGAS9429_Spy0421"
FT   CDS_pept        complement(416624..417289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0421"
FT                   /product="NAD(P)H-dependent quinone reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31609"
FT                   /db_xref="GOA:Q1JMZ0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMZ0"
FT                   /protein_id="ABF31609.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   VGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(417338..418423)
FT                   /gene="pepQ"
FT                   /locus_tag="MGAS9429_Spy0422"
FT   CDS_pept        complement(417338..418423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="MGAS9429_Spy0422"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31610"
FT                   /db_xref="GOA:Q1JMY9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY9"
FT                   /protein_id="ABF31610.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFRYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTSYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTHTPKELLYFEG"
FT   gene            418597..419598
FT                   /gene="ccpA"
FT                   /locus_tag="MGAS9429_Spy0423"
FT   CDS_pept        418597..419598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="MGAS9429_Spy0423"
FT                   /product="catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31611"
FT                   /db_xref="GOA:Q1JMY8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY8"
FT                   /protein_id="ABF31611.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            419729..420727
FT                   /locus_tag="MGAS9429_Spy0424"
FT   CDS_pept        419729..420727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0424"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31612"
FT                   /db_xref="GOA:Q1JMY7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY7"
FT                   /protein_id="ABF31612.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRETYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADSKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            420729..422063
FT                   /locus_tag="MGAS9429_Spy0425"
FT   CDS_pept        420729..422063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0425"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31613"
FT                   /db_xref="GOA:Q1JMY6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY6"
FT                   /protein_id="ABF31613.1"
FT                   /translation="MRIGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGNGPYLQDLKHLAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   VIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLSLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            422485..424428
FT                   /gene="thrS"
FT                   /locus_tag="MGAS9429_Spy0426"
FT   CDS_pept        422485..424428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="MGAS9429_Spy0426"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31614"
FT                   /db_xref="GOA:Q1JMY5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMY5"
FT                   /protein_id="ABF31614.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESISKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNAEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFQR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEDKSVNVRRYGSKATHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            424569..425561
FT                   /gene="drrA"
FT                   /locus_tag="MGAS9429_Spy0427"
FT   CDS_pept        424569..425561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drrA"
FT                   /locus_tag="MGAS9429_Spy0427"
FT                   /product="daunorubicin resistance ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31615"
FT                   /db_xref="GOA:Q1JMY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY4"
FT                   /protein_id="ABF31615.1"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQDYVRDIGAVFG
FT                   QRTQLWWDLALQETYVVLKEIYDVPEKAFRKRMDFLNEVLDLNEFIKDPVRILSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQSFGKMKSLSFELRPGQEQVVSQFMGLPDITVERHE
FT                   LSLDIQYDSSRYQTADIIQKTMADFAVRDLKMTDVDIEDIVRRFYRKEL"
FT   gene            425512..426381
FT                   /locus_tag="MGAS9429_Spy0428"
FT   CDS_pept        425512..426381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0428"
FT                   /product="daunorubicin resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31616"
FT                   /db_xref="GOA:Q1JMY3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY3"
FT                   /protein_id="ABF31616.1"
FT                   /translation="MLILRILFVVSTERSFKMWSFWKRYRPFLSAGIQELITYRVNFFL
FT                   YRIGDVMGAFVAYYLWKAVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTKSDSSFMIG
FT                   EEVKDGSIIMRLLRPVHFAASYLFMEIGFRWIVLMSVGFPFLVVLSGIKVMAGLSILQV
FT                   LASSCLYLVSLLLAFLINFYFNICFGFSAFVFKNLWGSNLLKNALVAFMSGSLIPLAFF
FT                   PKMVSIVLSFLPFSSLVYTPVMIVIGKYSLSQIMVALSLQIFWLLVMVVLSQVIWKKVQ
FT                   YHLTIQGG"
FT   gene            426383..427168
FT                   /locus_tag="MGAS9429_Spy0429"
FT   CDS_pept        426383..427168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0429"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31617"
FT                   /db_xref="GOA:Q1JMY2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY2"
FT                   /protein_id="ABF31617.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFVIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLDAYESAGS"
FT   gene            427254..427403
FT                   /locus_tag="MGAS9429_Spy0430"
FT   CDS_pept        427254..427403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0430"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31618"
FT                   /db_xref="GOA:Q1JMY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY1"
FT                   /protein_id="ABF31618.1"
FT                   /translation="MQLLDNVYGTLRSFAFMRPVKSSNDTSLADALQADTDMAFILVRG
FT                   INYQ"
FT   gene            427798..428946
FT                   /locus_tag="MGAS9429_Spy0431"
FT   CDS_pept        427798..428946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0431"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31619"
FT                   /db_xref="GOA:Q1JMY0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMY0"
FT                   /protein_id="ABF31619.1"
FT                   /translation="MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPI
FT                   DQVICGNAVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASN
FT                   LLVGGIESSSLQPESVYASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEY
FT                   LNHWILRSHQKASYCQEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVIS
FT                   AANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMAD
FT                   MTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIK
FT                   NGHYGIAAIAAAGGQGFAVLLKYHKEFSHADKARILGKAMPK"
FT   gene            428903..429988
FT                   /locus_tag="MGAS9429_Spy0432"
FT   CDS_pept        428903..429988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0432"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31620"
FT                   /db_xref="GOA:Q1JMX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX9"
FT                   /protein_id="ABF31620.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTYQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLRGLKEGSCPIILHPNISGTFQQQIKHVDGELLEKADFAVLSS
FT                   GTTGKAKLFWRCLSTWTRLFDYQNKMFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLSLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELRSPSAKRQR
FT                   SARFKDRKRRKRNPNISISFD"
FT   gene            430207..431241
FT                   /locus_tag="MGAS9429_Spy0433"
FT   CDS_pept        430207..431241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0433"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31621"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX8"
FT                   /protein_id="ABF31621.1"
FT                   /translation="MCYNMVKKDEEKAMKQAILDRYQALKCYQNAGLSNQAFRAIAKEP
FT                   MIDNRLGSPTFWVIWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSL
FT                   LPDHMFWKELASLVDQAFPGKTLSQAGELEKRLHQFRYVISSQQAQSIRNHYKMIEMTD
FT                   AQALALFLRSKKGPCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWF
FT                   HTEFILDSTGFFLNEVDAEVVTEKGIVNGASFNYGTDGPRHWDLDVDPISRHDPQFRRD
FT                   TLKGFRSPKRVFRQWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPI
FT                   KGWF"
FT   gene            431403..432113
FT                   /gene="vicR"
FT                   /locus_tag="MGAS9429_Spy0434"
FT   CDS_pept        431403..432113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="MGAS9429_Spy0434"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31622"
FT                   /db_xref="GOA:Q1JMX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX7"
FT                   /protein_id="ABF31622.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            432106..433458
FT                   /gene="vicK"
FT                   /locus_tag="MGAS9429_Spy0435"
FT   CDS_pept        432106..433458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="MGAS9429_Spy0435"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31623"
FT                   /db_xref="GOA:Q1JMX6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX6"
FT                   /protein_id="ABF31623.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            433462..434271
FT                   /gene="vicX"
FT                   /locus_tag="MGAS9429_Spy0436"
FT   CDS_pept        433462..434271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="MGAS9429_Spy0436"
FT                   /product="Zn-dependent hydrolase (beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31624"
FT                   /db_xref="GOA:Q1JMX5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX5"
FT                   /protein_id="ABF31624.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            434703..435395
FT                   /gene="acpA"
FT                   /locus_tag="MGAS9429_Spy0437"
FT   CDS_pept        434703..435395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="MGAS9429_Spy0437"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31625"
FT                   /db_xref="GOA:Q1JMX4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMX4"
FT                   /protein_id="ABF31625.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            435396..438935
FT                   /gene="smc"
FT                   /locus_tag="MGAS9429_Spy0438"
FT   CDS_pept        435396..438935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="MGAS9429_Spy0438"
FT                   /product="chromosome partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31626"
FT                   /db_xref="GOA:Q1JMX3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX3"
FT                   /protein_id="ABF31626.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAALQQDLASYYAKRQSMEEDYQKFKQKKQVISQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QRTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQEG
FT                   DKRVQELERDYQLKQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEIALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLATCEGYLGTAESLVRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGTNRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKALLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKNALTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEARLEETAEKITKESEKNDTFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLADAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAIIQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQEMTN"
FT   gene            complement(439188..440060)
FT                   /locus_tag="MGAS9429_Spy0439"
FT   CDS_pept        complement(439188..440060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0439"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31627"
FT                   /db_xref="GOA:Q1JMX2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX2"
FT                   /protein_id="ABF31627.1"
FT                   /translation="MLGKWENMKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFER
FT                   GESEISCIRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIAC
FT                   LLSDTSDYTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGN
FT                   CVRTINYNSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLID
FT                   EIKTLLDNELNFYEQTVFLYATGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYAD
FT                   HFDKLVNKD"
FT   gene            440259..441185
FT                   /gene="aroE2"
FT                   /locus_tag="MGAS9429_Spy0440"
FT   CDS_pept        440259..441185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE2"
FT                   /locus_tag="MGAS9429_Spy0440"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31628"
FT                   /db_xref="GOA:Q1JMX1"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX1"
FT                   /protein_id="ABF31628.1"
FT                   /translation="MLVLYVSSKLIKRRRMKFMYSALLGNPVEHSISDELFEYLNHNIG
FT                   VLDEYKHKKILVDSVCLEDKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGS
FT                   VNNIYKSGNIITGTNTDWKGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISP
FT                   TVVYREPISENTRSLIKSFPDLKYITYKELADQQILNDIEIIINTTPVGMINYEESLPI
FT                   NFDHLDNVNYKDKYFMDVVFNPLHTKLHEYFGKKGAKIIDGLWVLIFQGIEAFSLWSDK
FT                   INDGKYFFSKDDVVLIHTFLEGKIKGK"
FT   gene            441182..442018
FT                   /locus_tag="MGAS9429_Spy0441"
FT   CDS_pept        441182..442018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0441"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31629"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMX0"
FT                   /protein_id="ABF31629.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            441996..442754
FT                   /locus_tag="MGAS9429_Spy0442"
FT   CDS_pept        441996..442754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31630"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW9"
FT                   /protein_id="ABF31630.1"
FT                   /translation="MSILMEAKMNLSIFGLKNIPYLKEGDSIEKLIEESIKTSGFFIED
FT                   NDVLCIASKVVSVAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRL
FT                   DIKKNYIGCRLENGLKLTSGGIDRKSVDEVFLLPNNPDASAKRISEYLKKSLGKNVAVV
FT                   ITDSDGREDKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMG
FT                   QRGTGIPAVLIRGLDYKWSENTSIKEALNE"
FT   gene            442747..443733
FT                   /locus_tag="MGAS9429_Spy0443"
FT   CDS_pept        442747..443733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW8"
FT                   /protein_id="ABF31631.1"
FT                   /translation="MSRNQDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYSYISIEKPLCNRLEDLEEM
FT                   KSLVESHPHLAKKMFASEQYFFSKILEKLLQVDCFSLDKIKEITVNFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            443743..444942
FT                   /gene="metK1"
FT                   /locus_tag="MGAS9429_Spy0444"
FT   CDS_pept        443743..444942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK1"
FT                   /locus_tag="MGAS9429_Spy0444"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31632"
FT                   /db_xref="GOA:Q1JMW7"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW7"
FT                   /protein_id="ABF31632.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSSIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            444926..445894
FT                   /locus_tag="MGAS9429_Spy0445"
FT   CDS_pept        444926..445894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0445"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31633"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW6"
FT                   /protein_id="ABF31633.1"
FT                   /translation="MFMMDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINIL
FT                   GSVKFINSNQQLIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEHSDTLLIHA
FT                   AAVYNPLSGHSILLLGDKGAGKTTVAIRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTS
FT                   FFKIRRTAVLSDNLLFKLFSKFFNRSLQFNKASWDDKISIFPKELGIRTCNFSTEISKI
FT                   YYIKTDKKEKQIYHSIWNDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEK
FT                   NNRVREQIVKGIFAKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            445949..446938
FT                   /locus_tag="MGAS9429_Spy0446"
FT   CDS_pept        445949..446938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0446"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31634"
FT                   /db_xref="GOA:Q1JMW5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW5"
FT                   /protein_id="ABF31634.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKFFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLQEEKQ
FT                   YPHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            447446..447583
FT                   /locus_tag="MGAS9429_Spy0447"
FT   CDS_pept        447446..447583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31635"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW4"
FT                   /protein_id="ABF31635.1"
FT                   /translation="MFQKGEYLGSFSDKSEFLSRHPKIYIISFRYKNQFYILSNKKIDL
FT                   "
FT   gene            447607..448764
FT                   /locus_tag="MGAS9429_Spy0448"
FT   CDS_pept        447607..448764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0448"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31636"
FT                   /db_xref="GOA:Q1JMW3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW3"
FT                   /protein_id="ABF31636.1"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSSL
FT                   KEAAINKLLCKAKNINATSSEELAYKDATFIILSLPTNLKVNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNRFHYNDIIFSPEFLREGSTIHDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSPSLLVGSSEAEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKMILNSSAKTIGIYRINSKKDSDNCRESSTIDVAKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            448849..450057
FT                   /gene="mefE"
FT                   /locus_tag="MGAS9429_Spy0449"
FT   CDS_pept        448849..450057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mefE"
FT                   /locus_tag="MGAS9429_Spy0449"
FT                   /product="macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31637"
FT                   /db_xref="GOA:Q1JMW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW2"
FT                   /protein_id="ABF31637.1"
FT                   /translation="MNNRKKNIQYLVYSKVIYRIGDVMFDFANNTFLAGLNPASLSLVA
FT                   VYQSLESVIGVLFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVL
FT                   TNVILAFMSAFSSPSYKAFTKEIVKKDSISQLNSLLETTSTVIKVTVPMVAIFLYKLLG
FT                   IHGVLLLDGLSFLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGFKYVYSHKSIFI
FT                   ITVLSALVNFFLAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKEL
FT                   SSMRLILFLSLSGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVD
FT                   NDFLGRVFGIIFTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITILSLVFRILFKKY
FT                   NIR"
FT   gene            complement(450160..450369)
FT                   /locus_tag="MGAS9429_Spy0450"
FT   CDS_pept        complement(450160..450369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0450"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31638"
FT                   /db_xref="GOA:Q1JMW1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW1"
FT                   /protein_id="ABF31638.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENITTD
FT                   ILLEICIALDCKIEDIVEIVDNNI"
FT   gene            complement(450359..450832)
FT                   /locus_tag="MGAS9429_Spy0451"
FT   CDS_pept        complement(450359..450832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0451"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31639"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMW0"
FT                   /protein_id="ABF31639.1"
FT                   /translation="MKRSTEDILLDLEVKINSKMREVNNILYPDIRKAPQINLNAHNSY
FT                   SFYTPDDDGTGTKFKGMIVFDLVMLYLTNLPALAHDSLLLSNVSYQATEALLKLYDQSR
FT                   SLNKQVFLAFDKASSYSPDANQLLSENTVLRLSSNGNELYGISWNKGENSDEI"
FT   gene            complement(450845..452017)
FT                   /locus_tag="MGAS9429_Spy0452"
FT   CDS_pept        complement(450845..452017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0452"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV9"
FT                   /protein_id="ABF31640.1"
FT                   /translation="MLIEMWSPVFKNHGEIRESICFHYGLNVIMGMDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSGDTANPDIILVCDKSYSPTG
FT                   ETMDLGIFLNKLKKRYHLDSPELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARKYTFISNLVGGKKQFEANVSEIKRL
FT                   EYDLAHLQDTHQDKIDSDDIEKNQQKLQLRNTKLELESSLRDKQRRLKLLDISIEFGLY
FT                   PTESDLTELQQYFPDTNLKKLYEVEAYHKKLETILDSEFSTERESLIAEIDELESQLTT
FT                   LNQELQELGNIPNLSSEYLENYSKLTATINALKEQNEAYLKESGLSKEKS"
FT   gene            complement(452008..452232)
FT                   /locus_tag="MGAS9429_Spy0453"
FT   CDS_pept        complement(452008..452232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31641"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV8"
FT                   /protein_id="ABF31641.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEVKLCL"
FT   gene            complement(452232..453326)
FT                   /locus_tag="MGAS9429_Spy0454"
FT   CDS_pept        complement(452232..453326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31642"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV7"
FT                   /protein_id="ABF31642.1"
FT                   /translation="MTQLKTQYPSLIIDASFITLAANATVKPQDKTYNTVNLLNRFFLI
FT                   WLDVASRGLSHHHVLSHPFKDWMTTMLDFPFHHEFIEFLGRWTHILITLLKRHHGQADT
FT                   AIPRYLLVTIREKTGIVKSTTVQNTAFTTQSNQLKKQYGQFLLTESNNCCACPGCDRPL
FT                   ILTSGNLAAENYEVSAIEKDKDAEPLNLIALCPDCFLSYQADSRKKIVTALKNVKKILV
FT                   SAHNSQQAISDMKLDSGIVSVLTSLNKLKCDEYDISYDSKQLTDKISPENNRTLYQLVK
FT                   NPVIDNYLTIQKIIVNLDKQGKIDYEEIQYQTRSMYKKLKAAKHNNLAIFNTISEKLHK
FT                   ATLQDIYFCQTIVSYFIQKCEVLE"
FT   gene            453345..453674
FT                   /locus_tag="MGAS9429_Spy0455"
FT   CDS_pept        453345..453674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0455"
FT                   /product="plasmid stabilization system antitoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31643"
FT                   /db_xref="GOA:Q1JMV6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV6"
FT                   /protein_id="ABF31643.1"
FT                   /translation="MSLQKRRITMAKTGTLNLRVDDSVKSAADDILKRLGIPMSTAIDM
FT                   FLNQIILTGGIPFDVSLPEAPQRVNVDYMSQEKFYDKLISSFEDAKTGNRKDVREFLSQ
FT                   LKENA"
FT   gene            453674..453979
FT                   /locus_tag="MGAS9429_Spy0456"
FT   CDS_pept        453674..453979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0456"
FT                   /product="plasmid stabilization system toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31644"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV5"
FT                   /protein_id="ABF31644.1"
FT                   /translation="MKEYQVTMSDDAKADLLSIYHYVRDELCAPQAADNLLERLSQEML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            454112..454270
FT                   /locus_tag="MGAS9429_Spy0457"
FT   CDS_pept        454112..454270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0457"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31645"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV4"
FT                   /protein_id="ABF31645.1"
FT                   /translation="MVLSPSDSKLSADHQSLSSDEQMTTVVEQARLDEIATSVLSRHLD
FT                   AFKELTE"
FT   gene            454375..455148
FT                   /locus_tag="MGAS9429_Spy0458"
FT   CDS_pept        454375..455148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0458"
FT                   /product="portal protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31646"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV3"
FT                   /protein_id="ABF31646.1"
FT                   /translation="MGLLDLIGRKRARDKPQNSYEGQDFFYLFGRTTSGENVDEFKGIK
FT                   VEFIQLSNKNIFDVLEKDLSKKLRFEDISIEAILGKYLCNNDIEIIKYLYEKDKINMEL
FT                   LISLISKISNKLVKQEFIKVLVLYEYVKNFLPADCIYFSLSNLYGTGHYSSMNYKIFIR
FT                   TKSGDIFDIADGGRIDDMVSKFNKVNVLGVCMGIGTTVLSQEIEYEIEDRIMILVEKID
FT                   VKIYKNCLELANKLSGYQSFFNMNYIRDIIILLFD"
FT   gene            complement(455591..456322)
FT                   /locus_tag="MGAS9429_Spy0459"
FT   CDS_pept        complement(455591..456322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0459"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31647"
FT                   /db_xref="GOA:Q1JMV2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV2"
FT                   /protein_id="ABF31647.1"
FT                   /translation="MDNQIYRKQILEIYTKANKRLGVKSIKVILQRDYDTKISEGRIYR
FT                   LMKNMALPKMATVKPKTALKRTQKTYPQNLLNQKFNPDKPNQVWSTDFTYISIGYKKYV
FT                   YLCAILDLYSRKCIAWKLSHHMDAKLACDTLELALNKRKIEGTLLFHSDQGSQFKARKL
FT                   RKIIDDNTIMHSFSKPGYPYDNAVTEAFFKYLKHRQINRKKYQNIKQVQLDCFEYIENF
FT                   YNNYNPHTANLGLTPNQKEEN"
FT   gene            complement(456442..456762)
FT                   /locus_tag="MGAS9429_Spy0461"
FT   CDS_pept        complement(456442..456762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0461"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31648"
FT                   /db_xref="GOA:Q1JMV1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV1"
FT                   /protein_id="ABF31648.1"
FT                   /translation="MLQSVLKDTKTKGQPMSTVKRYDEEFKQSLVNLYQTGKTQSELCK
FT                   DYGVSASALAKWIKQYSQVKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASAIFMQN
FT                   LK"
FT   gene            456737..456862
FT                   /locus_tag="MGAS9429_Spy0460"
FT   CDS_pept        456737..456862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31649"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMV0"
FT                   /protein_id="ABF31649.1"
FT                   /translation="MSFKTDCNTQSFVYFYSIHPVVIYKNKKVAVHFKNGQVIEI"
FT   gene            457021..457818
FT                   /locus_tag="MGAS9429_Spy0462"
FT   CDS_pept        457021..457818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0462"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31650"
FT                   /db_xref="GOA:Q1JMU9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU9"
FT                   /protein_id="ABF31650.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYHGEILFADMMTKEQYTEVAKKVLANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            457822..458646
FT                   /locus_tag="MGAS9429_Spy0463"
FT   CDS_pept        457822..458646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0463"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31651"
FT                   /db_xref="GOA:Q1JMU8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU8"
FT                   /protein_id="ABF31651.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQVCQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVAELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            458646..460196
FT                   /gene="ftsY"
FT                   /locus_tag="MGAS9429_Spy0464"
FT   CDS_pept        458646..460196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="MGAS9429_Spy0464"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31652"
FT                   /db_xref="GOA:Q1JMU7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU7"
FT                   /protein_id="ABF31652.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQDKI
FT                   EVVQQEDVSSEGAGSVENGPEAASVNAQVEEETGDNSNHSSEDTNEFAADKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSANEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATYDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKEVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(460251..461618)
FT                   /locus_tag="MGAS9429_Spy0465"
FT   CDS_pept        complement(460251..461618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0465"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31653"
FT                   /db_xref="GOA:Q1JMU6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU6"
FT                   /protein_id="ABF31653.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFNWQWIFICILPVPLIAGILAYYYLEDSPVSEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENGSVNLYYLGLFILSLILFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTLLGALLAPAFGKLYDQKGARLSLYLGNALFSL
FT                   SLIIMTLQTRHFMLLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTAMASLIANSQPEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            461946..462788
FT                   /gene="licT"
FT                   /locus_tag="MGAS9429_Spy0466"
FT   CDS_pept        461946..462788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="MGAS9429_Spy0466"
FT                   /product="transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31654"
FT                   /db_xref="GOA:Q1JMU5"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU5"
FT                   /protein_id="ABF31654.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLGVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSEMSYD
FT                   DDDAELLIVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            462790..464652
FT                   /locus_tag="MGAS9429_Spy0467"
FT   CDS_pept        462790..464652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0467"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31655"
FT                   /db_xref="GOA:Q1JMU4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU4"
FT                   /protein_id="ABF31655.1"
FT                   /translation="MTYQETAKAILAAVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KSISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQTVAFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLALFGAPVTPASYGSSVIPILMMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSNTMLAIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFTNALIAGAATIVLAFSLTWFMGIDEESPEQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGEVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDFVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKIVTKEDALLVIL"
FT   gene            464671..466095
FT                   /gene="bglA"
FT                   /locus_tag="MGAS9429_Spy0468"
FT   CDS_pept        464671..466095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="MGAS9429_Spy0468"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31656"
FT                   /db_xref="GOA:Q1JMU3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU3"
FT                   /protein_id="ABF31656.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(466194..467033)
FT                   /locus_tag="MGAS9429_Spy0469"
FT   CDS_pept        complement(466194..467033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0469"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31657"
FT                   /db_xref="GOA:Q1JMU2"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU2"
FT                   /protein_id="ABF31657.1"
FT                   /translation="MFTCGGALMIRFLILSGYFELTMYLQLSGKLDQYINVRYSYLAYI
FT                   SMVLSFILALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTV
FT                   SAKGYTFPLAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVT
FT                   ITTENYMEVMELIYLYPDEFLDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYG
FT                   LLTTGNQTSYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(467009..467911)
FT                   /locus_tag="MGAS9429_Spy0470"
FT   CDS_pept        complement(467009..467911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0470"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31658"
FT                   /db_xref="GOA:Q1JMU1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU1"
FT                   /protein_id="ABF31658.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            complement(468059..468214)
FT                   /locus_tag="MGAS9429_Spy0471"
FT   CDS_pept        complement(468059..468214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMU0"
FT                   /protein_id="ABF31659.1"
FT                   /translation="MAITHKKNDELEKMLAGFASIPSFDRPLEVNTDGKLATKEKTTEQ
FT                   TKPSKP"
FT   gene            468427..470580
FT                   /locus_tag="MGAS9429_Spy0472"
FT   CDS_pept        468427..470580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0472"
FT                   /product="transcription accessory protein (S1 RNA binding
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31660"
FT                   /db_xref="GOA:Q1JMT9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT9"
FT                   /protein_id="ABF31660.1"
FT                   /translation="MCYNSNIMENNNNHNIAEALSVSLHQIEQVLALTAQGNTIPFIAR
FT                   YRKEVTGNLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLA
FT                   DLEELYLPYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPQEALA
FT                   GAVDILVEAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYNFSDQVSNMQ
FT                   GYRTLALNRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAME
FT                   RRVRSELSDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKL
FT                   LTTQVIYPVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFP
FT                   NTSYVIVNESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGV
FT                   GQYQHDVSQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREE
FT                   NGALTSRADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLGI
FT                   QDLDDAAKATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILD
FT                   LKDLEIGQKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTV
FT                   WVSKIDLDRHKVNLSLLPPRDTH"
FT   gene            470522..471004
FT                   /locus_tag="MGAS9429_Spy0473"
FT   CDS_pept        470522..471004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0473"
FT                   /product="metallopeptidase, SprT family"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31661"
FT                   /db_xref="GOA:Q1JMT8"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT8"
FT                   /protein_id="ABF31661.1"
FT                   /translation="MTWTATRSISAYCHRVTLTNYVQEVSLADFGKPFHHKAYWNKRLK
FT                   TTGGRFFPKDGHLDFNPRMLEEHGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLL
FT                   AQVNGLRYVPTSSKSKTNHHYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS"
FT   gene            471068..471340
FT                   /locus_tag="MGAS9429_Spy0474"
FT   CDS_pept        471068..471340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0474"
FT                   /product="stress-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31662"
FT                   /db_xref="GOA:Q1JMT7"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT7"
FT                   /protein_id="ABF31662.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            471612..472637
FT                   /gene="ptsK"
FT                   /locus_tag="MGAS9429_Spy0475"
FT   CDS_pept        471612..472637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="MGAS9429_Spy0475"
FT                   /product="HPR(SER) kinase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="3.1.3.-"
FT                   /note="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31663"
FT                   /db_xref="GOA:Q1JMT6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT6"
FT                   /protein_id="ABF31663.1"
FT                   /translation="MVSLFSFSSEKMSICKGLTVDLCYNIEKGEIMTVTVKMLVQKVKL
FT                   DVVYATDNLLSKEITTSDISRPGLEMTGYFDYYAPERLQLFGMKEWSYLTQMTSHNRYS
FT                   VLKEMFKKDTPAVVVSRNLAIPKEMVQAAKEEGISLLSSRVSTSRLAGEMSYFLDASLA
FT                   ERTSVHGVLMDIYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWG
FT                   EPAEILRHLLEIRGVGIIDVMSLYGASAVKDSSQVQLAIYLENFEAGKVFDRLGNGNEE
FT                   ITFSGVRIPRIRIPVKTGRNVSVVIEAAAMNHRAKEMGFDATKTFEDRLTQLITKNEVS
FT                   Q"
FT   gene            472634..473413
FT                   /gene="lgt"
FT                   /locus_tag="MGAS9429_Spy0476"
FT   CDS_pept        472634..473413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MGAS9429_Spy0476"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31664"
FT                   /db_xref="GOA:Q1JMT5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMT5"
FT                   /protein_id="ABF31664.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESLWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            473435..473842
FT                   /locus_tag="MGAS9429_Spy0477"
FT   CDS_pept        473435..473842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31665"
FT                   /db_xref="GOA:Q1JMT4"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT4"
FT                   /protein_id="ABF31665.1"
FT                   /translation="MDLVGISLMIIALGFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANILVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            473814..474263
FT                   /locus_tag="MGAS9429_Spy0478"
FT   CDS_pept        473814..474263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0478"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31666"
FT                   /db_xref="GOA:Q1JMT3"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT3"
FT                   /protein_id="ABF31666.1"
FT                   /translation="MEKKEKSMNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAY
FT                   QAYKESPDDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQ
FT                   KTKETLAEVEAKEKQDDVIIDLNEEDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(474423..474707)
FT                   /locus_tag="MGAS9429_Spy0479"
FT   CDS_pept        complement(474423..474707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31667"
FT                   /db_xref="GOA:Q1JMT2"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT2"
FT                   /protein_id="ABF31667.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLLAKVIKSLLM"
FT   gene            474906..475832
FT                   /locus_tag="MGAS9429_Spy0480"
FT   CDS_pept        474906..475832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0480"
FT                   /product="peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31668"
FT                   /db_xref="GOA:Q1JMT1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT1"
FT                   /protein_id="ABF31668.1"
FT                   /translation="MEKIIITATAESIEQVKALLAAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCPGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            475934..477220
FT                   /locus_tag="MGAS9429_Spy0481"
FT   CDS_pept        475934..477220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0481"
FT                   /product="peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31669"
FT                   /db_xref="GOA:Q1JMT0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMT0"
FT                   /protein_id="ABF31669.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERRSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESPE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRT"
FT   gene            complement(477233..477361)
FT                   /locus_tag="MGAS9429_Spy0482"
FT   CDS_pept        complement(477233..477361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31670"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS9"
FT                   /protein_id="ABF31670.1"
FT                   /translation="MTHSPIILSSFEKISYCDIQFSKKTGSLFPTMVVYHLEKEGL"
FT   gene            477430..477642
FT                   /locus_tag="MGAS9429_Spy0483"
FT   CDS_pept        477430..477642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0483"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31671"
FT                   /db_xref="GOA:Q1JMS8"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS8"
FT                   /protein_id="ABF31671.1"
FT                   /translation="MAEFTFNIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(477739..477879)
FT                   /locus_tag="MGAS9429_Spy0484"
FT   CDS_pept        complement(477739..477879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31672"
FT                   /db_xref="GOA:Q1JMS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS7"
FT                   /protein_id="ABF31672.1"
FT                   /translation="MTKEYISYISATIFLLYGLLAAKWIFLGLGLILVLVGLADRLNSK
FT                   K"
FT   gene            complement(478015..479520)
FT                   /gene="lysS"
FT                   /locus_tag="MGAS9429_Spy0485"
FT   CDS_pept        complement(478015..479520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="MGAS9429_Spy0485"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31673"
FT                   /db_xref="GOA:Q1JMS6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS6"
FT                   /protein_id="ABF31673.1"
FT                   /translation="MEENMSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFDRTANS
FT                   AELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVG
FT                   EDNYEIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIET
FT                   IYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFV
FT                   THHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQA
FT                   YADYLDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFW
FT                   PEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLA
FT                   KKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYD
FT                   FVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            479682..480584
FT                   /locus_tag="MGAS9429_Spy0486"
FT   CDS_pept        479682..480584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0486"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31674"
FT                   /db_xref="GOA:Q1JMS5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS5"
FT                   /protein_id="ABF31674.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKHVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRGRQLKPGTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDINDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAK"
FT   gene            complement(480692..481315)
FT                   /locus_tag="MGAS9429_Spy0487"
FT   CDS_pept        complement(480692..481315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0487"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31675"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS4"
FT                   /protein_id="ABF31675.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VDFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKIATMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNTSLTILETKDYLTYDCLIWNDKSFIEV"
FT   gene            complement(481656..482135)
FT                   /locus_tag="MGAS9429_Spy0488"
FT   CDS_pept        complement(481656..482135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0488"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31676"
FT                   /db_xref="GOA:Q1JMS3"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS3"
FT                   /protein_id="ABF31676.1"
FT                   /translation="MAKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(482226..482834)
FT                   /locus_tag="MGAS9429_Spy0489"
FT   CDS_pept        complement(482226..482834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0489"
FT                   /product="thiamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31677"
FT                   /db_xref="GOA:Q1JMS2"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS2"
FT                   /protein_id="ABF31677.1"
FT                   /translation="MIGKRYSFCAQKEFFMSPNTNVKYLIEAAIFAALAMTLSFIPDFA
FT                   GWFSPSYGAIALVIFSLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTS
FT                   MGLAGSFSDSLIKTLRRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMS
FT                   AVWYSFSVNGTAGVLTFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(483058..483906)
FT                   /locus_tag="MGAS9429_Spy0490"
FT   CDS_pept        complement(483058..483906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0490"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31678"
FT                   /db_xref="GOA:Q1JMS1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS1"
FT                   /protein_id="ABF31678.1"
FT                   /translation="MRRKIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPSKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARAFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDAVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            484231..484734
FT                   /locus_tag="MGAS9429_Spy0491"
FT   CDS_pept        484231..484734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0491"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31679"
FT                   /db_xref="GOA:Q1JMS0"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMS0"
FT                   /protein_id="ABF31679.1"
FT                   /translation="MSAKLMSRIAIMSALCVVLRMVFSSLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFVLVLLLWRFALYPLSQQFPKYQLGCQAF
FT                   LVALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVVMMLFRRLIG
FT                   EQKI"
FT   gene            484718..485101
FT                   /locus_tag="MGAS9429_Spy0492"
FT   CDS_pept        484718..485101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0492"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31680"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR9"
FT                   /protein_id="ABF31680.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQTQTPSVPKADHHVRLVVKE
FT                   DTNTIDEKVSFGKGDTVLEILKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVFK"
FT   gene            complement(485147..485671)
FT                   /locus_tag="MGAS9429_Spy0493"
FT   CDS_pept        complement(485147..485671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0493"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31681"
FT                   /db_xref="GOA:Q1JMR8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR8"
FT                   /protein_id="ABF31681.1"
FT                   /translation="MIPLTKLSITPRRCHMPNLYDFTVKAQNGNDVSLAAYKKKVVLIV
FT                   NTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTT
FT                   FPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPK
FT                   LIEEDLKALLG"
FT   gene            complement(485619..487493)
FT                   /gene="pepF"
FT                   /locus_tag="MGAS9429_Spy0494"
FT   CDS_pept        complement(485619..487493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="MGAS9429_Spy0494"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31682"
FT                   /db_xref="GOA:Q1JMR7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR7"
FT                   /protein_id="ABF31682.1"
FT                   /translation="MDRFSLHIPLKFCYTSLDYIVKETTMELKKRSEFPENELWDLTAL
FT                   YKDRQDFLLAIEKTLQDIDLFKRNYEGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMP
FT                   QTTDFSDESFAQIAQAGDDFMTKASVALSFFDTALANADLDVLDTLEKNPYFSAAIRMA
FT                   KIQKEHLLSPDVEKALANLREVINVPYDIYTKMRAGDFDMEDFEVDGKTYKNSFVSYEN
FT                   FYQNHENAEIREKAFRSFSKGLRKHQNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAE
FT                   QEVDRSLFDRQIDLIMTEFGPVAQKFLKHVAQVNGLEKMTFADWKLDIDNELNPEVSID
FT                   GAYDLVMKSLAPLGQEYTKEIERYQTERWVDFAANANKDSGGYAADPYKVHPYVLMSWT
FT                   GRMSDVYTLIHEIGHSGQFIFSDNHQSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDD
FT                   PRQKRFALAHRLTDTYFHNFITHLLEAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDF
FT                   WGDAVDIDDDAALTWMRQAHYYMGLYSYTYSAGLVMSTAGYLNLKNNPDGAKEWLDFLK
FT                   SGGSRTPLDTAMLIGADIATEKPLRDTIQFLSDTVDQIINYTEEMSHA"
FT   gene            487562..490375
FT                   /gene="ppc"
FT                   /locus_tag="MGAS9429_Spy0495"
FT   CDS_pept        487562..490375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="MGAS9429_Spy0495"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31683"
FT                   /db_xref="GOA:Q1JMR6"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR6"
FT                   /protein_id="ABF31683.1"
FT                   /translation="MVKSGMIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLEN
FT                   ITRRMIGDDAFTVIESIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISE
FT                   DVDLAYEINYQNNTDTDYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKT
FT                   ILELTTHIHKLLRKYRDAKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNV
FT                   MQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCL
FT                   SATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRA
FT                   FHYIQSRLKQTQNQLTNQPAARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKA
FT                   IEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVD
FT                   DYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIK
FT                   QHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHD
FT                   IVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGR
FT                   GGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASIN
FT                   RMVTQMITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNI
FT                   GSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHM
FT                   YQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEILDEWQLTKNVILAI
FT                   QDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIA
FT                   TGLRNSG"
FT   gene            490515..491819
FT                   /gene="ftsW"
FT                   /locus_tag="MGAS9429_Spy0496"
FT   CDS_pept        490515..491819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="MGAS9429_Spy0496"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31684"
FT                   /db_xref="GOA:Q1JMR5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR5"
FT                   /protein_id="ABF31684.1"
FT                   /translation="MIISRSRGKTMKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVS
FT                   LIQAHANPFKSVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARF
FT                   FTTAIKGAHGWIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWP
FT                   TQWNDLRDWRVYSLLMVLLVAAQPDLGNASIIVLTAIIMFSTSGIGYRWFSAILVMITG
FT                   LSTVFLGTIAVIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGW
FT                   FGQGLGNSIEKRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKN
FT                   PFNAMMALGVGGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNI
FT                   DASEKRDDIFKEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            complement(491836..491976)
FT                   /locus_tag="MGAS9429_Spy0497"
FT   CDS_pept        complement(491836..491976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0497"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31685"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR4"
FT                   /protein_id="ABF31685.1"
FT                   /translation="MEFHTLFLPQQKAAVWAHVTRKNKKSAEQFKFFEHQTGIVYILKS
FT                   P"
FT   gene            492122..493369
FT                   /locus_tag="MGAS9429_Spy0498"
FT   CDS_pept        492122..493369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0498"
FT                   /product="translation elongation factor Tu (EF-TU)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31686"
FT                   /db_xref="GOA:Q1JMR3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMR3"
FT                   /protein_id="ABF31686.1"
FT                   /translation="MAYRLSIKYILLEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTL
FT                   TAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPG
FT                   HADYVKNMITGAAQMDGAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDD
FT                   EELLELVEMEIRDLLSEYDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPE
FT                   PERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVE
FT                   MFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGR
FT                   HTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIR
FT                   EGGRTVGSGIVSEIEA"
FT   gene            493610..494368
FT                   /gene="tpi"
FT                   /locus_tag="MGAS9429_Spy0499"
FT   CDS_pept        493610..494368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="MGAS9429_Spy0499"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31687"
FT                   /db_xref="GOA:Q1JMR2"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMR2"
FT                   /protein_id="ABF31687.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   gene            complement(494467..495702)
FT                   /locus_tag="MGAS9429_Spy0500"
FT   CDS_pept        complement(494467..495702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0500"
FT                   /product="factor essential for expression of methicillin
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31688"
FT                   /db_xref="GOA:Q1JMR1"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR1"
FT                   /protein_id="ABF31688.1"
FT                   /translation="MALIEISQEQFDHYCHSLVHHSFIQTSEMASLMAKKGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISHPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   RLTHSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFMVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTEQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGKFDGSDGVLRFKQNFNGFILQKPGTFRCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(495689..496930)
FT                   /gene="murM"
FT                   /locus_tag="MGAS9429_Spy0501"
FT   CDS_pept        complement(495689..496930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="MGAS9429_Spy0501"
FT                   /product="UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-alanyltransferase"
FT                   /EC_number="2.3.2.10"
FT                   /EC_number="2.3.2.-"
FT                   /note="UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-seryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31689"
FT                   /db_xref="GOA:Q1JMR0"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMR0"
FT                   /protein_id="ABF31689.1"
FT                   /translation="MGIKLMYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKNNWKH
FT                   ERISFYENGVQVAAAACLIRKLPLGFTMIYIPRGPIMDYANFELLDFVIKTLKTVGKSK
FT                   RALFVKIDPSLVIKQTLEGKESKENDVTLSIIAFLKKLGVEWSGRTKELEDTIQPRIQA
FT                   NIYAKDFDFDSLPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGK
FT                   SYYQKLLDIYAGQSYITMASLDLPEQKKLLIQQLDKALAEQARLTDKSKPSKVAENQKT
FT                   IARLQKDLTILSEQLATGQTRIPLAATLTLIYGETSENLYAGMDDDYRNYQAPLLTWYK
FT                   TAKEAFKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFAGEFNIPVGLVSSLAILTY
FT                   NLRKKLRSTTNGTN"
FT   gene            complement(496915..497724)
FT                   /locus_tag="MGAS9429_Spy0502"
FT   CDS_pept        complement(496915..497724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0502"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31690"
FT                   /db_xref="GOA:Q1JMQ9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ9"
FT                   /protein_id="ABF31690.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLG
FT                   IHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            497745..497849
FT                   /locus_tag="MGAS9429_Spy0503"
FT   CDS_pept        497745..497849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ8"
FT                   /protein_id="ABF31691.1"
FT                   /translation="MVYLKNVLPPILLKIGAFVMGWERKLKEKREKTF"
FT   gene            complement(497875..498108)
FT                   /locus_tag="MGAS9429_Spy0504"
FT   CDS_pept        complement(497875..498108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0504"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ7"
FT                   /protein_id="ABF31692.1"
FT                   /translation="MEFYALFLSLGSQKFRVTSLPVLTPLLPQQKAAVLAHVTRRNKKS
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(498180..499583)
FT                   /locus_tag="MGAS9429_Spy0506"
FT   CDS_pept        complement(498180..499583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0506"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31693"
FT                   /db_xref="GOA:Q1JMQ6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ6"
FT                   /protein_id="ABF31693.1"
FT                   /translation="MVNCNFITLLSISKLVCLFYQFLLILSIFDIIKIMNEKVFRDPVH
FT                   NYIHIDNPLIYDLINTKEFQRLRRIKQVPTTAFTFHGAEHSRFSHCLGVYEIARRVTAI
FT                   FEEKYADIWNKDESLVTMTAALLHDIGHGAYSHTFEALFHTDHEAFTQEIITNPETEIN
FT                   AILVRHAPDFPDKVASVINHTYPNKQVVQLISSQIDCDRMDYLLRDSYFSAANYGQFDL
FT                   MRILRVIRPVEDGIVFEHSGMHAVEDYIVSRFQMYMQVYFHPASRAVELILQNLLKRAQ
FT                   HLYPEQQAYFQKTAPGLIPFFEKKANLADYIALDDGVMNTYFQVWMASEDHILSDLASR
FT                   FINRKILKSVTFDQDSQGELERLRQLVESVGFDPDYYTGIHINFDLPYDIYRPELENPR
FT                   TQIEMIQKDGSLAELSQLSPIVKALTGTTYGDRRFYFPKEMLELDDLFAPSKETFMSYI
FT                   SNGHFHFSQ"
FT   gene            499564..499950
FT                   /locus_tag="MGAS9429_Spy0505"
FT   CDS_pept        499564..499950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0505"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31694"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ5"
FT                   /protein_id="ABF31694.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGGYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            500180..502861
FT                   /gene="pacL"
FT                   /locus_tag="MGAS9429_Spy0507"
FT   CDS_pept        500180..502861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="MGAS9429_Spy0507"
FT                   /product="calcium-transporting ATPase"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31695"
FT                   /db_xref="GOA:Q1JMQ4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ4"
FT                   /protein_id="ABF31695.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLACIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSEDAGIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGTLQSSSADIAFDNTTLRVMNFANDTKVDPSGKLIGDPTETALVQ
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRPITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVGMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(502945..503949)
FT                   /gene="regR"
FT                   /locus_tag="MGAS9429_Spy0508"
FT   CDS_pept        complement(502945..503949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="MGAS9429_Spy0508"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31696"
FT                   /db_xref="GOA:Q1JMQ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ3"
FT                   /protein_id="ABF31696.1"
FT                   /translation="MYAMQRKVTIKDIAELAKTSKTTVSFYLNGKFDKMSEETKNRIKS
FT                   TIEATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNS
FT                   NYDPSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWV
FT                   KTNNYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMII
FT                   DENQTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEW
FT                   TKFSSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(504004..505929)
FT                   /locus_tag="MGAS9429_Spy0509"
FT   CDS_pept        complement(504004..505929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0509"
FT                   /product="oligohyaluronate lyase"
FT                   /EC_number="4.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31697"
FT                   /db_xref="GOA:Q1JMQ2"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ2"
FT                   /protein_id="ABF31697.1"
FT                   /translation="MERKRPMSLAFARFKETVNPDFCRNYLLDYQTDSYADQKRIADLL
FT                   LTNTFLFEDNWDMEPCHIPYHLDPITWQEAVTDDPEWNFMLNRQTYLQTLILVYLVERD
FT                   ERYLLKAKSFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFDALTKQEER
FT                   LILASLEKQLHFLHANYLDKYSLSNWGILQTTAILLADAYFGSNLDIAAATAFARKELT
FT                   QQIALQILEDGSQFEQSTMYHVEVLKALLELTALVPDYLPQLRPTLLAMSDYLLKMTGP
FT                   DHKQIPLGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHIFEQLP
FT                   VQTLPTFAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSICLYYKGQPLFCDAG
FT                   RYTYKEEPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHIYFID
FT                   GSYQTQFSDRNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLEVKTDHLS
FT                   DLRLISDCPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPL
FT                   QTGKRNPIETALSWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNE
FT                   IIRLKH"
FT   gene            complement(505998..506879)
FT                   /gene="agaD"
FT                   /locus_tag="MGAS9429_Spy0510"
FT   CDS_pept        complement(505998..506879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaD"
FT                   /locus_tag="MGAS9429_Spy0510"
FT                   /product="PTS system, N-acetylgalactosamine-specific IID
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31698"
FT                   /db_xref="GOA:Q1JMQ1"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ1"
FT                   /protein_id="ABF31698.1"
FT                   /translation="MNFTTNLNKSMQQLSKEANKMTGSNKLTKKDYLKTALRAFFLQNG
FT                   FNYSNYQGIGYANVIYPALKKHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVML
FT                   ENDRPEEETRNIKMALMGPLAGIGDSLSQFCLAPLFSTIAASLASDGLVLGPIFFFLAM
FT                   NIILTAIKIGSGLYGYKVGTSFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPI
FT                   TFAAGKVDAANTAQKFVTIQGMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVLLTVL
FT                   IGIIGSWLGILA"
FT   gene            complement(506806..507588)
FT                   /locus_tag="MGAS9429_Spy0511"
FT   CDS_pept        complement(506806..507588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0511"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31699"
FT                   /db_xref="GOA:Q1JMQ0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMQ0"
FT                   /protein_id="ABF31699.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVVIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFIGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(507607..508095)
FT                   /gene="agaV"
FT                   /locus_tag="MGAS9429_Spy0512"
FT   CDS_pept        complement(507607..508095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaV"
FT                   /locus_tag="MGAS9429_Spy0512"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31700"
FT                   /db_xref="GOA:Q1JMP9"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP9"
FT                   /protein_id="ABF31700.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKFLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQNIFIVVKDLQDAKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHHVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(508131..509330)
FT                   /locus_tag="MGAS9429_Spy0513"
FT   CDS_pept        complement(508131..509330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0513"
FT                   /product="unsaturated glucuronyl hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31701"
FT                   /db_xref="GOA:Q1JMP8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP8"
FT                   /protein_id="ABF31701.1"
FT                   /translation="MTRSLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTPEAREAALKAADKLVQRYQDKGGFIQAWG
FT                   ELGKKEDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFRDGSGQSRDSSATAIAVCGIHEMLKTLPDHDPDKKTYEAAMHSM
FT                   LRALIKDYANKNLKPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            complement(509330..509767)
FT                   /locus_tag="MGAS9429_Spy0514"
FT   CDS_pept        complement(509330..509767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0514"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31702"
FT                   /db_xref="GOA:Q1JMP7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP7"
FT                   /protein_id="ABF31702.1"
FT                   /translation="MIAIIVMGHGHFASGIVSSLELIAGPQEKVTAIDFTAEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLPNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVSGLITCSKEGIVDWKTLSQQEDGATDDELGGI"
FT   gene            510092..510886
FT                   /gene="idnO"
FT                   /locus_tag="MGAS9429_Spy0515"
FT   CDS_pept        510092..510886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="MGAS9429_Spy0515"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31703"
FT                   /db_xref="GOA:Q1JMP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP6"
FT                   /protein_id="ABF31703.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLAAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKVVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGTTEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            510911..511552
FT                   /locus_tag="MGAS9429_Spy0516"
FT   CDS_pept        510911..511552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0516"
FT                   /product="galactose-6-phosphate isomerase subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31704"
FT                   /db_xref="GOA:Q1JMP5"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP5"
FT                   /protein_id="ABF31704.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFKEYFFANAEPSELVAYLKSVLEQ"
FT   gene            511542..512582
FT                   /locus_tag="MGAS9429_Spy0517"
FT   CDS_pept        511542..512582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0517"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31705"
FT                   /db_xref="GOA:Q1JMP4"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP4"
FT                   /protein_id="ABF31705.1"
FT                   /translation="MNSNSILTRKGGHMSKLLLVGEPLIRVSPNQFQPLTNACDAQLFF
FT                   GGSEVNIARTLGGFGLEARLFTALPDNPVGHAFHQFLKQSGVDMTLTAWQGHRVGLYYL
FT                   ENGFGCRASQVYYDRCGSSFSALDKDSLDLAAIFEGIRHFHFSGISLALGKKTQDLIEI
FT                   LAREAKKRDICISFDLNFRSSMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFD
FT                   RNKADTTTIRERLAGLYQRYQLQAIYHTERSNDAQGSNRFKAYAYDGQFYESCEVTTPV
FT                   LQRVGSGDAFVAGLLYQLLEGNEKQRNLDFAVATASLKCTVAEDQLYHSVQQVEAVLHN
FT                   QRDVQR"
FT   gene            512569..513222
FT                   /gene="kgdA"
FT                   /locus_tag="MGAS9429_Spy0518"
FT   CDS_pept        512569..513222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgdA"
FT                   /locus_tag="MGAS9429_Spy0518"
FT                   /product="4-Hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /EC_number="4.1.2.14"
FT                   /note="2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31706"
FT                   /db_xref="GOA:Q1JMP3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP3"
FT                   /protein_id="ABF31706.1"
FT                   /translation="MSRGDDMGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGI
FT                   KTIEVTYTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQFIVGPNFN
FT                   RAVALICHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGMSFIRAIKSPLPQVE
FT                   VMVTGGVSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            513513..514169
FT                   /locus_tag="MGAS9429_Spy0519"
FT   CDS_pept        513513..514169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0519"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /EC_number="2.7.1.41"
FT                   /note="glucose-1-phosphate phosphodismutase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31707"
FT                   /db_xref="GOA:Q1JMP2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP2"
FT                   /protein_id="ABF31707.1"
FT                   /translation="MLMIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDF
FT                   IGGNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLEQLKKQG
FT                   IKLAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQ
FT                   LLVVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            514815..515990
FT                   /locus_tag="MGAS9429_Spy0520"
FT   CDS_pept        514815..515990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0520"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31708"
FT                   /db_xref="GOA:Q1JMP1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP1"
FT                   /protein_id="ABF31708.1"
FT                   /translation="MSFFFLEVLTYFDYDSSMTIKAEIKALAKEIGISKIGFTTADNFD
FT                   YLEKSLRASVEEGRNSGFEHKVIEDRISPERLLESAKTIISIGVAYPHKLPQQPQKTPY
FT                   KRGKITPSSWGFDYHYVVGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAG
FT                   IGFIGKNGLVISKEYGSYMFLGELITNLEIEPDKPVDYDCGDCRRCIDACPTSCLIGDG
FT                   SMNAKRCLSFQTQDKGMMDIEFRKKIKTVIYGCDICQICCPYNKGINNPPATEIDPELA
FT                   QPELIPFLSLSNGQFKEKFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKN
FT                   NNPIHTATAIWALGEIVKKPNDEILAFMSHLTLKDEDSQKELELIRHKWQF"
FT   gene            516144..517157
FT                   /gene="prfB"
FT                   /locus_tag="MGAS9429_Spy0521"
FT   CDS_pept        516144..517157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="MGAS9429_Spy0521"
FT                   /product="bacterial peptide chain release factor 2 (RF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31709"
FT                   /db_xref="GOA:Q1JMP0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMP0"
FT                   /protein_id="ABF31709.1"
FT                   /translation="MEEEIALLENHMTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQ
FT                   ELSDETELLLEMLDEDDSLKEELEENLMQLDKIMGAYEMTLLLSEPYDHNNAILEIHPG
FT                   SGGTEAQDWGDLLLRMYTRFGNANGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKS
FT                   EMGVHRLVRISPFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQN
FT                   VNKVSTGVRLTHIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKG
FT                   DKKEITWGSQIRSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            517176..517868
FT                   /gene="ftsE"
FT                   /locus_tag="MGAS9429_Spy0522"
FT   CDS_pept        517176..517868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="MGAS9429_Spy0522"
FT                   /product="cell division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31710"
FT                   /db_xref="GOA:Q1JMN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN9"
FT                   /protein_id="ABF31710.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            517831..518790
FT                   /gene="ftsX"
FT                   /locus_tag="MGAS9429_Spy0523"
FT   CDS_pept        517831..518790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="MGAS9429_Spy0523"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31711"
FT                   /db_xref="GOA:Q1JMN8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN8"
FT                   /protein_id="ABF31711.1"
FT                   /translation="MMKKKEIMVTMIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLT
FT                   LVGVFAATLLNIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDK
FT                   IAQIKGVKKITFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITK
FT                   KIRTIEGVEAADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRK
FT                   RDIEIMRLVGAKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNL
FT                   SMYPLDPYVYYLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(519099..519797)
FT                   /locus_tag="MGAS9429_Spy0524"
FT   CDS_pept        complement(519099..519797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0524"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31712"
FT                   /db_xref="GOA:Q1JMN7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN7"
FT                   /protein_id="ABF31712.1"
FT                   /translation="MPFIFRYSFFNKVLIFWYTILMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIITVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSLGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTIC
FT                   HEKNANPFFH"
FT   gene            519938..520729
FT                   /locus_tag="MGAS9429_Spy0525"
FT   CDS_pept        519938..520729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0525"
FT                   /product="(R,R)-butanediol dehydrogenase"
FT                   /EC_number="1.1.1.4"
FT                   /EC_number="1.1.1.303"
FT                   /note="acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31713"
FT                   /db_xref="GOA:Q1JMN6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN6"
FT                   /protein_id="ABF31713.1"
FT                   /translation="MTKKYEVEDMSKVAIVTGAGQGIGFAIAKRLHADGFKIGILDYNE
FT                   ETAQAAVDKLSPEDTVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDT
FT                   ITEEQFEKAFAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTK
FT                   FAVRGITQTLAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMEQFAKD
FT                   ITLKRLSEPEDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            520837..523338
FT                   /gene="dinG"
FT                   /locus_tag="MGAS9429_Spy0526"
FT   CDS_pept        520837..523338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="MGAS9429_Spy0526"
FT                   /product="ATP-dependent helicase, DinG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31714"
FT                   /db_xref="GOA:Q1JMN5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN5"
FT                   /protein_id="ABF31714.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLGHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLVYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKPYQISKSFPINMALLGLEERPKQTQFAQLIDEDYHQGVAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRIQDDKDFTRNKVLVFDE
FT                   AQKLMLQLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVPHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRKDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            523673..524866
FT                   /gene="aspC"
FT                   /locus_tag="MGAS9429_Spy0527"
FT   CDS_pept        523673..524866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MGAS9429_Spy0527"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31715"
FT                   /db_xref="GOA:Q1JMN4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN4"
FT                   /protein_id="ABF31715.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGHDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIETLKEAVRRLHVFMESNEIN"
FT   gene            524887..526233
FT                   /gene="asnS"
FT                   /locus_tag="MGAS9429_Spy0528"
FT   CDS_pept        524887..526233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="MGAS9429_Spy0528"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31716"
FT                   /db_xref="GOA:Q1JMN3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMN3"
FT                   /protein_id="ABF31716.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVTNKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            526648..527538
FT                   /locus_tag="MGAS9429_Spy0529"
FT   CDS_pept        526648..527538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0529"
FT                   /product="ATP-binding protein"
FT                   /note="contains P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31717"
FT                   /db_xref="GOA:Q1JMN2"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMN2"
FT                   /protein_id="ABF31717.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQPSFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            527535..528512
FT                   /locus_tag="MGAS9429_Spy0530"
FT   CDS_pept        527535..528512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0530"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31718"
FT                   /db_xref="GOA:Q1JMN1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMN1"
FT                   /protein_id="ABF31718.1"
FT                   /translation="MKNPKMTVIGGGTGISIILKSLRNEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGNLIIAGISEMQG
FT                   STYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYPGMIDHVYVTN
FT                   TYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEVVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            528509..529420
FT                   /locus_tag="MGAS9429_Spy0531"
FT   CDS_pept        528509..529420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0531"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31719"
FT                   /db_xref="GOA:Q1JMN0"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMN0"
FT                   /protein_id="ABF31719.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSLIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLAAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYVQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   gene            complement(529597..529836)
FT                   /locus_tag="MGAS9429_Spy0532"
FT   CDS_pept        complement(529597..529836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0532"
FT                   /product="DNA integration/recombination/inversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31720"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR11"
FT                   /protein_id="ABF31720.1"
FT                   /translation="MIDLPKLKKDIEELNHLKDDYNKAIKLNYLDKKNEDSLGMLMDNI
FT                   DIRKSSYDVQSRIVKQLIDRVEVTMDNIDIIFKF"
FT   gene            complement(529935..531011)
FT                   /locus_tag="MGAS9429_Spy0533"
FT   CDS_pept        complement(529935..531011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0533"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31721"
FT                   /db_xref="GOA:Q1CR10"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR10"
FT                   /protein_id="ABF31721.1"
FT                   /translation="MRKVAIYSRVSTINQAEEGYSIQGQIEALTKYCEAMEWKIYKNYS
FT                   DAGFSGGKLERPAITELIEDGKNNKFDTILVYKLDRLSRNVKDTLYLVKDVFTANNIHF
FT                   VSLKENIDTSSAMGNLFLTLLSAIAEFEREQIKERMQFGVMNRAKSGKTTAWKTPPYGY
FT                   RYNKDEKTLSVNELEAANVRQMFDMIISGCSIMSITNYARDNFVGNTWTHVKVKRILEN
FT                   ETYKGLVKYREQTFSGDHQAIIDEKTYNKAQIALAHRTDTKTNTRPFQGKYMLSHIAKC
FT                   GYCGAPLKVCTGRAKNDGTRRQTYVCVNKTESLARRSVNNYNNQKICNTGRYEKNTSKN
FT                   MLLMFFINFNTIKNILKK"
FT   gene            complement(531162..531764)
FT                   /locus_tag="MGAS9429_Spy0534"
FT   CDS_pept        complement(531162..531764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0534"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31722"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR09"
FT                   /protein_id="ABF31722.1"
FT                   /translation="MVKLWGVILKNKNIFIRSFIMNLDTVLQQMKECGAYDTWGTKKEV
FT                   KALPEILSDDEIIQYATSGFVNGNTVLVVLTQKRILFIDKGMLYGIRSTEIPLDMVNSV
FT                   SYSKGLILGAIAVMNGATKIEISNIAKDTCPVLTEKIKDCVEQYKYNLYQHQSPQKTAT
FT                   VGSEDAVAEIRKFKKLYDEGILTEEEFIAKKKIILGI"
FT   gene            complement(531730..532479)
FT                   /locus_tag="MGAS9429_Spy0535"
FT   CDS_pept        complement(531730..532479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0535"
FT                   /product="phage transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31723"
FT                   /db_xref="GOA:Q1CR08"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR08"
FT                   /protein_id="ABF31723.1"
FT                   /translation="MASTIAFPAMVKELRLGKNLTMEQLAEELGKTKSTISKWEKGTRS
FT                   PKIYEIEEIAKFFGVEPKKMMFGDNPTSINPQVELIPSTLQKINSTSSQLEHSRQIIVL
FT                   DTAETLLEQQKEIKNNEDTIAELFSYNYYDHAASAGTGQYLNDVQVEKIELPVDYDADF
FT                   VIPVYGDSMEPKYHSGDYVFIKLSVELADGDIGVFEYYGDAYIKQLLINDEGAFLHSLN
FT                   GKYEDIPVDRDSDFRIIGEVVGSYSEK"
FT   gene            532866..533024
FT                   /locus_tag="MGAS9429_Spy0536"
FT   CDS_pept        532866..533024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0536"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31724"
FT                   /db_xref="GOA:Q1CR07"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR07"
FT                   /protein_id="ABF31724.1"
FT                   /translation="MNWKKLMFGDLEYTFASRDGKEKTSIEFEGGVLPALLVLCGITWL
FT                   IAWFITK"
FT   gene            complement(533123..533764)
FT                   /locus_tag="MGAS9429_Spy0537"
FT   CDS_pept        complement(533123..533764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0537"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR06"
FT                   /protein_id="ABF31725.1"
FT                   /translation="MNFFNFLLCVFKFTSEYLIKNWIALIALFLSYSNYRRNNLQVELI
FT                   AAPVSDWILSVILDNGESIYNPNGTLRANIKIINPSNVDVSYFDLIVFDKNRKYQHYYQ
FT                   KQNNIINDLTGREAIAAVQPDGNTILIEVPEADCGVLKAHSMTRMDLIIQTSEITDRLF
FT                   VAFKVAKKKKLFKANKAGYVNSPYQSFSASFPVELSKKPHYEDILKDLHE"
FT   gene            533857..534063
FT                   /locus_tag="MGAS9429_Spy0538"
FT   CDS_pept        533857..534063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0538"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31726"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR05"
FT                   /protein_id="ABF31726.1"
FT                   /translation="MQENAFEQLIDDSGIKKKVIATKMGFTRSGFYQKRKKPKKSFDAS
FT                   EVAMLADILGVDPGKVLEAILIS"
FT   gene            complement(534309..534518)
FT                   /locus_tag="MGAS9429_Spy0539"
FT   CDS_pept        complement(534309..534518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0539"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31727"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR04"
FT                   /protein_id="ABF31727.1"
FT                   /translation="MNLEELTPLLNSIDDFETVILHSLVGDFVIDHWIEPNRKNETLIF
FT                   MHNDQTTELKLSAILGTSTIPKSL"
FT   gene            complement(534681..534911)
FT                   /locus_tag="MGAS9429_Spy0540"
FT   CDS_pept        complement(534681..534911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31728"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR03"
FT                   /protein_id="ABF31728.1"
FT                   /translation="MEIFSYPENAKELYEKHKKAIEQACEPIATMLALNNPELTDLANE
FT                   ALELYARTIYNACVDASIIIRNREYQHYRDQ"
FT   gene            535035..535241
FT                   /locus_tag="MGAS9429_Spy0541"
FT   CDS_pept        535035..535241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0541"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31729"
FT                   /db_xref="GOA:Q1CR02"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR02"
FT                   /protein_id="ABF31729.1"
FT                   /translation="MCFGEWVMWGKLSKILSERGMTMYQLAKLSGVNKSHFSDLKSGKI
FT                   KNLSWPNMVKISDALGVSLDEFK"
FT   gene            535314..535559
FT                   /locus_tag="MGAS9429_Spy0542"
FT   CDS_pept        535314..535559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31730"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR01"
FT                   /protein_id="ABF31730.1"
FT                   /translation="MEIVHIKDIVTEPYSADDETLGKIFGYTKRQMQDRRYEMVKIPYF
FT                   SKYLLEQGGRVTIDGMREYLFYRKSIEWEKDKEKYL"
FT   gene            535556..535696
FT                   /locus_tag="MGAS9429_Spy0543"
FT   CDS_pept        535556..535696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0543"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CR00"
FT                   /protein_id="ABF31731.1"
FT                   /translation="MKLLDFIFAKPKKQEEKPKWTIENNGWEANTRRYNQKHGLPAKQI
FT                   W"
FT   gene            535706..535918
FT                   /locus_tag="MGAS9429_Spy0544"
FT   CDS_pept        535706..535918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0544"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31732"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ9"
FT                   /protein_id="ABF31732.1"
FT                   /translation="MDQYLINDNEFLRDENTRLNKEFSELNHAVAKANLLDVIIEDGYI
FT                   LQSTLDKCTAKLDEIDQKELKTWKN"
FT   gene            535906..536088
FT                   /locus_tag="MGAS9429_Spy0545"
FT   CDS_pept        535906..536088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ8"
FT                   /protein_id="ABF31733.1"
FT                   /translation="MEKLTLKKEKENTATLPFFVGIDLHAQIKEISTETGIPMRRIIER
FT                   MIRFSLDNLEIMEGD"
FT   gene            536198..536509
FT                   /locus_tag="MGAS9429_Spy0546"
FT   CDS_pept        536198..536509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0546"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ7"
FT                   /protein_id="ABF31734.1"
FT                   /translation="MGSEGLRLRIYINKHKKMIIAPDYNDRYGGISNTTIQLRTGKLTE
FT                   AIEQEVGEAILDIIKKYEPIFDTPIIDDLFREKEQAIRKMVDYDTALTEMVEVEDENY"
FT   gene            536496..537188
FT                   /locus_tag="MGAS9429_Spy0547"
FT   CDS_pept        536496..537188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0547"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31735"
FT                   /db_xref="InterPro:IPR006505"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ6"
FT                   /protein_id="ABF31735.1"
FT                   /translation="MKITKATEITKTHNWRILIYGKPGNGKTYLTNYLQGKTLILDMDH
FT                   SSKTIAGNENIDIIQFDRTHPSDFMTEFLIELPELIKEYDNLVIDNITSWQSDWFIEQG
FT                   RKSKNGITNELQQYNMWTNYYLRVLTTIYSQPINIFVTAWESTQDLTLESGQIITQYIP
FT                   DIRKQVLSQTLGLTDIVGRVQVNPKTGGHGILLQGSDGLYAKNRLDNRTVCKAEELFNF
FT                   GDTVNETT"
FT   gene            537284..538519
FT                   /locus_tag="MGAS9429_Spy0548"
FT   CDS_pept        537284..538519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0548"
FT                   /product="phage DNA/RNA helicase (DEAD/DEAH box family)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31736"
FT                   /db_xref="GOA:Q1CQZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ5"
FT                   /protein_id="ABF31736.1"
FT                   /translation="MVMAHIAKSATDKGNRVLFFSHRKEINEQVEKTFAVNGVNSNLLT
FT                   IGGVQSLVRKLDSLFQPEVILIDEAHHSKAKSYLKIIDYFKNAYVLMFTGTPVRLNGDG
FT                   FDDIADDLVVGKSVKWLQEHGNIANFKYYAPSMIDNSVLKKRGGEFTKDSVDQSMKSVI
FT                   YGDVIKHYEKLAKGKQAIVYTHSVEASHLVSDTFNQAGYQSQAVSGKTPKNEREEAMRA
FT                   FRDGDLKIMVNCELFTEGIDLPNVDVCIMLRPTQSLSLYLQFAMRPLNPRDGKTAIIID
FT                   HVGNVERFGLPNMDREWRLDGETKQKQSAKIGEPTTRVCDNCYATYWSDTRICPECGHE
FT                   NELTKREIEEIKEAELQEISEQKQLKLKNRVSTYQTPDMCQTMDELTEYRKQHGYKPGW
FT                   QYYIAKKLGILY"
FT   gene            538535..538993
FT                   /locus_tag="MGAS9429_Spy0549"
FT   CDS_pept        538535..538993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0549"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31737"
FT                   /db_xref="InterPro:IPR007731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ4"
FT                   /protein_id="ABF31737.1"
FT                   /translation="MFTIDYSKAKEFASITDGTYETFIEKAVQDATKNGADFINIHFRI
FT                   RKDFQQEFQNNIIFHRIFAKKEDGKYPEGVIHNLAKQAGIPEGTQFKSLDDYLNQLLNK
FT                   CLKITVKNETSEYNGNTYNNLNVKRIEKSDIPSMVNPVEEFKEDDLPF"
FT   gene            538996..539808
FT                   /locus_tag="MGAS9429_Spy0550"
FT   CDS_pept        538996..539808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0550"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31738"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ3"
FT                   /protein_id="ABF31738.1"
FT                   /translation="MRGMIDYAIYYQQKGFSVIPISKDGKKPLVAFADKPAFTEHELRL
FT                   LWKDNPDANIALRTDSFFVIDIDVHNGVDGLKNLREWEHARLIPKTLQATTPSGGRHIY
FT                   LKKPQGVSMAQNIGFVDGVDLKAHVNNYVLVPPSNNAKGMYVWDKVHSPTSGEMTEAPL
FT                   ELITVLQELKPAYEYDASSFTSGDYQGSNKTAKLFETIVLGFGDTGGRNNSLAEFVGGL
FT                   LLRNVDVEIAYTLAKMANHKTVDPLNDKEFDRTFKSMCDKELRRRSGL"
FT   gene            539798..541273
FT                   /locus_tag="MGAS9429_Spy0551"
FT   CDS_pept        539798..541273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0551"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31739"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ2"
FT                   /protein_id="ABF31739.1"
FT                   /translation="MDFEFYREKLNEEPGIEPGKPTTWSAIKSKLIAYRRDWLEEAGKD
FT                   VKNLSELAVAIGINKYLHVITLENGKVAIYDPDQGYYIKDYKFAYKLIHILQPTFNETK
FT                   CRNVLFMLASMDRKYGAMDFEPEFQDVRRYVLVKNGIYDKYKRKLLPFDYRFINFSTIE
FT                   TELIPNAPLPTIDGWDVESWLLDLMSGDKDLVKLLWQVVAASLNGNYSYRKSIWFVGNG
FT                   NDGKGTFQQMISNLVGFKNVAPLKLNQFSERFGLAIIEGKTVIIGDDVQAGIYVDESSN
FT                   FNSVVTGEPVSIEKKGENPYMAIFKKTVIQSTNGMPSFKNKSNGTYRRIIIIPFKKTFS
FT                   SKEDNWAIKDDYINRKEVLEYVLWKAINIDFDRFSEPKATQERMHAFKRDNNTILAFID
FT                   DWFERFTSTVLPTRFLWWLYKEWCKDNGHTPLKQSTFENELSTNIPDGWVKKKSRVAGK
FT                   FFPSDEIPTEYGHFPWNNEKDANGSMQSYVKII"
FT   gene            541535..541948
FT                   /locus_tag="MGAS9429_Spy0552"
FT   CDS_pept        541535..541948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0552"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ1"
FT                   /protein_id="ABF31740.1"
FT                   /translation="MYDILKDYEDLPIPSESIYYHDWLIGNITSEEAKEHFYRSDHPKG
FT                   FLELSEDKQEKLLHWCKQLEKTKTYENGHTSYGLKHKFEYRKNGFYVTNGQFKGAMLLA
FT                   GFKPKDKNKLNWVFAFSVKSLRKIIDTKRYVMV"
FT   gene            541945..542265
FT                   /locus_tag="MGAS9429_Spy0553"
FT   CDS_pept        541945..542265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0553"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31741"
FT                   /db_xref="GOA:Q1CQZ0"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQZ0"
FT                   /protein_id="ABF31741.1"
FT                   /translation="MTTESLIQNQIRVGLSQAGHMVFRANVGKVKTADGRFFDTGLPKG
FT                   FCDLFGFKPDGQVFFIEVKNETGRVRPEQKKFMEVMASRGALVGVARSVEDALKIVNDT
FT                   SR"
FT   gene            542249..542605
FT                   /locus_tag="MGAS9429_Spy0554"
FT   CDS_pept        542249..542605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0554"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31742"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY9"
FT                   /protein_id="ABF31742.1"
FT                   /translation="MTLVDDFYKQMEPSIKAFLDDNIIITDPEEADRVYKSVKYYKNLN
FT                   RLPPPNVLDWFKQIYTTEEMITLIKQSYRLKQKKTDEDDEIYEKWMFKNYGDVKLVKKV
FT                   KRMDALAKAWEMGL"
FT   gene            542730..543011
FT                   /locus_tag="MGAS9429_Spy0555"
FT   CDS_pept        542730..543011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0555"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31743"
FT                   /db_xref="InterPro:IPR011630"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY8"
FT                   /protein_id="ABF31743.1"
FT                   /translation="MTYKINPESMQVAFDKNYQTFLDKNADYGNSFEKSLDDLGIVAGV
FT                   VRIGDKYNRVCNLIKNKQNVSESLSDTLNDMANYCMMLAVWLEGQKDD"
FT   gene            543004..543189
FT                   /locus_tag="MGAS9429_Spy0556"
FT   CDS_pept        543004..543189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0556"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31744"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY7"
FT                   /protein_id="ABF31744.1"
FT                   /translation="MTKKHVVRVYNKGITATYMVYDKNLFKEHEFATKREAMQFIRKLE
FT                   LANEKRSTEYFMREAE"
FT   gene            543186..543455
FT                   /locus_tag="MGAS9429_Spy0557"
FT   CDS_pept        543186..543455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0557"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31745"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY6"
FT                   /protein_id="ABF31745.1"
FT                   /translation="MKKPNRYPYSKSKFNGCIYQLHAASFKDEQYVEDLKSCGIHYQIT
FT                   KIGYFPDIFIKIDNLEQLQILIDKTGHDLILSKDQIWIYDDYME"
FT   gene            543465..543614
FT                   /locus_tag="MGAS9429_Spy0558"
FT   CDS_pept        543465..543614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0558"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31746"
FT                   /db_xref="InterPro:IPR010024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY5"
FT                   /protein_id="ABF31746.1"
FT                   /translation="MIPKFRAFNKKIQKMYSIDGFKSSERKIYRCSLADDEFRSGRLET
FT                   FHFG"
FT   gene            543624..543767
FT                   /locus_tag="MGAS9429_Spy0559"
FT   CDS_pept        543624..543767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0559"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31747"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQS6"
FT                   /protein_id="ABF31747.1"
FT                   /translation="MWKSATDHLNDFIDKNKYAKVTGDLWQGSDQVIAEQCFLKVLEEM
FT                   QK"
FT   gene            543764..544225
FT                   /locus_tag="MGAS9429_Spy0560"
FT   CDS_pept        543764..544225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0560"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31748"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQS5"
FT                   /protein_id="ABF31748.1"
FT                   /translation="MNIEEAKELVDNSKFYGKTSSVIKAEVRDIIDQLNQPKPEVPQCV
FT                   ADWIEECKEEDLTLKGLFSNSDMPAKIFDWIFGSDENCRLMAEAWINGYTVEKEKLYTV
FT                   DLPNGQPLVRGINTLYFSQNLATENVKLTESEIRKDFEWAWQFAEEVTE"
FT   gene            544668..545105
FT                   /locus_tag="MGAS9429_Spy0561"
FT   CDS_pept        544668..545105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0561"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31749"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY2"
FT                   /protein_id="ABF31749.1"
FT                   /translation="MGNIPTTKANNFLEELKTIPHLIETLERDANLMSRSLVKSPQWSD
FT                   MKVSGGVKQSQEDKNIKMLHMVGYYSDQIEQLKDRRQEMANLIVQSMGICESHVLLTTY
FT                   LDCDGDYERARERLNIGNRNKYFMFVRRGKESLELILKNTN"
FT   gene            complement(545445..545621)
FT                   /locus_tag="MGAS9429_Spy0562"
FT   CDS_pept        complement(545445..545621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0562"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY1"
FT                   /protein_id="ABF31750.1"
FT                   /translation="MNSKPIAYPILGHFYLSNRNSRNRTDLQPLSLLTTSKVATLVLLV
FT                   VNQMSQSVVNTYT"
FT   gene            545661..546581
FT                   /locus_tag="MGAS9429_Spy0563"
FT   CDS_pept        545661..546581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0563"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31751"
FT                   /db_xref="GOA:Q1CQY0"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQY0"
FT                   /protein_id="ABF31751.1"
FT                   /translation="MVAFYCGVKMLKLDEKKIRKGKPVGLPYQGSKKKISKKIVEIIKQ
FT                   NFDADKPIYDVFGGGGAITAECVLNGLEVHYNDLDNDITDMFQRVISQDREWIKTLIIS
FT                   RDEFNKIRQKEPKSVDDNLKLLVNSFGNELSSYLYGADWSDTKYDLAVEIINKHDVFSG
FT                   YKQTETYKKADKPYDEGELEKNKKLTQLEQLQQLGRLQQLGRLEQLEPTNYSYEAFSDI
FT                   EDAIFYLDPPYENTTQKSYKGDFNSQAFYDWAFGMSKNNIVLISSYDISDERFECVYEF
FT                   KTARSTMQGGGAGKRTEKLFMAVIT"
FT   gene            complement(546708..547124)
FT                   /locus_tag="MGAS9429_Spy0564"
FT   CDS_pept        complement(546708..547124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0564"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31752"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX9"
FT                   /protein_id="ABF31752.1"
FT                   /translation="MVCLSHSNQRRIIMLIYPATFTQDTDYIMVTFPDVPEAITQGEDF
FT                   QEAYEMAVEVLGFALEDYTDYPKASAVSDLKEQYPDSDIALIGIDMVAYMKKYHSKKVR
FT                   KNVTIPEWLNDAAEDKNLNFSQVLTEALELKLQA"
FT   gene            complement(547137..547403)
FT                   /locus_tag="MGAS9429_Spy0565"
FT   CDS_pept        complement(547137..547403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0565"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31753"
FT                   /db_xref="GOA:Q1CQX8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX8"
FT                   /protein_id="ABF31753.1"
FT                   /translation="MRILCVFCIDIYIVYVYNISIESEVSNMPMTPKQMIKLLKKNGFY
FT                   EVSQNGSHKKFRDNNGHQTIVPMHNKDLGKGLEDTILKQAGLK"
FT   gene            547558..547896
FT                   /locus_tag="MGAS9429_Spy0566"
FT   CDS_pept        547558..547896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0566"
FT                   /product="phage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31754"
FT                   /db_xref="GOA:Q1CQX7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX7"
FT                   /protein_id="ABF31754.1"
FT                   /translation="MRPQKLTIAGGRRTTVDYDDRSAEYRDYNRNRWKYDKQAKQFYNS
FT                   RIWRETSKQVLLQNDYICAMCGGEATMTDHIVSVKQDWNKRLDWNNLQASCKACNDSKA
FT                   IRERRKNN"
FT   gene            548067..548534
FT                   /locus_tag="MGAS9429_Spy0567"
FT   CDS_pept        548067..548534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0567"
FT                   /product="phage terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31755"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX6"
FT                   /protein_id="ABF31755.1"
FT                   /translation="MGRNLKLVETTKKHLTKEEKIVRETAQNKASDGLKKLQKTPPEHF
FT                   NNVAKYEYRRIIEDLQNLPLRNLDRGLLELYCTWYAIYKETSRKLDEVGYFTNDPDKGI
FT                   IPSPLILTLEKATANIRSSASQLGLTVDSRMKMFIPKEEEKPKSIFDKFGG"
FT   gene            548537..548767
FT                   /locus_tag="MGAS9429_Spy0568"
FT   CDS_pept        548537..548767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX5"
FT                   /protein_id="ABF31756.1"
FT                   /translation="MERVKEFSVKLLENGKFPIVEINGEKINGITKLIVKYDSDDAQNN
FT                   PLDNGFLVEYISEEGGRYYMQTIGQSFRIGL"
FT   gene            548768..550525
FT                   /locus_tag="MGAS9429_Spy0569"
FT   CDS_pept        548768..550525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0569"
FT                   /product="terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31757"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX4"
FT                   /protein_id="ABF31757.1"
FT                   /translation="MIKVEYDYSAISDIYKDDAFYYAKMVVDEQIKSSKKVFRACLRHL
FT                   NDLKKIDGDNFKFIYLPEKAADPINFIEILPDVKTGKPYPLAMFQKFIIGNLYGWRKKT
FT                   DHSLRRFRKAMISVARKNGKTILIAGILLYEFLFGHNPSMSRQLFCTANDRTQAKIAWD
FT                   MAKKQLSSLRAKDADVRKATKIVRDELKNLHDESYIRALSRDTGAVDGFEPYVGVLDEF
FT                   AASKTNEMLELLESGQGQLDNPFILIISTAGMDLNVPMHTIEYPYITKILDGEITDEGY
FT                   FGYVAEQDNEEEIKDESNWIKSNPILEVEALHDKLMDYLRTRRRVSLETGEINKVLIKN
FT                   FNMWRQSSEESYIDKTTWELARIDKPDTNKRRVWLGVDVGRVSDLFAITPVVMMDDFWY
FT                   IDSFSFVATKYGLTAKEKRDGVSYSNLECQGYCEITTLESGVIDDERVLEKIEEMVYSN
FT                   DWEINGICFDPYQFGTLLTMIEKRHPEWPLIEVSQTTMVLNMPTKQFRDDLKKGKIKHS
FT                   GNPLLTMAINNAYIKTDNNGMRIDKNKNSNKIDPLDAALDGYAVCYLEPFDGSGYWTNE
FT                   KIIGGESLF"
FT   gene            550522..550692
FT                   /locus_tag="MGAS9429_Spy0570"
FT   CDS_pept        550522..550692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0570"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31758"
FT                   /db_xref="GOA:Q1CQX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX3"
FT                   /protein_id="ABF31758.1"
FT                   /translation="MIDFILKNIHTLILLAGLGLLMYGLFLFGDKVGFIASGLILIVLA
FT                   IYVDSVGGKRE"
FT   gene            550685..550909
FT                   /locus_tag="MGAS9429_Spy0571"
FT   CDS_pept        550685..550909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0571"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX2"
FT                   /protein_id="ABF31759.1"
FT                   /translation="MNKRIKKKRKLETAIVLLIKEVAELRSIVSANAKATNNELAAVKS
FT                   AILDNQVAIKSIGDEVGHIKQNYKRKWRK"
FT   gene            550943..552163
FT                   /locus_tag="MGAS9429_Spy0572"
FT   CDS_pept        550943..552163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0572"
FT                   /product="portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31760"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX1"
FT                   /protein_id="ABF31760.1"
FT                   /translation="MSFFRPLGSSKVSYDDYISSVLAGDVSQKYLGVSALKNSDILTAT
FT                   SIIAGDIARFPLVKKDVNGDIIHDEDINYLLNVKSTKNASARTWKFAMAVNAILTGNSF
FT                   SRILRDPKTNQALQFQFYRPSETTVEETDSHEIIYTFTDTLTAKQVKCFAHDVVHWKFF
FT                   SHDTILGRSPLLSLGDEIDLQTGGINTLIKFFKDGFSSGILTMKGAQLSGDARQRARQE
FT                   FEKMREGSVGGSPLVFDSTMEYTPLEIDTNVLQLITSNNFSTAQIAKALRVPSYKLGVN
FT                   SPNQSVAQLMEDYVTNDLPFYFDAITSELGLKTLNDKDRRLYRIEFDTRSVTGRNVDEI
FT                   VKLVNNQILTPNQGLIELGKQKSTDPNMDRYQSSLNYVFLDKKEEYQDKVGIKGKGGEV
FT                   NAKEDKS"
FT   gene            552141..552806
FT                   /locus_tag="MGAS9429_Spy0573"
FT   CDS_pept        552141..552806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0573"
FT                   /product="ATP-dependent endopeptidase clp proteolytic
FT                   subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31761"
FT                   /db_xref="GOA:Q1CQX0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQX0"
FT                   /protein_id="ABF31761.1"
FT                   /translation="MPKRINLKGPLIANNSQEVYDYYGMEATSAKSIINQLPEDSSDII
FT                   LEVNSNGGLVTVGSEVYTALRNYKGKVTAEITGMAASAASVAVMGADKVVMSPTAQMMV
FT                   HKALFNWVAGNSDDLDKASNALKSSDKAIVNAYVAKTGLSEDEIMNLMRNETFMSAQDA
FT                   VEKGFADEVMSFEAVASIDNQMLPQAVIDDYYANRSKRKQEISNMLLEIEKEEILQGL"
FT   gene            552819..554018
FT                   /locus_tag="MGAS9429_Spy0574"
FT   CDS_pept        552819..554018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0574"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31762"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW9"
FT                   /protein_id="ABF31762.1"
FT                   /translation="MEEFMFEEKIKEIKATIASLNQAIATKTAEVKNALESDDLETARS
FT                   IKAEVEQAKADLVEAENDLKLYEASIEKGGAENTGGKEVPQETKTYRESVNEFIRSKGT
FT                   VTNEALRFEGKDEVLIPLNQTTPIDPKTDGVKKTDVKPVSSEEILYTPAREVKTVVDLK
FT                   QFTSIHPAKKASGKWPVLQCATEKMVSVEELEKNPKLAKPKFKDVEWKVETYRGAIPLS
FT                   QESIDDADVDLVGIVAETIGQMKVNTTNDAIAKVLKTFEPKADVKTLDEIKKILNVDLD
FT                   PAYNVSFIVSQSFYQSMDTLKDENGRYLLQDSITSVTGKVFLGKPVFVLADEVLGKNKA
FT                   FVGDFKRGVLFADRKDLGLRWVDNDIYGQYLQAVLRFGVAKVDDKAGYYVTFTPEQLPS
FT                   "
FT   gene            554032..554160
FT                   /locus_tag="MGAS9429_Spy0575"
FT   CDS_pept        554032..554160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0575"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW8"
FT                   /protein_id="ABF31763.1"
FT                   /translation="MAKPTSKSTVEEIKRYLTSKGIDFSGKTLKSDLLALAGVEEV"
FT   gene            554163..554465
FT                   /locus_tag="MGAS9429_Spy0576"
FT   CDS_pept        554163..554465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0576"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31764"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW7"
FT                   /protein_id="ABF31764.1"
FT                   /translation="MAVSKELLDSVKLYCKIDFDFEDDIIKEMIESAQEQICFAIEEGS
FT                   TAGTFKESAKFALAVKKQVKEEYDHRGLSADSFRYPLANGVLNIIHQLRLRGDDS"
FT   gene            554462..554809
FT                   /locus_tag="MGAS9429_Spy0577"
FT   CDS_pept        554462..554809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0577"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31765"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW6"
FT                   /protein_id="ABF31765.1"
FT                   /translation="MITRKMNVRITIFSQSGGQNEDGEVVSAIRKDLYTCWAEVLKTQL
FT                   RDFNYQSKFQNASNLPTNKDTKVFLIRYNPELSIDNTMFVEFDKRIYKIDKIESDESGK
FT                   DMIMISGVSMS"
FT   gene            554806..555183
FT                   /locus_tag="MGAS9429_Spy0578"
FT   CDS_pept        554806..555183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0578"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31766"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW5"
FT                   /protein_id="ABF31766.1"
FT                   /translation="MTKGLDEILANLTKLEVKASKTAKAAVTKVAKEFEKTLKSNTPVY
FT                   EIETDERLQEDTVISGFKGSNVGIVSKEIGYGKATGWRAHYPNDGTIYQRGQDFKERTI
FT                   NQMTPRARQIYAEKVKEGLGL"
FT   gene            555180..555605
FT                   /locus_tag="MGAS9429_Spy0579"
FT   CDS_pept        555180..555605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0579"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31767"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW4"
FT                   /protein_id="ABF31767.1"
FT                   /translation="MIAETAAYKLLSNDKTLNELLDRLRGGTFKNGFKQGIFTYDIPDN
FT                   PVNLRKVELAPFMRINTTLDGPFDYADDEILCNEQRITINFWCKTASEADQINKCIDNI
FT                   LKQGGFERYTANEKPRYKDRDIDLLMNVRKYRYFDFY"
FT   gene            555621..556229
FT                   /locus_tag="MGAS9429_Spy0580"
FT   CDS_pept        555621..556229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0580"
FT                   /product="major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31768"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW3"
FT                   /protein_id="ABF31768.1"
FT                   /translation="MGKVKFGLRDFYYGVLDGNDKVTKAESIKHLPGMKSAKLDITNEL
FT                   VTVPADDGPYVVLSGGISETKLEIELLDLTSDARKDFFGITVEKGVEKYNKNLTPNDIV
FT                   CLFRTSDENGKAIWIALLKGKFNLPGMEAQTKEGAPDPKPDTTTGNFVARGPKEEVLLV
FT                   GREGNSGFNLNEFLKCVFAGCGDAEIKKIPIAEQASTVM"
FT   gene            556282..556608
FT                   /locus_tag="MGAS9429_Spy0581"
FT   CDS_pept        556282..556608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0581"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31769"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW2"
FT                   /protein_id="ABF31769.1"
FT                   /translation="MYEITLKKGGVDKEFKKDFINVEDNLLAVEHQVRQSAVFSDEKRR
FT                   LDSKAHRKLNESYLQMFVDMYAGQFTVDDLKQSDMTVLNTLNDLYIAALGGEQEEDESE
FT                   KKEQ"
FT   gene            556638..556805
FT                   /locus_tag="MGAS9429_Spy0582"
FT   CDS_pept        556638..556805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0582"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW1"
FT                   /protein_id="ABF31770.1"
FT                   /translation="MWIQSLLKNGYTILDIKKMRLSDIELMVQALEIETVEKEEVIETT
FT                   LDKAFPFLFG"
FT   gene            556818..560741
FT                   /locus_tag="MGAS9429_Spy0583"
FT   CDS_pept        556818..560741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0583"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31771"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQW0"
FT                   /protein_id="ABF31771.1"
FT                   /translation="MGNIGDLVATATLDISPFMSNTRNLKTYMKGLDNSLKAVEKSFQG
FT                   HGGRIKGLKAVYAETGSALKGYQELLKTQSQKYSDLKKEIGDVNNATAEQKQKLIGAKS
FT                   AMLETAAQVAELQNRLRALATETSVFTRFGKAAERIGGKMKSFGDSVAGVGAAFTRGVT
FT                   APIVAGAGYAIKAAVDYESAFAGVKKTVDETATVSYAKLSQGIRQMAKELPASAVEIAH
FT                   VAEAAGQLGVKTGDILSFSRTMIDLGESTNLSAEEAATSIAKIANITGLASSEYSRFGS
FT                   AVVALGNNFATTERDIVAMTNRIAASGKLAGLTNQEMLALATAMSSVGIEAEAGGTAMT
FT                   QSLSAIERAVASGGDNLNKFAQIANMSSADFARAWKEKPIVALQEFIKGLGQLDKKGES
FT                   ATKVLDELGLSGIRQSNMLKSLGLASETLGKALGISNKAWKENTALTDEANKRYETTES
FT                   KLKMLKNEVNDVAIEFGGPLVDALRNGLEAGKPIIQMAADLAKQFNSLDKEQQQQIIKW
FT                   GLIAAAAGPALSILGKGIGVIGGTIQAIGKMSKGIGALSGWLRTFKAGAVAASVGAEAA
FT                   TASMGSLTGAVALLSNPVTWGVLLGGAAVIGIGLIADSMYKAQKRTEEWGTAVSATEAT
FT                   ALSNFKKKVDETNTSLQMFEAGAGSVKKVTEAFDDLVGSIEKLAQSKLDKNINLAKKLG
FT                   LSEETINALKSKTESVVNNVKSMNTQIKAIMEKHNGDMSQLSSAEKELVLRNQREMIIA
FT                   QLDLMKFSASEKKALTAALNNELDALNARQLEKVSENTVKMLDKENSAYKTKKAELKEI
FT                   LKQFGSDTSKLSAEELAARQEVLNRLTELNMQHNLKTKALNDQYLAIQRERVQRLKESG
FT                   KSQEEIHRGISQMASDMAQKLGISYDDAYRKMAYYTEKSGETLKVLSRNTANATAEVAA
FT                   ANAQWDSLFTSDNPQQSLNELLSTAEGWNSFEIMVKNADVEPTGRAALAEMLVAGGQWQ
FT                   NMTLEQKKLVVDGQQAMIEIFDSKELLAQWQVLTPEEKVLLAKNLTQEPTMSAQQALDS
FT                   VKQTVPADVNATDKTAGDTQSAQSKIDNVKQKAPADMKASDKTGPDVASANRAVNSPKQ
FT                   NSPAVIRAQDNASGVAENVIWSLARIPRSVTTTITTFVRKIFGHEKGTDFHPGGLAVVN
FT                   DQKGALYRELVTLPTGESFIPTGRNVILPLPRGSKVLKASRTKQLFPHYANGIGFDDTR
FT                   IASLTTRLKSVQDKGTVVVNADPQLAELIKLLKDRDDRNVTNNYTLNATNSSSSEDMFS
FT                   QENMRRLVRELAYYTKGEEGRLA"
FT   gene            560741..561448
FT                   /locus_tag="MGAS9429_Spy0584"
FT   CDS_pept        560741..561448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0584"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31772"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV9"
FT                   /protein_id="ABF31772.1"
FT                   /translation="MRYIEFNGTKSNDLGLLLERERSIKSTNNDVDLIEVAGRDGVLIK
FT                   DNERLKAVEQDFPFSLVGDVTANQQKISEWLHVKGWHDLALSWDKDYIYRASVVNLFEI
FT                   DEILKQFGRLKINFLIHPIKYLKTGKQEVSLVNGSTLQNPGNVQAKPILKIKGIGNGVL
FT                   TINGFKTGLENVQGELVIDMERHLVYKDVLSAWDNIVRTERHRMPLFDVGQNKISWTGS
FT                   FTITAVPNWGVKV"
FT   gene            561445..563589
FT                   /locus_tag="MGAS9429_Spy0585"
FT   CDS_pept        561445..563589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0585"
FT                   /product="phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31773"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV8"
FT                   /protein_id="ABF31773.1"
FT                   /translation="MIPVLYEAKETKFRTFGLGEIADAYEVKATRERNGNYSLYIKYPL
FT                   DGVFASVFKEEMKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIALKPF
FT                   VNGASVGAESALEIWKKNLVGDDKFDVKSDILTLGSFSWEADKIGNARGALGGVAGSIL
FT                   DVYGGEYEFDNRTIILRKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRYTPQ
FT                   PKPQEEAPGKPHVGEHKQPEEQLVTLPEFILDGQYLSLYAQRRIQMVDLSSHFNDDKNK
FT                   KEPTVEEIRKLAQKYLKDNNVGAPKVSIEVDYIDLSQTLDYQDFRVMEEVELCDIVPLY
FT                   YPKFGITTESEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVSERINALENNQKVI
FT                   TNNQKQFELNLPKYLNDINGKRVWYEKPDDNIEHKIGDYWFEKNGKYQRTWIWDGNQWV
FT                   KVLDTEDLNPNQRAFDEAMAEIEKAKKAQEEINQRTDKELEEFRATLKNLALPEEAIKK
FT                   ITEAIKVDDIPSIKQSFDDLKNKVSETSETSRLNAEILGNNGKTRYNKNLLVGDPNRTK
FT                   TYDEDYIEVEANDGGFKRGETYTISFSQTCELLQKVAITLTQANNKGVKLVLTPTKAKT
FT                   DAQTFEVTKDKQSIEVYPLSYTGVLTGDWYKPKQIDLNASDTQELALEMAYKEVVDGKD
FT                   AAITGIWSDSPQIILDGGKK"
FT   gene            563586..564596
FT                   /locus_tag="MGAS9429_Spy0586"
FT   CDS_pept        563586..564596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0586"
FT                   /product="hyaluronoglucosaminidase"
FT                   /EC_number="3.2.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31774"
FT                   /db_xref="GOA:Q1CQV7"
FT                   /db_xref="InterPro:IPR009860"
FT                   /db_xref="InterPro:IPR041352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV7"
FT                   /protein_id="ABF31774.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWTRSDVILLESEIGFETDTGYAKFGDG
FT                   KNQFSKLKYLNKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESKIELDKKLNLKG
FT                   GVMTGQLQFKPNKSGIKPSSSVGGAINIDMSKSEGAGVVVYSNNDTSDGPLMSLRTGKE
FT                   TFNQSALFVDYSGKTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQIRGVEKALGTLK
FT                   ITHENPNVEANYDENAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLGDD
FT                   KFYVKHDGGFYAKKTSQIDGNLKLKNPTADDHAATKAYVDSEVKKLKALLMDKQV"
FT   gene            564609..566495
FT                   /locus_tag="MGAS9429_Spy0587"
FT   CDS_pept        564609..566495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0587"
FT                   /product="phage infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31775"
FT                   /db_xref="InterPro:IPR012892"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV6"
FT                   /protein_id="ABF31775.1"
FT                   /translation="MSRDPTLTLDESNLVIGKDGRVHYTFTAEDDNPKVRLASKCLGTA
FT                   HFNQLMIERGDQATSYVAPVVVEGTGNPTGLFKDLKEISLELTDTANSQLWSKIKLTNR
FT                   GMLQEYYDGKIKTEIVNSARGVATRISEDTDKKLALINDTIDGIRREYRDADRRLSSSY
FT                   QSGINGLKAQLANDKIGLQAEIQATAQGLSQKYDNELRQLSAKITTTSSGTTEAYESKL
FT                   AGLRAEFTRSNQGMRIELESQISGLRAVQQSTASQISQEIRDRTGAVSRVQQDLESYQR
FT                   RLQDAEDNYSSLTHTVRGLQSDVGSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGD
FT                   SIKLAIQKAGGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTFTTKIAEAI
FT                   KIRADQIIAGTIDAARIRVINLNASSIVGLDANFIKAKIGYAITDLLEGKVIKARNGAM
FT                   LIDLSSAKMDFNSNATINFNSRDNALVRRDDTHTAFVHFSNATPKGYTGSALYAAIGIT
FT                   SSGDGVNSASSGRFAGMRCFRHATGYNHTAAVDQTEIYGDSVLIADDFSINRGFKFRPD
FT                   KMTKVLDMNDLYAAVVALGRCWKHLANVGWNTVHGNFTNAVTNELNNHINKI"
FT   gene            566507..566938
FT                   /locus_tag="MGAS9429_Spy0588"
FT   CDS_pept        566507..566938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0588"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31776"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV5"
FT                   /protein_id="ABF31776.1"
FT                   /translation="MDLTLKNKELNTLYRVLDKIKITNMRANRGRAKLLAKVVDKINEY
FT                   AKDETDLIDMYAAKDKDDKFVIDEHKNIKLADPAKLDELNDLLNELADEEIVIKGGEYS
FT                   KRFIDFLNFLEECEDEFTSSEIILIDNILEQFEESKKGE"
FT   gene            566941..567558
FT                   /locus_tag="MGAS9429_Spy0589"
FT   CDS_pept        566941..567558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0589"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31777"
FT                   /db_xref="InterPro:IPR009796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV4"
FT                   /protein_id="ABF31777.1"
FT                   /translation="MRNWKVTGKYPQFDSTGAVASTHIIITAEDGSVISQLVKQDLIST
FT                   NDTEIIKATLEEFKKSEYVEIAMGEAVQKVDDLEKISQETAKTAKTAQTAAGLAKVSAE
FT                   RTQKMINLQTIHMLMSGGKIDSDIYKGMLELIEPAKKGEYQAYDVFTVVDSTKEEDGEA
FT                   GEGNLVFVHVNEAFEYDKQTLEELESEAKVTVIKYADLVKQD"
FT   gene            567568..567843
FT                   /locus_tag="MGAS9429_Spy0590"
FT   CDS_pept        567568..567843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0590"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31778"
FT                   /db_xref="GOA:Q1CQV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV3"
FT                   /protein_id="ABF31778.1"
FT                   /translation="MATELIFGVGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHAEQNKTLITMTEQIKNLTDDVKDLKDMMRGEIK"
FT   gene            567840..568067
FT                   /locus_tag="MGAS9429_Spy0591"
FT   CDS_pept        567840..568067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0591"
FT                   /product="holin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31779"
FT                   /db_xref="GOA:Q1CQV2"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV2"
FT                   /protein_id="ABF31779.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTKGLSDSEQALTYHEPKK"
FT   gene            568183..569397
FT                   /locus_tag="MGAS9429_Spy0592"
FT   CDS_pept        568183..569397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0592"
FT                   /product="phage-associated cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31780"
FT                   /db_xref="GOA:Q1CQV1"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV1"
FT                   /protein_id="ABF31780.1"
FT                   /translation="MTFLDKIKQGCLDGWAKYKILPSLTAAQAILESGWGKHAPHNALF
FT                   GIKADASWTGKSFNTKTQEEYQAGVITDIVDRFRAYDSWDESIADHGQFLVDNPRYQSV
FT                   IGEADYKKACHAIKDAGYATASGYAELLIQIIEENNLQKWDKEAIVRKEKQMINSQCRE
FT                   VIEFFINLANAGMGVDKDSFAGWQCADVPCYAAKHWFDVDLWGNAIDLLDSAAAVGWEV
FT                   HRMPTDANPLTGAFFVQSVPYHQFGHTGIVIEDSDGYTMRTVRTVEQNIDGNPDALYVG
FT                   APARFNTRDFTGVIGWFYPPYQGDTVTQPVSTEPQTSETIVETAKTGTFTLDVAEINIR
FT                   RWPSLASEVVGSYKQGDTVSFDNEGYANGYYWISYVGGSGMRNYLGIGQTDKDGNRISL
FT                   WGKLN"
FT   gene            complement(569465..570172)
FT                   /gene="speC"
FT                   /locus_tag="MGAS9429_Spy0593"
FT   CDS_pept        complement(569465..570172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="MGAS9429_Spy0593"
FT                   /product="enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31781"
FT                   /db_xref="GOA:Q1CQV0"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQV0"
FT                   /protein_id="ABF31781.1"
FT                   /translation="MKKINIIKIVFIITVILISTISPIIKSDSKKDISNVKSDLLYAYT
FT                   ITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYI
FT                   LNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKI
FT                   RKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIIN
FT                   MKNFSHFDIYLEK"
FT   gene            complement(570283..571041)
FT                   /gene="spd1"
FT                   /locus_tag="MGAS9429_Spy0594"
FT   CDS_pept        complement(570283..571041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spd1"
FT                   /locus_tag="MGAS9429_Spy0594"
FT                   /product="streptodornase"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31782"
FT                   /db_xref="GOA:Q1CQU9"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CQU9"
FT                   /protein_id="ABF31782.1"
FT                   /translation="MKLSKQKASLLTAVLLLLSLSITTITVDAARVRTYPNVSHANTHY
FT                   KNTVSSKLLPFTANYQLQLGELDNLNRATFSHIQLQDRHETKDVRTKINYDPVGWHNYQ
FT                   FPYGDGSKSSWVMNRGHLVGYQFCGLNDEPRNLVAMTAWLNTGAYSGANDSNPEGMLYY
FT                   ENRLDSWLALHPDFWLDYKVTPIYSGNEVVPRQIELQYVGIDSSGELLTIRLNSNKESI
FT                   DENGVTTVILENSAPNINLDYLNGTATPKN"
FT   gene            571353..572771
FT                   /gene="pepD"
FT                   /locus_tag="MGAS9429_Spy0595"
FT   CDS_pept        571353..572771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="MGAS9429_Spy0595"
FT                   /product="dipeptidase A"
FT                   /EC_number="3.4.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31783"
FT                   /db_xref="GOA:Q1JMM9"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM9"
FT                   /protein_id="ABF31783.1"
FT                   /translation="MDKKIQRFSCTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIV
FT                   VKPEDQPRHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVAMSATETI
FT                   TTNSRVLGADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSD
FT                   EHDIWWLETIGGHHWIARRVPDDAYVTNPNQFGIDYFEFNNPEDYLCSADLKDFIDTYH
FT                   LDLTYNHEHFNPRYAFGSQRDKDRHYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYR
FT                   KITVEDVKYVLSSHYQDTVYDPYGSEGTPVSKKVFRPIGINRTSQTAILHIRPNKPQEI
FT                   AAIQWMAYGSMPFNTMVPFFTQVKTIPDYFANTYENVSTDNFYWTNRLIAALADPHYNH
FT                   HETDLDNYLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILF
FT                   DASNLMTNRFSLSD"
FT   gene            572923..574470
FT                   /locus_tag="MGAS9429_Spy0596"
FT   CDS_pept        572923..574470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0596"
FT                   /product="high-affinity zinc uptake system protein znuA
FT                   precursor"
FT                   /note="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31784"
FT                   /db_xref="GOA:Q1JMM8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM8"
FT                   /protein_id="ABF31784.1"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGVIGNDGDVSMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGVGHDHHHEEADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTEKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEPNAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            574609..575340
FT                   /locus_tag="MGAS9429_Spy0597"
FT   CDS_pept        574609..575340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0597"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31785"
FT                   /db_xref="GOA:Q1JMM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM7"
FT                   /protein_id="ABF31785.1"
FT                   /translation="MNKMPKEQPLYLQIVDDLEVKIKKSMTENDKLLSERELSDLYGVS
FT                   RITIRLALKELELRDLIYKKQGKGTYVSGIKEPVTDLSSTYSFTEQMKKVGKTPKTEIL
FT                   SFEQYQVTPYLSGLLEFDLDTEVFELERLRIADDMPLMFERSYIPAQPFQGLSIADLKR
FT                   KALYDIFAKDYQETIRLAEEEFYASIALDYEADLLGIKKGDPVLHIIRKTYNDKNILIE
FT                   FTFSIARADQFRYRVQHHPNG"
FT   gene            575360..576559
FT                   /gene="agaS"
FT                   /locus_tag="MGAS9429_Spy0598"
FT   CDS_pept        575360..576559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="MGAS9429_Spy0598"
FT                   /product="galactosamine-6-phosphate deaminase
FT                   (isomerizing)"
FT                   /EC_number="3.5.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31786"
FT                   /db_xref="GOA:Q1JMM6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM6"
FT                   /protein_id="ABF31786.1"
FT                   /translation="MFTKTQEALEALGAAITTKEIKQEPRLWQETMTFFEETRDSLDSF
FT                   LKRVCKSANGNNVHVIFTGAGTSEYIGNTICPYLKKVGNRQCYLFESVASTDLVAAPDY
FT                   YLAEEETVLLVSFARSGNSPESVAAVNLVNQLVPNSYHLTITCAKDGELAKKAQQDERS
FT                   YLYLMPEDANDAGFAMTGSFTCMMLAALLIFDDANSIAQKEAYVTDMILAGQAVIDQER
FT                   RLQELADLGFERLVYLGSAGLAKLTQEAQLKMLELTAGQVATLYESSMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLL
FT                   PEAYLAFPMILVAQTLALLTAVTLGNSPDTPSATGTVNRVVKGVTIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(576656..576916)
FT                   /gene="rpmE"
FT                   /locus_tag="MGAS9429_Spy0599"
FT   CDS_pept        complement(576656..576916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="MGAS9429_Spy0599"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31787"
FT                   /db_xref="GOA:Q1JMM5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMM5"
FT                   /protein_id="ABF31787.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(577031..577972)
FT                   /locus_tag="MGAS9429_Spy0600"
FT   CDS_pept        complement(577031..577972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0600"
FT                   /product="phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31788"
FT                   /db_xref="GOA:Q1JMM4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM4"
FT                   /protein_id="ABF31788.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLTWISQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGQCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSANLEENQAIFRELIAVCQEI"
FT   gene            578366..578815
FT                   /locus_tag="MGAS9429_Spy0601"
FT   CDS_pept        578366..578815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0601"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31789"
FT                   /db_xref="GOA:Q1JMM3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM3"
FT                   /protein_id="ABF31789.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSDQFALTGAVKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            578990..579274
FT                   /locus_tag="MGAS9429_Spy0602"
FT   CDS_pept        578990..579274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0602"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31790"
FT                   /db_xref="GOA:Q1JMM2"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM2"
FT                   /protein_id="ABF31790.1"
FT                   /translation="MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   ARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRQYQTQRLTGGDIND"
FT   gene            579255..580529
FT                   /locus_tag="MGAS9429_Spy0603"
FT   CDS_pept        579255..580529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0603"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31791"
FT                   /db_xref="GOA:Q1JMM1"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMM1"
FT                   /protein_id="ABF31791.1"
FT                   /translation="MVTLMIKSIATLPKPSLKEALGLIGLALPIGATVGVVDVIFGKGL
FT                   LFLSEYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFQVGHGQKDQIPPILI
FT                   PLILFSTWVTHLFGASAGREGVAVQIGATISHYCQRFVTSQEAARHLLIMGMAAGFAGL
FT                   FQTPIAAVVFALEVLLVGTLRYCALLPSLVAACVASWTSHSLGLEKFTIVLEETLTITP
FT                   LTLVKLIGLGLIFGLVGNSFAYLLGWFKPYLSQKLPNPYFRIAFIGALLSICLMIGHVG
FT                   RYSGLGTHLIAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFAIGASLGIVLA
FT                   PYLGLPVLLVAALGYTTVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMVSHRH
FT                   SIYSYQKVVMINLKDMTVNQMDLKK"
FT   gene            580644..580991
FT                   /gene="rplS"
FT                   /locus_tag="MGAS9429_Spy0604"
FT   CDS_pept        580644..580991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="MGAS9429_Spy0604"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31792"
FT                   /db_xref="GOA:Q1JMM0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMM0"
FT                   /protein_id="ABF31792.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            581238..581309
FT                   /locus_tag="MGAS9429_SpyT0045"
FT   tRNA            581238..581309
FT                   /locus_tag="MGAS9429_SpyT0045"
FT                   /product="tRNA-Arg"
FT   gene            581994..582563
FT                   /locus_tag="MGAS9429_Spy0605"
FT   CDS_pept        581994..582563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0605"
FT                   /product="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31793"
FT                   /db_xref="GOA:Q1JML9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML9"
FT                   /protein_id="ABF31793.1"
FT                   /translation="MKGMNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFSLPGDHDAVY
FT                   QKLKESTAIAVAMFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILEKIATSGSRNFLI
FT                   SHRDCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDINSGLVIGDRLI
FT                   DKQAGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            582564..584516
FT                   /gene="gyrB"
FT                   /locus_tag="MGAS9429_Spy0606"
FT   CDS_pept        582564..584516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MGAS9429_Spy0606"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31794"
FT                   /db_xref="GOA:Q1JML8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML8"
FT                   /protein_id="ABF31794.1"
FT                   /translation="MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGL
FT                   HHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVF
FT                   TVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADL
FT                   EVIGTTDVTGTTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNHGLKISITDKRSGME
FT                   QEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELEGIAVEVAMQYTTSYQETVMSFA
FT                   NNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPN
FT                   PQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRA
FT                   REVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIR
FT                   GKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIR
FT                   TLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSI
FT                   GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPR
FT                   RDFIEENAVYSTLDI"
FT   gene            584908..586632
FT                   /locus_tag="MGAS9429_Spy0607"
FT   CDS_pept        584908..586632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0607"
FT                   /product="septation ring formation regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31795"
FT                   /db_xref="GOA:Q1JML7"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JML7"
FT                   /protein_id="ABF31795.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLAHVKRNNEQLKDEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(586764..587222)
FT                   /locus_tag="MGAS9429_Spy0608"
FT   CDS_pept        complement(586764..587222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0608"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31796"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML6"
FT                   /protein_id="ABF31796.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDQAINLKETRLEVILKQTKNDQLSKQTPEKTKSFWKRFLKK"
FT   gene            587455..588762
FT                   /gene="eno"
FT                   /locus_tag="MGAS9429_Spy0609"
FT   CDS_pept        587455..588762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="MGAS9429_Spy0609"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31797"
FT                   /db_xref="GOA:Q1JML5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JML5"
FT                   /protein_id="ABF31797.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMITLDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            complement(589351..589926)
FT                   /locus_tag="MGAS9429_Spy0610"
FT   CDS_pept        complement(589351..589926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0610"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31798"
FT                   /db_xref="GOA:Q1JML4"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML4"
FT                   /protein_id="ABF31798.1"
FT                   /translation="MVTAFPCNSFVLELADKALSAIIRQSTSKRISDKRGIYLVEKLVS
FT                   LAKQSYFTVTKTSPMIEEVRYYAKELLRLSERRQAIFDKMVALAQPLPEDKILRSIPSI
FT                   AETTATSIIDELGAIRRFQSANQINAFIGIDFRHYESGNCLAQEHITERGNPYAPKILF
FT                   KCIHDIASASHTNPCHIADFYEKRKRQS"
FT   gene            complement(590012..590173)
FT                   /locus_tag="MGAS9429_Spy0611"
FT   CDS_pept        complement(590012..590173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0611"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31799"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML3"
FT                   /protein_id="ABF31799.1"
FT                   /translation="MRKADKLDTEKLAQSQFILVRKPTYVQEEVYQLLRDLSRFYQNLR
FT                   LRIILFES"
FT   gene            complement(590535..591083)
FT                   /locus_tag="MGAS9429_Spy0612"
FT   CDS_pept        complement(590535..591083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0612"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31800"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML2"
FT                   /protein_id="ABF31800.1"
FT                   /translation="MLPDIHLFHYLRRQQKRNKSFYNTLKTIVEEWMSAEGIVGKLPSY
FT                   HLLLFTIQLEELLKTYLPPIPVYLLTNNTAALDLMTNALSIYFPPAIATVMPVNVEIIP
FT                   FKDIVKEKQSVIIADRQYLNLIQHLYQNQGHLFLYFLFSFRDVSEAYIHKAFLDFCQKR
FT                   YDEFIVTLLDTYHKNLSSP"
FT   gene            591128..596395
FT                   /gene="epf"
FT                   /locus_tag="MGAS9429_Spy0613"
FT   CDS_pept        591128..596395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="MGAS9429_Spy0613"
FT                   /product="extracellular matrix binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31801"
FT                   /db_xref="GOA:Q1JML1"
FT                   /db_xref="InterPro:IPR011439"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML1"
FT                   /protein_id="ABF31801.1"
FT                   /translation="MLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKT
FT                   SKDFFFEVGIDPKVEAKQKEKLLELDKVKKQIEDSINGDAWLPEKPEGEKPVQNTNKEL
FT                   QLQELNKKYQMAKEAIESATTLDDVETQFDKYTKVGDKDKYPDSLRNQYTQGDKDKEIE
FT                   KAKKSLGDLSDKVNGKIEEDKWLSAEVKKKQQQELEARKQKVNDSLKGSDSLKSLRETV
FT                   EKASSKNQKKPESFEDVYVPGNEETEKTKVRDILQKTYQKTEQNIETDPWLSPEQKKAQ
FT                   KENAKTRLDAGLKAVETTESLDKLKEVESDFLDKEKNPDSIPNQHKAGTPEVARKTFLD
FT                   NFEKEAKKEIESIKNDVTLTDAEKATAKAKVEAQLQEAKGKAKESKSFDDLKNIQDKFN
FT                   SELPHTPGKPLKDQQSDAIAELEKKQQEIEKAIEGDKTLPRDEKEKQIADSKERLKSDT
FT                   QKVKDAKNADAIKKVFEEGKVNIPQAHIPGDLNKDKEKLLAELKQKAADTEKAIDSDKT
FT                   LTAKEKEEQKAKTKEELQKATEAVGAIDNREELDKKVPELKKAIEDTHVKGNLEGVKNK
FT                   AIEDLKKVHDETVAKINGDDTLDKATKEAQVKEADKALAAGKDAITKADDADKVGAAVT
FT                   EHTPKIKAAHKTGDLKKVQEEANQALDKAAEKERGEINNDITLTAKDKEQQLKEVETAL
FT                   TKAKDNVKAAKTADAINDARDKGVATIDAVHKAGQDLGARKSGQVAKLEEAAKATKDKI
FT                   SADPTLTSKEKEEQSKAVNAELKKAIEAVNAADTADKVDDALGKGVTDIKNQHKTGDPV
FT                   VARREAHGKQLDRVAQETKDAIEKDPTLTTEEKAKQVKDVDAAKERGMAKLTEAKNADE
FT                   LDKAYGEGVTDIKNQYKSGDPIEARRGLHNKSIDKVAQATKDAITADTTLTEAEKETQR
FT                   GNVDKEATKAKEELAKAKDADALDKAYGDGVTSIKNQHKSGKGLDVRKDEHKKALEAVA
FT                   KRVTAEIEADPTLTPEVREQQKAEVQKELELATDKIAEAKDADEADKAYGDGVTAIENA
FT                   HVIGKGIEARKDLAKKDLAEAVAKTKALIIEDKTLTDDQRKEQLSGVDTEYAKGIENID
FT                   AAKDAAGVDKAYSDGVRDILAQYKEGQNLDDRRNAAKEFLLKEADKVTKLINDDPTLTH
FT                   DQKVDQINKVEQAKLDAIKSVDDAQTADAINDALGKGIENINNQYQHGDGVDVRKATAK
FT                   GDLEKEAAKVKALIAKDPTLTQADKDKQTAAVDAAKNTAIAAVDKATTADGVNQELGKG
FT                   ITAINKAYRPGEGVKARKEAAKADLEKEAAKVKALIAKDPTLTQADKDKQTAAVDAAKN
FT                   TAIAAVDKATTAEGINQELGKGITAINKAYRPGEGVKARKEAAKADLEKEAAKVKALIT
FT                   NDPTLTKADKAKQTGAVAKALKAAIAAVDKATTAEGINQELGKGITAINKAYRPGEGVK
FT                   ARKEAAKADLEREAAKVREAIANDPTLTKADKAKQTEAVAKALKAAIAAVDKATTAEGI
FT                   NQELGKGITAINKAYRPGEGVKARKEAAKANLEKVAKETKALISGDRYLSETEKAAQKQ
FT                   AVEQALAKALGQVEAAKTVEAVKLAENLGTVAIRSAYVAGLAKDTDQATAALNEAKQAA
FT                   IEALKQAAAETLAKITTDAKLTEAQKAEQSENVSLALKTAIATVRSAQSIASVKEAKDK
FT                   GITAIRAAYVPNKAVAKSSSANHLPKSGDANSIVLVGLGVMSLLLGMVLYSKKKESKD"
FT   gene            597260..597421
FT                   /gene="sagA"
FT                   /locus_tag="MGAS9429_Spy0614"
FT   CDS_pept        597260..597421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagA"
FT                   /locus_tag="MGAS9429_Spy0614"
FT                   /product="streptolysin S precursor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31802"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JML0"
FT                   /protein_id="ABF31802.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            597643..598593
FT                   /gene="sagB"
FT                   /locus_tag="MGAS9429_Spy0615"
FT   CDS_pept        597643..598593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagB"
FT                   /locus_tag="MGAS9429_Spy0615"
FT                   /product="streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31803"
FT                   /db_xref="GOA:Q1JMK9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK9"
FT                   /protein_id="ABF31803.1"
FT                   /translation="MSFFTKEQQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPTKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYIKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            598590..599648
FT                   /gene="sagC"
FT                   /locus_tag="MGAS9429_Spy0616"
FT   CDS_pept        598590..599648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagC"
FT                   /locus_tag="MGAS9429_Spy0616"
FT                   /product="streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31804"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK8"
FT                   /protein_id="ABF31804.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENTLEPETFANLMEVISGLYYNDMLMLEDDYNLEENVMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSEALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHTCTLNPPHSADFDSLERRVLARLQDSTLYQHFANQILPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            599668..601026
FT                   /gene="sagD"
FT                   /locus_tag="MGAS9429_Spy0617"
FT   CDS_pept        599668..601026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagD"
FT                   /locus_tag="MGAS9429_Spy0617"
FT                   /product="streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31805"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK7"
FT                   /protein_id="ABF31805.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKPCPKIIVDDPDIEVILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            601001..601672
FT                   /gene="sagE"
FT                   /locus_tag="MGAS9429_Spy0618"
FT   CDS_pept        601001..601672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagE"
FT                   /locus_tag="MGAS9429_Spy0618"
FT                   /product="streptolysin S putative self-immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31806"
FT                   /db_xref="GOA:Q1JMK6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK6"
FT                   /protein_id="ABF31806.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSLESIDSKTFFMGLVFCVLIVLIELVFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEETIYRFLWFNILAFQWYLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYGSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            601669..602352
FT                   /gene="sagF"
FT                   /locus_tag="MGAS9429_Spy0619"
FT   CDS_pept        601669..602352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagF"
FT                   /locus_tag="MGAS9429_Spy0619"
FT                   /product="streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31807"
FT                   /db_xref="GOA:Q1JMK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK5"
FT                   /protein_id="ABF31807.1"
FT                   /translation="MMLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLVALSYQDFLDVL
FT                   LSLFQFVIIILVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLIL
FT                   IFDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGIVILVDSLFYLGLLILLGEQSLTS
FT                   LATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILTVTYLMI
FT                   SCKEY"
FT   gene            602375..603298
FT                   /gene="sagG"
FT                   /locus_tag="MGAS9429_Spy0620"
FT   CDS_pept        602375..603298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagG"
FT                   /locus_tag="MGAS9429_Spy0620"
FT                   /product="streptolysin S export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31808"
FT                   /db_xref="GOA:Q1JMK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK4"
FT                   /protein_id="ABF31808.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLTQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            603307..603663
FT                   /locus_tag="MGAS9429_Spy0621"
FT   CDS_pept        603307..603663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0621"
FT                   /product="streptolysin S export transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31809"
FT                   /db_xref="GOA:Q1JMK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK3"
FT                   /protein_id="ABF31809.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLEAKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKGYY"
FT   gene            603698..604435
FT                   /gene="sagH"
FT                   /locus_tag="MGAS9429_Spy0622"
FT   CDS_pept        603698..604435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagH"
FT                   /locus_tag="MGAS9429_Spy0622"
FT                   /product="streptolysin S export transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31810"
FT                   /db_xref="GOA:Q1JMK2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK2"
FT                   /protein_id="ABF31810.1"
FT                   /translation="MLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVDYVKVSSIQTSKG
FT                   MTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIHLTGVSPSLLVFGKLIGAML
FT                   ATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLGISIKNEAFLTVA
FT                   SNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIFGGQYNPIPVTLI
FT                   VNISIGTIFIILSLIGMRKQVTT"
FT   gene            604432..605550
FT                   /gene="sagI"
FT                   /locus_tag="MGAS9429_Spy0623"
FT   CDS_pept        604432..605550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagI"
FT                   /locus_tag="MGAS9429_Spy0623"
FT                   /product="streptolysin S export transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31811"
FT                   /db_xref="GOA:Q1JMK1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK1"
FT                   /protein_id="ABF31811.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   DVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGE
FT                   TLSQAWPYLLALMGTALALISFSSLLLKPTKL"
FT   gene            complement(605661..605879)
FT                   /locus_tag="MGAS9429_Spy0624"
FT   CDS_pept        complement(605661..605879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0624"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31812"
FT                   /db_xref="GOA:Q1JMK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMK0"
FT                   /protein_id="ABF31812.1"
FT                   /translation="MLIVTKTFHKINTFLHLFLITLVFMFIENVFLKCFDNSFINKNEL
FT                   SREVAFDNMLSKKHSNNSNIAIAFNKR"
FT   gene            606121..608853
FT                   /locus_tag="MGAS9429_Spy0625"
FT   CDS_pept        606121..608853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0625"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31813"
FT                   /db_xref="GOA:Q1JMJ9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMJ9"
FT                   /protein_id="ABF31813.1"
FT                   /translation="MINKKYIIPVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKSNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERTYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPEKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLVRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLEVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNMPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPTYRYVDIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNAAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGRVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKTGDSLVYVITLLGTASLLVPILLLTKGKKES"
FT   gene            609131..609631
FT                   /locus_tag="MGAS9429_Spy0626"
FT   CDS_pept        609131..609631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0626"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31814"
FT                   /db_xref="GOA:Q1JMJ8"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMJ8"
FT                   /protein_id="ABF31814.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNG
FT                   IFNKAFVYFSFFFATSMFTVAIELYFFGAPFLLTWFTTALGELVSLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            609825..611783
FT                   /gene="lig"
FT                   /locus_tag="MGAS9429_Spy0627"
FT   CDS_pept        609825..611783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="MGAS9429_Spy0627"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31815"
FT                   /db_xref="GOA:Q1JMJ7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ7"
FT                   /protein_id="ABF31815.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPHQLSEPLTITVRG
FT                   EAYMSRQSFKAINEARQENGETEFANPRNAAAGTLRQLDTSVVAKRQLATFLYQEASPT
FT                   ARNQQNEVLAELAGLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKENFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRQL"
FT   gene            611797..612819
FT                   /locus_tag="MGAS9429_Spy0628"
FT   CDS_pept        611797..612819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0628"
FT                   /product="diacylglycerol kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31816"
FT                   /db_xref="GOA:Q1JMJ6"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMJ6"
FT                   /protein_id="ABF31816.1"
FT                   /translation="MKKQLRARLIYNPTSGQELMRKSVPEVLDILEGFGYETSAFQTTA
FT                   QKNSALNEARRAAKAGFDLLIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARA
FT                   LKVPRGNPSQAAKLIGKNQTIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFG
FT                   YLAYLAKGVELLPRVSNVPVKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDG
FT                   MFTLILIKTANLFEIVHLLRLILDGGKHITDRRVEYIKTSKIVIEPQCGKRMMINLDGE
FT                   YGGDAPITLENLKNHITFFADTDLISDDALVLDQDELEIEEIVKKFAHEVEDLEQELEE
FT                   "
FT   gene            613211..613408
FT                   /gene="atpE"
FT                   /locus_tag="MGAS9429_Spy0629"
FT   CDS_pept        613211..613408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="MGAS9429_Spy0629"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31817"
FT                   /db_xref="GOA:Q1JMJ5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMJ5"
FT                   /protein_id="ABF31817.1"
FT                   /translation="MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMIL
FT                   GVAFIEGTFFVTLVMAFILK"
FT   gene            613443..614159
FT                   /gene="atpB"
FT                   /locus_tag="MGAS9429_Spy0630"
FT   CDS_pept        613443..614159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="MGAS9429_Spy0630"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31818"
FT                   /db_xref="GOA:Q1JMJ4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ4"
FT                   /protein_id="ABF31818.1"
FT                   /translation="MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLK
FT                   PEGKQTALEYLISFVDGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNG
FT                   YNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTN
FT                   FLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFT
FT                   KLTATYLGKKVNESEE"
FT   gene            614177..614671
FT                   /gene="atpF"
FT                   /locus_tag="MGAS9429_Spy0631"
FT   CDS_pept        614177..614671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MGAS9429_Spy0631"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31819"
FT                   /db_xref="GOA:Q1JMJ3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ3"
FT                   /protein_id="ABF31819.1"
FT                   /translation="MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQI
FT                   SRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAK
FT                   RLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE
FT                   A"
FT   gene            614671..615207
FT                   /gene="atpH"
FT                   /locus_tag="MGAS9429_Spy0632"
FT   CDS_pept        614671..615207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="MGAS9429_Spy0632"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31820"
FT                   /db_xref="GOA:Q1JMJ2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ2"
FT                   /protein_id="ABF31820.1"
FT                   /translation="MTKKEQALIEQYAKSLVEVASEHHSLDALQADVLAILETFVTTNL
FT                   DQSLSSLAVPHAEKIKLLTLLKGNNSVYMNNFLNLILQNEREAYLYQMLQAVLNEIAIV
FT                   SNQYDVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVID
FT                   TSIRRQLQAFKMNLK"
FT   gene            615223..616731
FT                   /gene="atpA"
FT                   /locus_tag="MGAS9429_Spy0633"
FT   CDS_pept        615223..616731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="MGAS9429_Spy0633"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31821"
FT                   /db_xref="GOA:Q1JMJ1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ1"
FT                   /protein_id="ABF31821.1"
FT                   /translation="MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLD
FT                   NAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALI
FT                   GRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTI
FT                   VVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDG
FT                   QIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFG
FT                   SDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEE
FT                   ALYDYFDVHYNDLFETIRTTKDLPEEAALDAAIKAFKEHSNFKS"
FT   gene            616747..617622
FT                   /gene="atpG"
FT                   /locus_tag="MGAS9429_Spy0634"
FT   CDS_pept        616747..617622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="MGAS9429_Spy0634"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31822"
FT                   /db_xref="GOA:Q1JMJ0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMJ0"
FT                   /protein_id="ABF31822.1"
FT                   /translation="MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQI
FT                   YASKIRQITTDLLKSELTIGSDNPMLVSRPVKKTGYIVITSDKGLVGGYNSKILKSVMD
FT                   MITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQPSFEQVRQIISQSVDMFV
FT                   NEIFDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTGFELEPNRHDILDQL
FT                   LPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEIT
FT                   EIVAGANALE"
FT   gene            617784..619190
FT                   /gene="atpD"
FT                   /locus_tag="MGAS9429_Spy0635"
FT   CDS_pept        617784..619190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="MGAS9429_Spy0635"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31823"
FT                   /db_xref="GOA:Q1JMI9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMI9"
FT                   /protein_id="ABF31823.1"
FT                   /translation="MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVL
FT                   EVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEE
FT                   PFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTV
FT                   LIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGAR
FT                   MRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATE
FT                   MGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPA
FT                   VDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGR
FT                   ARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDDLPEDAFRSVGPIED
FT                   VIKKAEKMGF"
FT   gene            619203..619619
FT                   /gene="atpC"
FT                   /locus_tag="MGAS9429_Spy0636"
FT   CDS_pept        619203..619619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="MGAS9429_Spy0636"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31824"
FT                   /db_xref="GOA:Q1JMI8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMI8"
FT                   /protein_id="ABF31824.1"
FT                   /translation="MTQMTVQVVTPDGIKYDHHAKCISVTTPDGEMGILPNHINLIAPL
FT                   QVHEMKIRRGGEDEKVDWIAINGGIIEIKDNVVTVVADSAERDRDIDVSRAERAKLRAE
FT                   REIAQAETTHNIDEVRRAKVALRRALNRINVSKK"
FT   gene            619885..620142
FT                   /locus_tag="MGAS9429_Spy0637"
FT   CDS_pept        619885..620142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0637"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31825"
FT                   /db_xref="GOA:Q1JMI7"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI7"
FT                   /protein_id="ABF31825.1"
FT                   /translation="MVCYNNPMELLMKIIAFSCHLFFIGLSYQLLISVIDWTKFSHYHP
FT                   ENLGRLRLFVFLLATALGYLVSHCMLELLQISQTLFFEFC"
FT   gene            620207..621478
FT                   /gene="murA"
FT                   /locus_tag="MGAS9429_Spy0638"
FT   CDS_pept        620207..621478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="MGAS9429_Spy0638"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31826"
FT                   /db_xref="GOA:Q1JMI6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI6"
FT                   /protein_id="ABF31826.1"
FT                   /translation="MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRN
FT                   VPILSDVFTMNNVVRGLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGP
FT                   ILARNGHAKVSMPGGCTIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMD
FT                   FPSVGATQNLMMAATLADGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGV
FT                   TSLHGVEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEE
FT                   YGIRVQANTPKLKPVTVKTLPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLE
FT                   EMRRMGLQSEILRETAMIHGGRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHL
FT                   DRGYYQFHEKLAKLGATISRSSEV"
FT   gene            621482..621670
FT                   /gene="epuA"
FT                   /locus_tag="MGAS9429_Spy0639"
FT   CDS_pept        621482..621670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epuA"
FT                   /locus_tag="MGAS9429_Spy0639"
FT                   /product="EpuA protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31827"
FT                   /db_xref="GOA:Q1JMI5"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI5"
FT                   /protein_id="ABF31827.1"
FT                   /translation="MTNGLKYVLEQMLLLLVIAALACLFLAIGLMIGYSFMGDGHSPWH
FT                   ILSMDKWAELVNKFTGK"
FT   gene            621706..622245
FT                   /gene="endA"
FT                   /locus_tag="MGAS9429_Spy0640"
FT   CDS_pept        621706..622245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="MGAS9429_Spy0640"
FT                   /product="DNA-entry nuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31828"
FT                   /db_xref="GOA:Q1JMI4"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI4"
FT                   /protein_id="ABF31828.1"
FT                   /translation="MLTRKKRKRVQEQKVPKRANALLTKSTRQYQDRSQLKKGYRSFKP
FT                   AGWHRLHHLKGSYDHAVDRGHLLGYALVGGLKGFDASTGNPDNIATQLSWANQANKPYS
FT                   TGQNYYEGLVRRALDKGHRVRYRVTLLYDGDNLLASGSHLKAKSSDDSLAFNVFVPNVQ
FT                   AGLTVDYRTGQIAINL"
FT   gene            622450..623571
FT                   /gene="pheS"
FT                   /locus_tag="MGAS9429_Spy0641"
FT   CDS_pept        622450..623571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="MGAS9429_Spy0641"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31829"
FT                   /db_xref="GOA:Q1JMI3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI3"
FT                   /protein_id="ABF31829.1"
FT                   /translation="MVPRVNAPLIKWRSGMLFSSPKEGKTMDLQAQLEELKSKTLETLQ
FT                   SLTGNHTKELQDLRVAVLGKKGSLTELLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEE
FT                   QAKIVEAAKIQAQLDAESIDVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFE
FT                   VEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDQHDFSKGPLKMV
FT                   SPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGEERSIRLRPS
FT                   YFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFA
FT                   FGLGQERIAMLRYGINDIRGFYQGDQRFSEQFN"
FT   gene            623766..626186
FT                   /gene="pheT"
FT                   /locus_tag="MGAS9429_Spy0642"
FT   CDS_pept        623766..626186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="MGAS9429_Spy0642"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31830"
FT                   /db_xref="GOA:Q1JMI2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI2"
FT                   /protein_id="ABF31830.1"
FT                   /translation="MGTKIMLVSYKWLKELVDIDVTPVALAEKMSTTGIEVEGIEVPAE
FT                   GLSKLVVGHVLSCEDVPETHLHLCQVDTGDETPRQIVCGAPNVKAGIKVIVAVPGARIA
FT                   DNYKIKKGKIRGMESLGMICSLQELGLSDSIIPKEFSDGIQILPEEAVPGDAIFKYLDL
FT                   DDHIIELSITPNRADALSMRGVAHEVAAIYGKSVSFPQKNLQESDKATSEAIELSIASD
FT                   NVLTYASRVVENVKVKPSPQWLQNLLMNAGIRPINNVVDVTNYVLLYLGQPMHAFDYDK
FT                   FEDHKIVARAARQGESLVTLDGEKRDLTTEDLVITVAEKPVALAGVMGGQATEIDGNSQ
FT                   TVVLEAAVFDGKSIRKTSGRLNLRSESSSRFEKGVNYATVLEALDFAAAMLQELAEGQV
FT                   LSGHVQAGQLPTEPVEVSTSLDYVNVRLGTELTFADIQRIFDQLGFGLTGDETSFTVAV
FT                   PRRRWDVSIPADLVEEIARIYGYDKLPTTLPEAGGTAAELTPTQALRRKVRGLAEGLGL
FT                   TEIISYALTTPEKAVEFAVAPSHLTELMWPMSVERSALRQNMVSGMLDTVAYNVARKQS
FT                   NLALYEIGKIFEQEANPKEDLPNEVNHFAFAICGLVAQKDFQTQAQAVDFYHAKGILDT
FT                   LFANLNLKVQYVPTKDLANMHPGRTALILLDEQVIGFVGQVHPGTAKAYSIPETYVAEL
FT                   DMAALEAALPSDQTFAEITKFPAMTRDVALLLDREVSHQAIVTAIESAGVKRLTSIKLF
FT                   DVYEGATIQAGKKSMAYSLTFQNPNDNLTDEEVAKYMEKITKALTEQVGAEVR"
FT   gene            626260..626673
FT                   /locus_tag="MGAS9429_Spy0643"
FT   CDS_pept        626260..626673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0643"
FT                   /product="salt-stress induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31831"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI1"
FT                   /protein_id="ABF31831.1"
FT                   /translation="MEKNIRRWRKIRMYQTKITGNRLYHTVSKGYGDSVTLFGKTDQGE
FT                   TPMSLLVIALSSCVTMCVQGFYHRQFQQDTVAVSVEASYEEEVFELLVRIDDVLDDKKK
FT                   ADLLAYIGTYCRVKQLLKPEVTVTITLEGLSHV"
FT   gene            626666..627052
FT                   /locus_tag="MGAS9429_Spy0644"
FT   CDS_pept        626666..627052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31832"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR016996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMI0"
FT                   /protein_id="ABF31832.1"
FT                   /translation="MSDASLKTYQKQWAYQKYWVMAHSQQHYNALRELFKGNQWSEEKV
FT                   LTFHCLIEEAQAIPPTVKSLRTAYQHVWGYFKKVASQEEKDHFKDLDAQLETKSEEMLC
FT                   FLQEMTAHYQPSYLLSCRLITKGP"
FT   gene            627125..628201
FT                   /locus_tag="MGAS9429_Spy0645"
FT   CDS_pept        627125..628201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0645"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31833"
FT                   /db_xref="GOA:Q1JMH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH9"
FT                   /protein_id="ABF31833.1"
FT                   /translation="MFLALNEMKQSKLRYGLIAGLLCLVAYLMFFLSGLAFGLMQENRS
FT                   AVDLWKADSVLLAKDADATLTLSQVSRAQENQITADKVAPLAQLNTVAWSVKNPKDADK
FT                   VKVRLFGIDSNSFIRPNIVKGRLFKTNKEVVLDQSLAKEEAFAIGKDFYTSSSSQALTI
FT                   VGYTQNARFSVAPVVYMNLEAFETLKYGEPLPKDKQVVNAFITKGSLTDYPKKDFQKLD
FT                   IKTFITKLPGYSAQLLTFGFMISFLVIISAIIIGIFMYILTIQKAPIFGIMKAQGIGNI
FT                   TIAQAVLLQTFLLSALGSGLGLLGTWLTSLVLPEAVPFQSNWLVYLAILVSMVCFALLG
FT                   TLFSVFSIVRIDPLKAIG"
FT   gene            628208..628879
FT                   /locus_tag="MGAS9429_Spy0646"
FT   CDS_pept        628208..628879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0646"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31834"
FT                   /db_xref="GOA:Q1JMH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH8"
FT                   /protein_id="ABF31834.1"
FT                   /translation="MMSVLTFKQVTKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGS
FT                   GKSTFLTIAGGLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQ
FT                   QQLELVDHLTGSKEKAKANQLFDDLGIAGLKHQLPQELSGGERQRAAIARALYHDPALI
FT                   LADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLKYCDKVYRMQDGELRQE
FT                   R"
FT   gene            complement(628983..629900)
FT                   /locus_tag="MGAS9429_Spy0647"
FT   CDS_pept        complement(628983..629900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0647"
FT                   /product="neutral zinc metallopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31835"
FT                   /db_xref="GOA:Q1JMH7"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH7"
FT                   /protein_id="ABF31835.1"
FT                   /translation="MKTDDLRESQQVEDRRGQSSGSFGGGGLGGGLLLQLLFSRGGWKT
FT                   KLVILLLLLVMGGGGLSGVLGGKPSSTNNNAYQSSQVTRTNGDKASQEQVSFVSKVFAS
FT                   TEDYWTKTFREKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQKVYLDISFYNE
FT                   LSTKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASTRQGKSKAKANQLNVKLELQAD
FT                   YYAGAWANYVQGQGLLEKGDIEEAMAAAHAVGDDTLQEETYGRAVPDSFTHGTSKQRQR
FT                   WFDRGYQYGDFEHGDTFSIPYSKL"
FT   gene            630051..633266
FT                   /gene="rexB"
FT                   /locus_tag="MGAS9429_Spy0648"
FT   CDS_pept        630051..633266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexB"
FT                   /locus_tag="MGAS9429_Spy0648"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31836"
FT                   /db_xref="GOA:Q1JMH6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMH6"
FT                   /protein_id="ABF31836.1"
FT                   /translation="MKLIYTEMSYSMTEILVNEARKAADQGYRVFYIAPNSLSFEKERE
FT                   VLTLLPERGTFSIIVTRFVQMSRYFTVESSPSKQHLDDTTLAMIFYRALMQLKPEDLPS
FT                   YGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDHPQKQEDLIKIIELAETIMIQQDY
FT                   NQDSPLQSFARAIKLGLLNNQLSKTVIVIDGFSRFSAEEDYLLSLLNNNCQEVIIGSYV
FT                   SQKAYQKSFIKGNIYEASLHFLQDLAQKYHIKPVFATSNQVFKPAFSRLTQLFEATHDF
FT                   SQVDWQLQKNDLDHFSLWQCHHQKEEIEHVAKSIRQKLYEGYRYKDILVLLGDMDAYQL
FT                   QIGPIFDKFEIPYYLGKAEPMAAHPLVQFIESLERSQRYNWRREDILNMLKSGLFGCFD
FT                   DSDIDRFEEYTQFADIKGFTKFSKPFTINSSRQYPLDFLNEMRQDIVLPLQELFKSQKQ
FT                   LGASLIDKLILFLEKIRLAENMQGLAQSQLEVEKNEEVWKRFTDILTSFHHIFGQEKLR
FT                   LSDCLALIKTGMKSAQYRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHH
FT                   SGLLSDQERARINEIRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF
FT                   DDLSPYLKELINFGLPLLDKGKNYLSYDNSDIGNYKALLSQIIAINRQDLIEMSDQDKM
FT                   FWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKEVIEVCFPKGIPLKLSATALTVFYN
FT                   NQYNYFLKYVLNLNKTESIHPDSRIHGQYLHRVFERLMKDHTQEPFDNKLKQAIYHTNQ
FT                   ESFFQQVYQDNAEAEYSLAILEDIVRSTAPILQLNQNIKVIDQEKNFHLDMGNEILVHG
FT                   IIDRIDQLSDGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLAALKQIAPHDINQLFGA
FT                   MYLHLQDPKLDLVTFKQIDNTLVESIYKALTYKGIFSEVEKEHLSTGAYQTKNALYSND
FT                   ELETLLNYNKYLYLKAAKHIKKGHFLINPYTSDGKTVQGDQLKAITRFEADLDMAQARR
FT                   LVTLPAKEKKECFLTLMRKESRL"
FT   gene            633227..636895
FT                   /gene="rexA"
FT                   /locus_tag="MGAS9429_Spy0649"
FT   CDS_pept        633227..636895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="MGAS9429_Spy0649"
FT                   /product="ATP-dependent nuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31837"
FT                   /db_xref="GOA:Q1JMH5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMH5"
FT                   /protein_id="ABF31837.1"
FT                   /translation="MLFNINEKGEPLVISFAPFLSPEAIKHLQENERCSDQSQKRTAQQ
FT                   IEAIYTSGQNILVSASAGSGKTFVMVERILDKILRGVSIDRLFISTFTVKAATELRERI
FT                   ENKLYSQIAQTTDFQMKVYLTEQLQSLGQADIGTMDAFAQKVVSRYGYSIGISSQFRIM
FT                   QDKAEQDVLKQEVFSKLFSEFMNQKEAPVFRALVKNFSGNCKDTSAFRELVYTCYSFSQ
FT                   STENPKIWLQENFLSAAKTYQRLEDIPDHDIELLLLAMQDTANQLRDVTDMEDYGQLTK
FT                   AGSRSAKYTKHLTIIEKLSDWVRDFKCLYGKAGLDRLIRDVTGLIPSGNDVTVSKVKYP
FT                   VFKTLHQKLKQFRHLETILMYQKDCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIT
FT                   HFAIKILEENTDIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNGHNRFMVGDIKQSI
FT                   YRFRQADPQIFNQKFRDYQKKTEQGKVILLKENFRSQSEVLNVSNAVFSHLMDESVGDV
FT                   LYDEQHQLIAGSHAQTVPYLDRRAQLLLYNSDKDDGNAPSDSEGISFSEVTIVAKEIIK
FT                   LHNDKGVPFEDITLLVSSRTRNDIISHTFNQYGIPIVTDGGQQNYLKSVEVMVMLDTLR
FT                   TINNPRNDYALVALLRSPMFAFDEDDLARIALQKDNELDKDCLYDKIQRAVIGRGAHPE
FT                   LIHDTLLGKLNIFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYFDFVASQAKAEQAQANL
FT                   YALALRANQFEKSGYKGLYCFIKMIDKVLETQNDLADVEVAAPKQAVNLMTIHKSKGLQ
FT                   FPYVFILNCDKRFSMTDIHKSFILNRQHGIGIKYLADIKGLLGETTLNSVKVSMETLPY
FT                   QLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSKSQDITDPKKLGKLLPLALR
FT                   EQLLTFQDWLLAIADVFSTEDLYFDVRFIEDSDLTQESVGRLQTPQLLNPDDLKDNRQS
FT                   ETIARALDMLEAVSQLNANYEAAIHLPTVRTPSQLKAAYEPLLEPIGVDIIEKSSRSLS
FT                   DFTLPHFSKKVKVEASHIGSALHQLMQVLPLSKPINQQTLLDALREIDSNEEVKTALDL
FT                   KKIESFFCDTSLGQFFQTYQKHLYREAPFAILKVDPISQEEYVLRGIIDAYFLFDDHIV
FT                   LVDYKTDKYKQPIELKKRYQQQLELYAEALTQTYKLPVTKRYLVLMGGGKPEIVEV"
FT   gene            637011..637847
FT                   /locus_tag="MGAS9429_Spy0650"
FT   CDS_pept        637011..637847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0650"
FT                   /product="arginine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31838"
FT                   /db_xref="GOA:Q1JMH4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH4"
FT                   /protein_id="ABF31838.1"
FT                   /translation="MTKRNKYTMNFKKIRFGFLLCLLLYPLAACNKSEQLNHYERIKKT
FT                   RKLVVAVSPDYAPFEFKALVNGKDTIVGADVQLAQAIADELDVDLELSPMSFDNVLSSL
FT                   QTGKADLAISGISHTKERAKVYDFSIPYYQAENAIVMRASDAKVTKNISDLNGKKVAAQ
FT                   KGSIEEGLVKIQLPKANLISLTAMGEAINELKAGQVYAVTLEAPVAAGFLAQHKDLALA
FT                   PFSLKTSDGDAKAVALPKNSGDLTKAVNKVIAKLDEQERYKSFIAETIALTKNTMK"
FT   gene            637952..638164
FT                   /locus_tag="MGAS9429_Spy0651"
FT   CDS_pept        637952..638164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0651"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31839"
FT                   /db_xref="GOA:Q1JMH3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMH3"
FT                   /protein_id="ABF31839.1"
FT                   /translation="MKMLQYLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESR
FT                   KREFYEKPSVKRKRKSEAARKRKKF"
FT   gene            complement(638292..638654)
FT                   /gene="mscL"
FT                   /locus_tag="MGAS9429_Spy0652"
FT   CDS_pept        complement(638292..638654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="MGAS9429_Spy0652"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31840"
FT                   /db_xref="GOA:Q1JMH2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH2"
FT                   /protein_id="ABF31840.1"
FT                   /translation="MVKELKAFLFRGNIIELAVAVIIGGAFGAIVTSFVNDIITPLILN
FT                   PALKAANVENITQLSWNGVKYGSFLGAVINFLIIGTSLFFVVKAAEKAMPKKEKEAAAP
FT                   TQEELLTEIRDLLAQK"
FT   gene            638784..640598
FT                   /gene="dnaG"
FT                   /locus_tag="MGAS9429_Spy0653"
FT   CDS_pept        638784..640598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="MGAS9429_Spy0653"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31841"
FT                   /db_xref="GOA:Q1JMH1"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH1"
FT                   /protein_id="ABF31841.1"
FT                   /translation="MGFLWGGDDLAIDKEMISQVKNSVNIVDVIGEVVKLSRSGRHYLG
FT                   LCPFHKEKTPSFNVVEDRQFFHCFGCGKSGDVFKFIEEYRQVPFLESVQIIADKTGMSL
FT                   NIPPSQAVLASQHKHPNHALMTLHEDAAKFYHAVLMTTTIGQEARKYLYQRGLDDQLIE
FT                   HFNIGLAPDESDYLYQALSKKYEEGQLVASGLFNLSDQSNTIYDAFRNRIMFPLSDDRG
FT                   HIIAFSGRIWTAADMEKRQAKYKNSRGTVLFNKSYELYHLDKARPVIAKTHEVFLMEGF
FT                   MDVIAAYRSGYENAVASMGTALTQEHVNHLKQVTKKVVLIYDGDDAGQHAIAKSLELLK
FT                   DFVVEIVRIPNKMDPDEFVQRHSPEAFADLLKQSRISSVEFFIDYLKPTNVDNLQSQIV
FT                   YVEKMAPLIAQSPSITAQHSYINKIADLLPNFDYFQVEQSVNALRIQDRQKRQGQIAQA
FT                   VSNLVTLPIPKSLTAIAKTESHLMHRLLHHDYLLNEFRHRDDFYFDTSTLEILYQRLKQ
FT                   QGYITSYDLSEMSEEINRAYYNVLEENLPKEVALGEIDDILSKRAKLLAERDLHKQGKK
FT                   VRESSNKGDHQAALEVLEHFIAQKRKME"
FT   gene            640607..641716
FT                   /gene="rpoD"
FT                   /locus_tag="MGAS9429_Spy0654"
FT   CDS_pept        640607..641716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="MGAS9429_Spy0654"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31842"
FT                   /db_xref="GOA:Q1JMH0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMH0"
FT                   /protein_id="ABF31842.1"
FT                   /translation="MTKQKEITTFNVQVAEFIRHHKKEGTAIDDDVTEKLVIPFALDAD
FT                   QIDDLLERLTDGGISITDKEGNPSSKYIVEEPKPEELTDEELIGSNSAKVNDPVRMYLK
FT                   EIGVVPLLTSEEEKELAVAVAKGDLMAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQE
FT                   GNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVRE
FT                   QRNLLQELGQDPTPEQIAERMEMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIED
FT                   EVIENPVDYTTRVVLREQLDEVLDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTR
FT                   ERIRQIEAKALRKLRHPSRSKQLRDFIED"
FT   gene            641952..642290
FT                   /locus_tag="MGAS9429_Spy0655"
FT   CDS_pept        641952..642290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0655"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31843"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG9"
FT                   /protein_id="ABF31843.1"
FT                   /translation="MSDTPKYTQDQVIAIKNRILEALETVIDPELGIDVVNLGLIYEIR
FT                   FNDNGYTEIDMTLTTMGCPLADLLTDYIHDALQDVPEVTKTEVKLVWYPAWTVDKMSRY
FT                   ARIALGIR"
FT   gene            642368..643282
FT                   /gene="rmlD"
FT                   /locus_tag="MGAS9429_Spy0656"
FT   CDS_pept        642368..643282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="MGAS9429_Spy0656"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31844"
FT                   /db_xref="GOA:Q1JMG8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG8"
FT                   /protein_id="ABF31844.1"
FT                   /translation="MLENTKILRKVFYLWQKGELMILITGSNGQLGTELRYLLDERGVD
FT                   YVAVDVAEMDITNEDKVEAVFAQVKPTLVYHCAAYTAVDAAEDEGKALNEAINVTGSEN
FT                   IAKACGKYGATLVYISTDYVFDGNKPVGQEWVETDRPDPKTEYGRTKRLGELAVERYAE
FT                   HFYIIRTAWVFGNYGKNFVFTMEQLAENHSRLTVVNDQHGRPTWTRTLAEFMCYLTENQ
FT                   KAFGYYHLSNDAKEDTTWYDFAKEILKDKAVEVVPVDSSAFPAKAKRPLNSTMNLDKAK
FT                   ATGFVIPTWQEALKAFYQQGLKK"
FT   gene            643401..644555
FT                   /gene="rgpAc"
FT                   /locus_tag="MGAS9429_Spy0657"
FT   CDS_pept        643401..644555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpAc"
FT                   /locus_tag="MGAS9429_Spy0657"
FT                   /product="alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31845"
FT                   /db_xref="GOA:Q1JMG7"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG7"
FT                   /protein_id="ABF31845.1"
FT                   /translation="MQDVFIIGSRGLPAKYGGFETFVEELISHQSSKNIRYHVACLSDT
FT                   KHKVHFDYKGADCFYLNPPKLGPARVIAYDMMAITYALSYSDQHQIQNPIFYVLGNTVG
FT                   AFIAPFVKQIHNRGGRFFINPDGLEWKRSKWSKPVQAYLKFSEKQMTRQADLVISDNIG
FT                   IDRYLKQVYPWSKTCFIAYGTQTQPSRLTTADSKVRAYFQTFDIREKDYYLILGRFVPE
FT                   NNYETAIKEFMASSTKRDLVIICNHEDNAYFKQLLAETECDKDPRIKFVGTLYDKELLA
FT                   YIREQAYAYIHGHEVGGTNPGLLEALAHTNLNLVLGVDFNQSVAKSAALYWSKQKGQLA
FT                   ELINQVDAGFDSDRLGKEAKAIIQEHYTWEKIVGEYEALFLNEH"
FT   gene            644545..645477
FT                   /gene="rgpBc"
FT                   /locus_tag="MGAS9429_Spy0658"
FT   CDS_pept        644545..645477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpBc"
FT                   /locus_tag="MGAS9429_Spy0658"
FT                   /product="alpha-L-Rha alpha-1,3-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31846"
FT                   /db_xref="GOA:Q1JMG6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG6"
FT                   /protein_id="ABF31846.1"
FT                   /translation="MNINILLSTYNGERFLAEQIQSIQRQTVNDWTLLIRDDGSTDGTQ
FT                   DIIRTFVKEDKRIQWINEGQTENLGVIKNFYTLLKHQKADVYFFSDQDDIWLDNKLEVT
FT                   LLEAQKHEMTAPLLVYTDLKVVTQHLAICHDSMIKTQSGHANTSLLQELTENTVTGGTM
FT                   MITHALAEEWTTCDGLLMHDWYLALLASATGKLVYLDIPTELYRQHDANVLGARTWSKR
FT                   MKNWLTPHHLVNKYWWLITSSQKQAQLLLDLPLKPNDHELVTAYVSLLDMPFTKRLATL
FT                   KRYGFRKNRIFHTFIFRSLVVTLFGYRRK"
FT   gene            645446..645541
FT                   /locus_tag="MGAS9429_Spy0659"
FT   CDS_pept        645446..645541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31847"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG5"
FT                   /protein_id="ABF31847.1"
FT                   /translation="MLPYLVTGESKNEFFNKEKPYFTERNGKNGF"
FT   gene            645480..646283
FT                   /gene="rgpCc"
FT                   /locus_tag="MGAS9429_Spy0660"
FT   CDS_pept        645480..646283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpCc"
FT                   /locus_tag="MGAS9429_Spy0660"
FT                   /product="polysaccharide export ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31848"
FT                   /db_xref="GOA:Q1JMG4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG4"
FT                   /protein_id="ABF31848.1"
FT                   /translation="MNFLTKKNRILLREMVKTDFKLRYQGSAIGYLWSILKPLMMFTIM
FT                   YLVFIRFLRLGGNVPHFPVALLLANVIWSFFSEATSMGMVSIVSRGDLLRKLNFSKHII
FT                   VFSAVLGALINFLINLVVVLIFALINGVTISGYAYLSLFLFIELVVLVLGIALLLSNVF
FT                   VYYRDLAQVWEVLLQAGMYATPIIYPITFVLDSHPLAAKLLMLNPVAQMIQDFRYLLID
FT                   RANVTIWQMSTNWFYVVIPYLVPFVILFIGIFVFKKNADRFAEII"
FT   gene            646283..647488
FT                   /gene="rgpDc"
FT                   /locus_tag="MGAS9429_Spy0661"
FT   CDS_pept        646283..647488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpDc"
FT                   /locus_tag="MGAS9429_Spy0661"
FT                   /product="polysaccharide export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31849"
FT                   /db_xref="GOA:Q1JMG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG3"
FT                   /protein_id="ABF31849.1"
FT                   /translation="MINREIAVKVQHVSKTFKLPTEATKSFRTTLVNRLRGIKGFTEQH
FT                   VLKDINFDVYKGDFFGIVGRNGSGKSTLLKIISQIYVPEKGQVTVDGKMVSFIELGVGF
FT                   NPELTGRENVYMNGAMLGFTKDEVDDMYNDIVDFAELHHFMNQKLKNYSSGMQVRLAFS
FT                   VAIKAQGDVLILDEVLAVGDEAFQRKCNDYFMERKDSGKTTILVTHDMGAVKKYCNRAV
FT                   LIEDGLVKAYGEPFDVANQYSVDNTETAEDAMNAEKISVSDIAKDLKVSLISNPRITPN
FT                   DTITFEVSYEVLKDDFTYIAFSLTDIDRNIWVYNDNSLDYPTQGIGRKCISYQCQLSQL
FT                   NDIKLKLEVTVRDKNGQMLLFSTAEQSPQIVIQRNDIDQDDLSALDSASGLYQRNGKWV
FT                   FH"
FT   gene            647513..648520
FT                   /gene="rgpEc"
FT                   /locus_tag="MGAS9429_Spy0662"
FT   CDS_pept        647513..648520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpEc"
FT                   /locus_tag="MGAS9429_Spy0662"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31850"
FT                   /db_xref="GOA:Q1JMG2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG2"
FT                   /protein_id="ABF31850.1"
FT                   /translation="MYKVSIICTNYNKAPWISDALDSFLSQVTDFEVEIIVIDDASTDD
FT                   SREILKSYQKKSSGKIKLLFNETNIGITKTWIKACLYAKGKYIARCDGDDYWTDSFKLQ
FT                   KQVDVLEASKRSRWCNTDFDFVNSQGDLLYANAFSSGHTPLTDTYEKVLALKGMTMAST
FT                   WLVDADLMRQVNQKINVDTPDDTFDIQLELFQLTQLTYIKDSTTVYRMTTDSDSRPTDT
FT                   PKMIHRIQKLLDTQLNYLKKYNQVDTKEMSELLLQQDAKQEIRIHELSCFIQELQQTIV
FT                   DKTKQQETREVELQNVIEEQKNQLSELRQQYHAIINSRQWKYTSKLIAFIRRKK"
FT   gene            648517..650262
FT                   /gene="rgpFc"
FT                   /locus_tag="MGAS9429_Spy0663"
FT   CDS_pept        648517..650262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpFc"
FT                   /locus_tag="MGAS9429_Spy0663"
FT                   /product="alpha-L-Rha alpha-1,2-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="alpha-L-Rha alpha-1,3-L-rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31851"
FT                   /db_xref="GOA:Q1JMG1"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG1"
FT                   /protein_id="ABF31851.1"
FT                   /translation="MNRILLYVHFNKYNKISAHVYYQLEQMRSLFSKIVFISNSKVSHE
FT                   DLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLITMGFDKLEEFDSLTIMNDTCFGPIWEM
FT                   APYFENFEEKETVDFWGITNNRGTKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYE
FT                   NVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSFMPHPDFSYYNPTAILKHHVPFI
FT                   KVKAIDANQHIAPYLLNLIRETTNYPIDLIVSHMSQISLPDAKYLLSQKYLNCQRLAKQ
FT                   TCQKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADI
FT                   RVTGNRGRDIYPMLLLKDKLSQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKPADS
FT                   ILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDT
FT                   FVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLVYIAWGNSYDFR
FT                   IVKNPYELTPFIDNKLLNLREDEGAHTYVNFNQMGGIKGALKYIIVGPAKAMKYIFLRL
FT                   MEKLK"
FT   gene            650259..652733
FT                   /locus_tag="MGAS9429_Spy0664"
FT   CDS_pept        650259..652733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0664"
FT                   /product="phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31852"
FT                   /db_xref="GOA:Q1JMG0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMG0"
FT                   /protein_id="ABF31852.1"
FT                   /translation="MIKDTFLKTNWLNISHHITLLVFGFYFSFYSLAKELVSSTAQPVN
FT                   YYTHLLNVSFVGYIISLIGLSYYLSRQVSRQLFLKTSFIVISYLIVSYWVQITQHLNDK
FT                   RFDIWSLTKNQFYQFQALPSLLIILVMATLIKILVAYFAIEKDRFGLLGYQGNTFSVAL
FT                   ILAVVPINDIHLLKLISSRFSELVRAGNSQIALLKISGLLIVLLVIFATIIYVVLNALK
FT                   HLKSNKLSFSVAATTSLFLALVFNYTFQYGVKGDEALLGYYVFPGATLFQIVAITLVAI
FT                   LAYVITNRYWPTTFFLLILGTIISVVNDLKESMRSEPLLVTDFVWLQELGLVTSFVKKS
FT                   VIVEMVVGLAICIVVAWYLHGRVLAGKLFMSPVKRASAVLGLFIVSCSMLIPFSYEKEG
FT                   KILSGLPIISALNNDNDINWLGFSTNARYKSLAYVWTRQVTKKIMEKPTNYSQETIASI
FT                   AQKYQKLAEDINKDRKNNIADQTVIYLLSESLSDPDRVSNVTVSHDVLPNIKAIKNSTT
FT                   AGLMQSDSYGGGTANMEFQTLTSLPFYNFSSSVSVLYSEVFPKMAKPHTISEFYQGKNR
FT                   IAMHPASANNFNRKTVYSNLGFSKFLALSGSKDKFKNIENVGLLTSDKTVYNNILSLIN
FT                   PSESQFFSVITMQNHIPWSSDYPEEIVAEGKNFTEEENHNLTSYARLLSFTDKETRAFL
FT                   EKLTQINKPITVVFYGDHLPGLYPDSAFNKHIENKYLTDYFIWSNGTNEKKNHPLINSS
FT                   DFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEVKAIQNDLKNVQYDVTIGKGY
FT                   LLKHKTFFKISR"
FT   gene            652912..653607
FT                   /locus_tag="MGAS9429_Spy0665"
FT   CDS_pept        652912..653607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0665"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31853"
FT                   /db_xref="GOA:Q1JMF9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMF9"
FT                   /protein_id="ABF31853.1"
FT                   /translation="MKKLIIIPAYNESSNIVNTIRTIESDASDFDYIIIDDCSTDNTLA
FT                   ICQKQGFNVISLPINLGIGGAVQTGYRYAQRCGYDVAVQVDGDGQHNPCYLEKMVEVLV
FT                   QSSVNMVIGSRFITKEGFQSSFARRIGIKYFTWLIALLTGKKITDATSGLRLIDRSLIE
FT                   RFANHYPDDYPEPETVVDVLVSHFKVKEIPVVMNERQGGVSSISLTKSVYYMIKVTLAI
FT                   LVVRLKGNR"
FT   gene            653609..653950
FT                   /locus_tag="MGAS9429_Spy0666"
FT   CDS_pept        653609..653950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31854"
FT                   /db_xref="GOA:Q1JMF8"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMF8"
FT                   /protein_id="ABF31854.1"
FT                   /translation="MTVTASLFISFIVLTFVFFLINLIKKDKLAIKYSLLWFILALLIL
FT                   LFTWLPNILNKMSHFLGIHSPTNMLFFLGFCLSLAIIFSLTNNISLQNDKVKRLTQEVA
FT                   LMKKEKTND"
FT   gene            653943..655229
FT                   /gene="amrA"
FT                   /locus_tag="MGAS9429_Spy0667"
FT   CDS_pept        653943..655229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amrA"
FT                   /locus_tag="MGAS9429_Spy0667"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31855"
FT                   /db_xref="GOA:Q1JMF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMF7"
FT                   /protein_id="ABF31855.1"
FT                   /translation="MINPSKQNQTIFLWNMLGSLSTAVISVILLMVVTRLLTSADSDIY
FT                   AFAYSFANMMVVVGLFQVRNYQATDINEKYSFSQYLVARLMTCLLMLAITVIYLTLTKT
FT                   DSYKSTIVFLVCFYRSTDAFSDLYQGMFQQHERLDIAGKSLAYRNTLIFMVYTAIILYS
FT                   KNLTLALVAVCIVSLVFIMYYDIGYSKKFQKLMFSELLSNISFQNSLKLLKESFPLFLN
FT                   GFLIIYIYTQPKYAIELMTTLGEVALGSQTIFNILFMPAFVMNLLILFFRPYITQMAIA
FT                   LIRGQIKEFNKIQVQLFAYLGVFSLIALVGSGLFGIPFLSMLYGTNLTDYWVDFMLIML
FT                   GGSIGSFATVIDNILTAMRKQQLLLIPYTGGFLISLLITNLFVMKYHILGAALSFLITM
FT                   LVWLGLSIMIYLFIMNRFKKGRVNATIYD"
FT   gene            655210..656706
FT                   /locus_tag="MGAS9429_Spy0668"
FT   CDS_pept        655210..656706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS9429_Spy0668"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31856"
FT                   /db_xref="GOA:Q1JMF6"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JMF6"
FT                   /protein_id="ABF31856.1"
FT                   /translation="MQQSMTKVKYLWKENNNYIYSTFLTLLLTVILYANSLNLPLKFIS
FT                   LLFVVSTLLIVFLPKKLEVATIIFILVFGTISAIISPINDIPDEYVHYSRTVYISEGDI
FT                   NLTNNNKKLRISKDVDKLIKQSGKTFITSNLKATKHSTREYSYPYIKGTNAYYSFSYIP
FT                   QALGILVGNALDLPILLTYYFGRLCNLISYAMLAFIAIKLSGSFKQVIAVVTLLPMNIY
FT                   LAASFNQDGFAIGLVLVTIGLFINLLSSKDKSNYNTKFFLYLVLCGLLVLSKFTYFLLV
FT                   CLPLFIPNEKFGKNTKLVILKKLGGLLLIFLFAAMWFRLYGQVKTPYVADFLKEVNVSQ
FT                   QVKNMLESPIVYSSIIIRHMVINLINMNNIFQFGALSYGITNLFPLYVCFFFFVYISNA
FT                   SKITINIVEKMGIIFVISAIIGATVLAMYLTWTPVGSSTVLGVQSRYLIGIIPLVLLLF
FT                   SSQQQKFKQIEDILSDKLAIHVSLLFILAMLMSTIFRYYH"
FT   gene            656788..658023
FT                   /gene="pepT"
FT                   /locus_tag="MGAS9429_Spy0669"
FT   CDS_pept        656788..658023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="MGAS9429_Spy0669"
FT                   /product="tripeptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS9429_Spy0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF31857"
FT                   /db_xref="GOA:Q1JMF5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1JMF5"
FT                   /protein_id="ABF31857.1"
FT                   /translation="MRWPMKYDNLLDRFIKYVKVNTRSDPDSETTPSTESQEAFALTIL
FT                   KPEMEAIGLQDVHYNPVNGYLIGTLPANNPTLTRKIGFIAHMDTADFNAENVNPQIIDN
FT                   YQGGDITLGSSNYKLDPKAFPNLNNYIGQTLITTDGTTLLGADDKSGIAEIMTAIEFLT
FT                   SQPQIEHCDIKVAFGPDEEIGVGADKFEVADFEVDFAYTMDGGPLGELQYETFSAAALE
FT                   VTFLGRNVHPGTAKDQMINALELAIDFHEKLPAKERPEYTDGYQGFYHLTGLTGTVEEA
FT                   RASYIIRDFEEASFEARKVKVENIAQSMNAHLGTKRVLVELNDQYYNMKKVIEKDMTAI
FT