(data stored in ACNUC7421 zone)

EMBL: CP000262

ID   CP000262; SV 1; circular; genomic DNA; STD; PRO; 1937111 BP.
XX
AC   CP000262;
XX
PR   Project:PRJNA16366;
XX
DT   08-MAY-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Streptococcus pyogenes MGAS10750, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes MGAS10750
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
OS   Streptococcus phage 10750.1
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 10750.2
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 10750.3
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
OS   Streptococcus phage 10750.4
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-1937111
RX   DOI; 10.1073/pnas.0510279103.
RX   PUBMED; 16636287.
RA   Beres S.B., Richter E.W., Nagiec M.J., Sumby P., Porcella S.F., DeLeo F.R.,
RA   Musser J.M.;
RT   "Molecular genetic anatomy of inter- and intraserotype variation in the
RT   human bacterial pathogen group A Streptococcus";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(18):7059-7064(2006).
XX
RN   [2]
RP   1-1937111
RA   Beres S.B., Porcella S.F., Sumby P., Richter E.W., Barbian K.D.,
RA   DeLeo F.R., Musser J.M.;
RT   ;
RL   Submitted (06-FEB-2006) to the INSDC.
RL   Laboratory of Human Bacterial Pathogenesis, Rocky Mountain Laboratories,
RL   National Institute of Allergy and Infectious Disease, National Institutes
RL   of Health, 903 S. 4th Street, Hamilton, MT 59840, USA
XX
DR   MD5; d58f0ea01df9b8ecb54c1cdc370a32f0.
DR   BioSample; SAMN02603504.
DR   EnsemblGenomes-Gn; EBG00001051110.
DR   EnsemblGenomes-Gn; EBG00001051111.
DR   EnsemblGenomes-Gn; EBG00001051112.
DR   EnsemblGenomes-Gn; EBG00001051113.
DR   EnsemblGenomes-Gn; EBG00001051114.
DR   EnsemblGenomes-Gn; EBG00001051115.
DR   EnsemblGenomes-Gn; EBG00001051116.
DR   EnsemblGenomes-Gn; EBG00001051117.
DR   EnsemblGenomes-Gn; EBG00001051118.
DR   EnsemblGenomes-Gn; EBG00001051119.
DR   EnsemblGenomes-Gn; EBG00001051120.
DR   EnsemblGenomes-Gn; EBG00001051121.
DR   EnsemblGenomes-Gn; EBG00001051122.
DR   EnsemblGenomes-Gn; EBG00001051123.
DR   EnsemblGenomes-Gn; EBG00001051124.
DR   EnsemblGenomes-Gn; EBG00001051125.
DR   EnsemblGenomes-Gn; EBG00001051126.
DR   EnsemblGenomes-Gn; EBG00001051127.
DR   EnsemblGenomes-Gn; EBG00001051128.
DR   EnsemblGenomes-Gn; EBG00001051129.
DR   EnsemblGenomes-Gn; EBG00001051130.
DR   EnsemblGenomes-Gn; EBG00001051131.
DR   EnsemblGenomes-Gn; EBG00001051132.
DR   EnsemblGenomes-Gn; EBG00001051133.
DR   EnsemblGenomes-Gn; EBG00001051134.
DR   EnsemblGenomes-Gn; EBG00001051135.
DR   EnsemblGenomes-Gn; EBG00001051136.
DR   EnsemblGenomes-Gn; EBG00001051137.
DR   EnsemblGenomes-Gn; EBG00001051138.
DR   EnsemblGenomes-Gn; EBG00001051139.
DR   EnsemblGenomes-Gn; EBG00001051140.
DR   EnsemblGenomes-Gn; EBG00001051141.
DR   EnsemblGenomes-Gn; EBG00001051142.
DR   EnsemblGenomes-Gn; EBG00001051143.
DR   EnsemblGenomes-Gn; EBG00001051144.
DR   EnsemblGenomes-Gn; EBG00001051145.
DR   EnsemblGenomes-Gn; EBG00001051146.
DR   EnsemblGenomes-Gn; EBG00001051147.
DR   EnsemblGenomes-Gn; EBG00001051148.
DR   EnsemblGenomes-Gn; EBG00001051149.
DR   EnsemblGenomes-Gn; EBG00001051150.
DR   EnsemblGenomes-Gn; EBG00001051151.
DR   EnsemblGenomes-Gn; EBG00001051152.
DR   EnsemblGenomes-Gn; EBG00001051153.
DR   EnsemblGenomes-Gn; EBG00001051154.
DR   EnsemblGenomes-Gn; EBG00001051155.
DR   EnsemblGenomes-Gn; EBG00001051156.
DR   EnsemblGenomes-Gn; EBG00001051157.
DR   EnsemblGenomes-Gn; EBG00001051158.
DR   EnsemblGenomes-Gn; EBG00001051159.
DR   EnsemblGenomes-Gn; EBG00001051160.
DR   EnsemblGenomes-Gn; EBG00001051161.
DR   EnsemblGenomes-Gn; EBG00001051162.
DR   EnsemblGenomes-Gn; EBG00001051163.
DR   EnsemblGenomes-Gn; EBG00001051164.
DR   EnsemblGenomes-Gn; EBG00001051165.
DR   EnsemblGenomes-Gn; EBG00001051166.
DR   EnsemblGenomes-Gn; EBG00001051167.
DR   EnsemblGenomes-Gn; EBG00001051168.
DR   EnsemblGenomes-Gn; EBG00001051169.
DR   EnsemblGenomes-Gn; EBG00001051170.
DR   EnsemblGenomes-Gn; EBG00001051171.
DR   EnsemblGenomes-Gn; EBG00001051172.
DR   EnsemblGenomes-Gn; EBG00001051173.
DR   EnsemblGenomes-Gn; EBG00001051174.
DR   EnsemblGenomes-Gn; EBG00001051175.
DR   EnsemblGenomes-Gn; EBG00001051176.
DR   EnsemblGenomes-Gn; EBG00001051177.
DR   EnsemblGenomes-Gn; EBG00001051178.
DR   EnsemblGenomes-Gn; EBG00001051179.
DR   EnsemblGenomes-Gn; EBG00001051180.
DR   EnsemblGenomes-Gn; EBG00001051181.
DR   EnsemblGenomes-Gn; EBG00001051182.
DR   EnsemblGenomes-Gn; EBG00001051183.
DR   EnsemblGenomes-Gn; EBG00001051184.
DR   EnsemblGenomes-Gn; EBG00001051185.
DR   EnsemblGenomes-Gn; EBG00001051186.
DR   EnsemblGenomes-Gn; EBG00001051187.
DR   EnsemblGenomes-Gn; EBG00001051188.
DR   EnsemblGenomes-Gn; EBG00001051189.
DR   EnsemblGenomes-Gn; EBG00001051190.
DR   EnsemblGenomes-Gn; EBG00001051191.
DR   EnsemblGenomes-Gn; EBG00001051192.
DR   EnsemblGenomes-Gn; EBG00001051193.
DR   EnsemblGenomes-Gn; EBG00001051194.
DR   EnsemblGenomes-Gn; EBG00001051195.
DR   EnsemblGenomes-Gn; EBG00001051196.
DR   EnsemblGenomes-Gn; EBG00001051197.
DR   EnsemblGenomes-Gn; EBG00001051198.
DR   EnsemblGenomes-Gn; EBG00001051199.
DR   EnsemblGenomes-Gn; EBG00001051200.
DR   EnsemblGenomes-Gn; EBG00001051201.
DR   EnsemblGenomes-Gn; EBG00001051202.
DR   EnsemblGenomes-Gn; EBG00001051203.
DR   EnsemblGenomes-Gn; EBG00001051204.
DR   EnsemblGenomes-Gn; EBG00001051205.
DR   EnsemblGenomes-Gn; EBG00001051206.
DR   EnsemblGenomes-Gn; EBG00001051207.
DR   EnsemblGenomes-Gn; EBG00001051208.
DR   EnsemblGenomes-Gn; EBG00001051209.
DR   EnsemblGenomes-Gn; EBG00001051210.
DR   EnsemblGenomes-Gn; EBG00001051211.
DR   EnsemblGenomes-Gn; EBG00001051212.
DR   EnsemblGenomes-Gn; EBG00001051213.
DR   EnsemblGenomes-Gn; EBG00001051214.
DR   EnsemblGenomes-Gn; EBG00001051215.
DR   EnsemblGenomes-Gn; EBG00001051216.
DR   EnsemblGenomes-Gn; EBG00001051217.
DR   EnsemblGenomes-Gn; EBG00001051218.
DR   EnsemblGenomes-Gn; EBG00001051219.
DR   EnsemblGenomes-Gn; EBG00001051220.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02225.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02226.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02227.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02228.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02229.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02230.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02231.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02232.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02233.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02234.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02235.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02236.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02237.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02238.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02239.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02240.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02241.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02242.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02243.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02244.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02245.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02246.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02247.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02248.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02249.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02250.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02251.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02252.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02253.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02254.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02255.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02256.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02257.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02258.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02259.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02260.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02261.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02262.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02263.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02264.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02265.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02266.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02267.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02268.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02269.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02270.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02271.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02272.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02273.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02274.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02275.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02276.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02277.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02278.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02279.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02280.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02281.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02282.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02283.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02284.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02285.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02286.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02287.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02288.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02289.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02290.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02291.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02292.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02293.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02294.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02295.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02296.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02297.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02298.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02299.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02300.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02301.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02302.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02303.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02304.
DR   EnsemblGenomes-Gn; MGAS10750_SpyR02305.
DR   EnsemblGenomes-Tr; EBT00001654521.
DR   EnsemblGenomes-Tr; EBT00001654523.
DR   EnsemblGenomes-Tr; EBT00001654524.
DR   EnsemblGenomes-Tr; EBT00001654526.
DR   EnsemblGenomes-Tr; EBT00001654527.
DR   EnsemblGenomes-Tr; EBT00001654528.
DR   EnsemblGenomes-Tr; EBT00001654530.
DR   EnsemblGenomes-Tr; EBT00001654531.
DR   EnsemblGenomes-Tr; EBT00001654533.
DR   EnsemblGenomes-Tr; EBT00001654535.
DR   EnsemblGenomes-Tr; EBT00001654536.
DR   EnsemblGenomes-Tr; EBT00001654537.
DR   EnsemblGenomes-Tr; EBT00001654539.
DR   EnsemblGenomes-Tr; EBT00001654540.
DR   EnsemblGenomes-Tr; EBT00001654541.
DR   EnsemblGenomes-Tr; EBT00001654542.
DR   EnsemblGenomes-Tr; EBT00001654544.
DR   EnsemblGenomes-Tr; EBT00001654545.
DR   EnsemblGenomes-Tr; EBT00001654546.
DR   EnsemblGenomes-Tr; EBT00001654547.
DR   EnsemblGenomes-Tr; EBT00001654548.
DR   EnsemblGenomes-Tr; EBT00001654550.
DR   EnsemblGenomes-Tr; EBT00001654551.
DR   EnsemblGenomes-Tr; EBT00001654552.
DR   EnsemblGenomes-Tr; EBT00001654554.
DR   EnsemblGenomes-Tr; EBT00001654555.
DR   EnsemblGenomes-Tr; EBT00001654556.
DR   EnsemblGenomes-Tr; EBT00001654557.
DR   EnsemblGenomes-Tr; EBT00001654558.
DR   EnsemblGenomes-Tr; EBT00001654559.
DR   EnsemblGenomes-Tr; EBT00001654560.
DR   EnsemblGenomes-Tr; EBT00001654561.
DR   EnsemblGenomes-Tr; EBT00001654562.
DR   EnsemblGenomes-Tr; EBT00001654563.
DR   EnsemblGenomes-Tr; EBT00001654564.
DR   EnsemblGenomes-Tr; EBT00001654565.
DR   EnsemblGenomes-Tr; EBT00001654566.
DR   EnsemblGenomes-Tr; EBT00001654567.
DR   EnsemblGenomes-Tr; EBT00001654568.
DR   EnsemblGenomes-Tr; EBT00001654569.
DR   EnsemblGenomes-Tr; EBT00001654570.
DR   EnsemblGenomes-Tr; EBT00001654571.
DR   EnsemblGenomes-Tr; EBT00001654572.
DR   EnsemblGenomes-Tr; EBT00001654573.
DR   EnsemblGenomes-Tr; EBT00001654574.
DR   EnsemblGenomes-Tr; EBT00001654575.
DR   EnsemblGenomes-Tr; EBT00001654576.
DR   EnsemblGenomes-Tr; EBT00001654577.
DR   EnsemblGenomes-Tr; EBT00001654578.
DR   EnsemblGenomes-Tr; EBT00001654579.
DR   EnsemblGenomes-Tr; EBT00001654580.
DR   EnsemblGenomes-Tr; EBT00001654581.
DR   EnsemblGenomes-Tr; EBT00001654582.
DR   EnsemblGenomes-Tr; EBT00001654583.
DR   EnsemblGenomes-Tr; EBT00001654584.
DR   EnsemblGenomes-Tr; EBT00001654585.
DR   EnsemblGenomes-Tr; EBT00001654586.
DR   EnsemblGenomes-Tr; EBT00001654587.
DR   EnsemblGenomes-Tr; EBT00001654588.
DR   EnsemblGenomes-Tr; EBT00001654589.
DR   EnsemblGenomes-Tr; EBT00001654590.
DR   EnsemblGenomes-Tr; EBT00001654591.
DR   EnsemblGenomes-Tr; EBT00001654592.
DR   EnsemblGenomes-Tr; EBT00001654593.
DR   EnsemblGenomes-Tr; EBT00001654594.
DR   EnsemblGenomes-Tr; EBT00001654595.
DR   EnsemblGenomes-Tr; EBT00001654596.
DR   EnsemblGenomes-Tr; EBT00001654597.
DR   EnsemblGenomes-Tr; EBT00001654598.
DR   EnsemblGenomes-Tr; EBT00001654599.
DR   EnsemblGenomes-Tr; EBT00001654600.
DR   EnsemblGenomes-Tr; EBT00001654601.
DR   EnsemblGenomes-Tr; EBT00001654602.
DR   EnsemblGenomes-Tr; EBT00001654603.
DR   EnsemblGenomes-Tr; EBT00001654604.
DR   EnsemblGenomes-Tr; EBT00001654605.
DR   EnsemblGenomes-Tr; EBT00001654606.
DR   EnsemblGenomes-Tr; EBT00001654607.
DR   EnsemblGenomes-Tr; EBT00001654608.
DR   EnsemblGenomes-Tr; EBT00001654609.
DR   EnsemblGenomes-Tr; EBT00001654610.
DR   EnsemblGenomes-Tr; EBT00001654611.
DR   EnsemblGenomes-Tr; EBT00001654612.
DR   EnsemblGenomes-Tr; EBT00001654613.
DR   EnsemblGenomes-Tr; EBT00001654614.
DR   EnsemblGenomes-Tr; EBT00001654615.
DR   EnsemblGenomes-Tr; EBT00001654616.
DR   EnsemblGenomes-Tr; EBT00001654617.
DR   EnsemblGenomes-Tr; EBT00001654618.
DR   EnsemblGenomes-Tr; EBT00001654619.
DR   EnsemblGenomes-Tr; EBT00001654620.
DR   EnsemblGenomes-Tr; EBT00001654621.
DR   EnsemblGenomes-Tr; EBT00001654622.
DR   EnsemblGenomes-Tr; EBT00001654623.
DR   EnsemblGenomes-Tr; EBT00001654624.
DR   EnsemblGenomes-Tr; EBT00001654625.
DR   EnsemblGenomes-Tr; EBT00001654626.
DR   EnsemblGenomes-Tr; EBT00001654627.
DR   EnsemblGenomes-Tr; EBT00001654628.
DR   EnsemblGenomes-Tr; EBT00001654629.
DR   EnsemblGenomes-Tr; EBT00001654630.
DR   EnsemblGenomes-Tr; EBT00001654631.
DR   EnsemblGenomes-Tr; EBT00001654632.
DR   EnsemblGenomes-Tr; EBT00001654633.
DR   EnsemblGenomes-Tr; EBT00001654634.
DR   EnsemblGenomes-Tr; EBT00001654635.
DR   EnsemblGenomes-Tr; EBT00001654636.
DR   EnsemblGenomes-Tr; EBT00001654637.
DR   EnsemblGenomes-Tr; EBT00001654638.
DR   EnsemblGenomes-Tr; EBT00001654639.
DR   EnsemblGenomes-Tr; EBT00001654640.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02225-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02226-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02227-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02228-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02229-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02230-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02231-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02232-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02233-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02234-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02235-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02236-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02237-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02238-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02239-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02240-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02241-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02242-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02243-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02244-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02245-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02246-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02247-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02248-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02249-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02250-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02251-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02252-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02253-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02254-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02255-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02256-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02257-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02258-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02259-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02260-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02261-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02262-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02263-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02264-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02265-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02266-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02267-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02268-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02269-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02270-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02271-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02272-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02273-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02274-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02275-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02276-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02277-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02278-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02279-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02280-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02281-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02282-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02283-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02284-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02285-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02286-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02287-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02288-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02289-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02290-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02291-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02292-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02293-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02294-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02295-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02296-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02297-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02298-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02299-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02300-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02301-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02302-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02303-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02304-1.
DR   EnsemblGenomes-Tr; MGAS10750_SpyR02305-1.
DR   EuropePMC; PMC1459018; 16636287.
DR   EuropePMC; PMC1797367; 17028269.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1949102; 17726530.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2630629; 19001115.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2798480; 19858262.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3088260; 21343455.
DR   EuropePMC; PMC3256084; 21986826.
DR   EuropePMC; PMC3411356; 21115137.
DR   EuropePMC; PMC4026873; 24883307.
DR   EuropePMC; PMC4249290; 25287924.
DR   EuropePMC; PMC4518830; 26013489.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; CP000262.
DR   SILVA-SSU; CP000262.
DR   StrainInfo; 692424; 0.
XX
CC   Sequencing Center: Integrated Genomics, Inc., 2201 W. Campbell Park
CC   Dr., Chicago, IL 60612.
CC   Bacterial Source:
CC   James M. Musser, M.D., Ph.D.
CC   Fondren Foundation Distinguished Endowed Chair
CC   Executive Vice President and Co-Director
CC   Director, Center for Molecular and Translational Human Infectious
CC   Diseases Research
CC   Vice-Chair, Department of Pathology
CC   The Methodist Hospital Research Institute
CC   6565 Fannin Street, B154
CC   Houston, Texas 77030
CC   tel:  (713) 441-5890
CC   fax:  (713) 790-6460
CC   e-mail:  jmmusser@tmh.tmc.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..545990,589843..804054,841976..1220658,
FT                   1256256..1862756,1876643..1937111)
FT                   /organism="Streptococcus pyogenes MGAS10750"
FT                   /focus
FT                   /strain="MGAS10750"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370554"
FT   source          545991..589842
FT                   /organism="Streptococcus phage 10750.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370566"
FT   source          804055..841975
FT                   /organism="Streptococcus phage 10750.2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370567"
FT   source          1220659..1256255
FT                   /organism="Streptococcus phage 10750.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370568"
FT   source          1862757..1876642
FT                   /organism="Streptococcus phage 10750.4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370569"
FT   gene            202..1557
FT                   /gene="dnaA"
FT                   /locus_tag="MGAS10750_Spy0001"
FT   CDS_pept        202..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MGAS10750_Spy0001"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36951"
FT                   /db_xref="GOA:Q1J960"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J960"
FT                   /protein_id="ABF36951.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNPKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQTQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1712..2848
FT                   /gene="dnaN"
FT                   /locus_tag="MGAS10750_Spy0002"
FT   CDS_pept        1712..2848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MGAS10750_Spy0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36952"
FT                   /db_xref="GOA:Q1J959"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J959"
FT                   /protein_id="ABF36952.1"
FT                   /translation="MIQFSINRTLFIQALNATKRAISTKNAIPILSSIKIEVTPTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            2923..3120
FT                   /locus_tag="MGAS10750_Spy0003"
FT   CDS_pept        2923..3120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0003"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36953"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J958"
FT                   /protein_id="ABF36953.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   gene            3450..4565
FT                   /locus_tag="MGAS10750_Spy0004"
FT   CDS_pept        3450..4565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0004"
FT                   /product="GTP-binding protein, probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36954"
FT                   /db_xref="GOA:Q1J957"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J957"
FT                   /protein_id="ABF36954.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEEEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMIYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4590..5204
FT                   /gene="pth"
FT                   /locus_tag="MGAS10750_Spy0005"
FT   CDS_pept        4590..5204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="MGAS10750_Spy0005"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36955"
FT                   /db_xref="GOA:Q1J956"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J956"
FT                   /protein_id="ABF36955.1"
FT                   /translation="MEEHSSPFGILERENMVKMIVGLGNPGSKYEKTKHNIGFMAIDNI
FT                   VKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLI
FT                   VIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHV
FT                   MGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5207..8710
FT                   /gene="trcF"
FT                   /locus_tag="MGAS10750_Spy0006"
FT   CDS_pept        5207..8710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="MGAS10750_Spy0006"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36956"
FT                   /db_xref="GOA:Q1J955"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J955"
FT                   /protein_id="ABF36956.1"
FT                   /translation="MDILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKALAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSGLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFHPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQIGSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVRKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQIFYVYNKVDTIEKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KILTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTIRQKGNTEINLQIDAYLPDDYIADERQKIDIYKRIREIQSREDYLN
FT                   LQDELIDRFGEYPDQVAYLLEMALLKHYMDNAFAELVERKNNQVIVRFEVTSLTYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYKILEELMLFGERLSEIKIRKNNSVF
FT                   K"
FT   gene            8848..9144
FT                   /locus_tag="MGAS10750_Spy0007"
FT   CDS_pept        8848..9144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0007"
FT                   /product="Heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36957"
FT                   /db_xref="GOA:Q1J954"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J954"
FT                   /protein_id="ABF36957.1"
FT                   /translation="MKRIVGEIMRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKS
FT                   STNVKLNDHIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9131..9502
FT                   /gene="divIC"
FT                   /locus_tag="MGAS10750_Spy0008"
FT   CDS_pept        9131..9502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="MGAS10750_Spy0008"
FT                   /product="Cell division protein DivIC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36958"
FT                   /db_xref="GOA:Q1J953"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J953"
FT                   /protein_id="ABF36958.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKSTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9499..9624
FT                   /locus_tag="MGAS10750_Spy0009"
FT   CDS_pept        9499..9624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J952"
FT                   /protein_id="ABF36959.1"
FT                   /translation="MMMDNIVKKIEAFLAFSDKKLAELQQENQKVKEESQYIQKN"
FT   gene            9637..10923
FT                   /locus_tag="MGAS10750_Spy0010"
FT   CDS_pept        9637..10923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0010"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36960"
FT                   /db_xref="GOA:Q1J951"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J951"
FT                   /protein_id="ABF36960.1"
FT                   /translation="MRKLLVAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLPIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDNYFWTQKKLRLYSAPYVLGTQTIPSSFSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   gene            10920..12206
FT                   /gene="tilS"
FT                   /locus_tag="MGAS10750_Spy0011"
FT   CDS_pept        10920..12206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="MGAS10750_Spy0011"
FT                   /product="tRNA(Ile)-lysidine synthetase TilS"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36961"
FT                   /db_xref="GOA:Q1J950"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J950"
FT                   /protein_id="ABF36961.1"
FT                   /translation="MMTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKEEKMLEYDSNLCYRDYYFSFMPKSNEDQGQV
FT                   SIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIIGEQDEQIIFV
FT                   LIGNKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12211..12753
FT                   /locus_tag="MGAS10750_Spy0012"
FT   CDS_pept        12211..12753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0012"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36962"
FT                   /db_xref="GOA:Q1J949"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J949"
FT                   /protein_id="ABF36962.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   gene            12775..14754
FT                   /gene="ftsH"
FT                   /locus_tag="MGAS10750_Spy0013"
FT   CDS_pept        12775..14754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="MGAS10750_Spy0013"
FT                   /product="Cell division protein ftsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36963"
FT                   /db_xref="GOA:Q1J948"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J948"
FT                   /protein_id="ABF36963.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   gene            15012..16472
FT                   /locus_tag="MGAS10750_Spy0014"
FT   CDS_pept        15012..16472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0014"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36964"
FT                   /db_xref="GOA:Q1J947"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J947"
FT                   /protein_id="ABF36964.1"
FT                   /translation="MKFTIITNYDTLSRKSFTIEGDNMTIFRKKKKYSNKTEMQRHFKV
FT                   IDLVFLGLGSMVGTGIFTVTGIGAAKYAGPALTISIIISAITIGILALFYAEFASRMPS
FT                   NGGAYSYVYATLGEFPAWLVGWYIIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALN
FT                   GTFNLKNGTYIDILPVLVMFFVTGIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFI
FT                   DHNNWSHFAPYGVGQITGGKTGIFAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGII
FT                   LSLIIVTALYIVVTTILTGIVHYTKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITV
FT                   CISMTYALARTIYSISRDGLLPKSLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLA
FT                   EFVNICTLAYLIILSGAIIKLRRIEGEPKANEFKTPLVPFLPILAIIICLSFMSQYKAF
FT                   TWIAFAIATIIGTLIYLAYGYTHSIENK"
FT   gene            complement(16812..16946)
FT                   /locus_tag="MGAS10750_Spy0015"
FT   CDS_pept        complement(16812..16946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36965"
FT                   /db_xref="GOA:Q1J4W2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J4W2"
FT                   /protein_id="ABF36965.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            17054..18882
FT                   /locus_tag="MGAS10750_SpyR02225"
FT   rRNA            17054..18882
FT                   /locus_tag="MGAS10750_SpyR02225"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            19007..21909
FT                   /locus_tag="MGAS10750_SpyR02226"
FT   rRNA            19007..21909
FT                   /locus_tag="MGAS10750_SpyR02226"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            21994..22110
FT                   /locus_tag="MGAS10750_SpyR02227"
FT   rRNA            21994..22110
FT                   /locus_tag="MGAS10750_SpyR02227"
FT                   /product="5S RNA"
FT   gene            22128..22200
FT                   /locus_tag="MGAS10750_SpyR02228"
FT   tRNA            22128..22200
FT                   /locus_tag="MGAS10750_SpyR02228"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            22218..22290
FT                   /locus_tag="MGAS10750_SpyR02229"
FT   tRNA            22218..22290
FT                   /locus_tag="MGAS10750_SpyR02229"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            22322..22394
FT                   /locus_tag="MGAS10750_SpyR02230"
FT   tRNA            22322..22394
FT                   /locus_tag="MGAS10750_SpyR02230"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            22400..22481
FT                   /locus_tag="MGAS10750_SpyR02231"
FT   tRNA            22400..22481
FT                   /locus_tag="MGAS10750_SpyR02231"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            22492..22564
FT                   /locus_tag="MGAS10750_SpyR02232"
FT   tRNA            22492..22564
FT                   /locus_tag="MGAS10750_SpyR02232"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            22577..22648
FT                   /locus_tag="MGAS10750_SpyR02233"
FT   tRNA            22577..22648
FT                   /locus_tag="MGAS10750_SpyR02233"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            22657..22741
FT                   /locus_tag="MGAS10750_SpyR02234"
FT   tRNA            22657..22741
FT                   /locus_tag="MGAS10750_SpyR02234"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            22758..22834
FT                   /locus_tag="MGAS10750_SpyR02235"
FT   tRNA            22758..22834
FT                   /locus_tag="MGAS10750_SpyR02235"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            22838..22911
FT                   /locus_tag="MGAS10750_SpyR02236"
FT   tRNA            22838..22911
FT                   /locus_tag="MGAS10750_SpyR02236"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   gene            23055..24883
FT                   /locus_tag="MGAS10750_SpyR02237"
FT   rRNA            23055..24883
FT                   /locus_tag="MGAS10750_SpyR02237"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            25008..27910
FT                   /locus_tag="MGAS10750_SpyR02238"
FT   rRNA            25008..27910
FT                   /locus_tag="MGAS10750_SpyR02238"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            27995..28111
FT                   /locus_tag="MGAS10750_SpyR02239"
FT   rRNA            27995..28111
FT                   /locus_tag="MGAS10750_SpyR02239"
FT                   /product="5S RNA"
FT   gene            28129..28201
FT                   /locus_tag="MGAS10750_SpyR02240"
FT   tRNA            28129..28201
FT                   /locus_tag="MGAS10750_SpyR02240"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            28219..28291
FT                   /locus_tag="MGAS10750_SpyR02241"
FT   tRNA            28219..28291
FT                   /locus_tag="MGAS10750_SpyR02241"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            28323..28395
FT                   /locus_tag="MGAS10750_SpyR02242"
FT   tRNA            28323..28395
FT                   /locus_tag="MGAS10750_SpyR02242"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            28401..28482
FT                   /locus_tag="MGAS10750_SpyR02243"
FT   tRNA            28401..28482
FT                   /locus_tag="MGAS10750_SpyR02243"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            28493..28565
FT                   /locus_tag="MGAS10750_SpyR02244"
FT   tRNA            28493..28565
FT                   /locus_tag="MGAS10750_SpyR02244"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            28578..28649
FT                   /locus_tag="MGAS10750_SpyR02245"
FT   tRNA            28578..28649
FT                   /locus_tag="MGAS10750_SpyR02245"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            28658..28742
FT                   /locus_tag="MGAS10750_SpyR02246"
FT   tRNA            28658..28742
FT                   /locus_tag="MGAS10750_SpyR02246"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            28759..28835
FT                   /locus_tag="MGAS10750_SpyR02247"
FT   tRNA            28759..28835
FT                   /locus_tag="MGAS10750_SpyR02247"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            28839..28912
FT                   /locus_tag="MGAS10750_SpyR02248"
FT   tRNA            28839..28912
FT                   /locus_tag="MGAS10750_SpyR02248"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   gene            28918..28991
FT                   /locus_tag="MGAS10750_SpyR02249"
FT   tRNA            28918..28991
FT                   /locus_tag="MGAS10750_SpyR02249"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            29012..29085
FT                   /locus_tag="MGAS10750_SpyR02250"
FT   tRNA            29012..29085
FT                   /locus_tag="MGAS10750_SpyR02250"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            29111..29193
FT                   /pseudo
FT                   /locus_tag="MGAS10750_SpyR02251"
FT   tRNA            29111..29193
FT                   /pseudo
FT                   /locus_tag="MGAS10750_SpyR02251"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            29207..29280
FT                   /locus_tag="MGAS10750_SpyR02252"
FT   tRNA            29207..29280
FT                   /locus_tag="MGAS10750_SpyR02252"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            29301..29373
FT                   /locus_tag="MGAS10750_SpyR02253"
FT   tRNA            29301..29373
FT                   /locus_tag="MGAS10750_SpyR02253"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            29386..29456
FT                   /locus_tag="MGAS10750_SpyR02254"
FT   tRNA            29386..29456
FT                   /locus_tag="MGAS10750_SpyR02254"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            29491..29564
FT                   /locus_tag="MGAS10750_SpyR02255"
FT   tRNA            29491..29564
FT                   /locus_tag="MGAS10750_SpyR02255"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            29574..29661
FT                   /locus_tag="MGAS10750_SpyR02256"
FT   tRNA            29574..29661
FT                   /locus_tag="MGAS10750_SpyR02256"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   gene            complement(30112..30255)
FT                   /locus_tag="MGAS10750_Spy0016"
FT   CDS_pept        complement(30112..30255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0016"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J945"
FT                   /protein_id="ABF36966.1"
FT                   /translation="MLFLQAKIILDCFHIPQRLRQAITRFRIRIINTSAIKPIAYRTLK
FT                   LY"
FT   gene            31082..32326
FT                   /gene="sibA"
FT                   /locus_tag="MGAS10750_Spy0017"
FT   CDS_pept        31082..32326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sibA"
FT                   /locus_tag="MGAS10750_Spy0017"
FT                   /product="Secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36967"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J944"
FT                   /protein_id="ABF36967.1"
FT                   /translation="MVKYKMSYRKGVVFFIMKKRILSAVLVSGVTLGAATTVGAEDLST
FT                   KIAKQDSIISNLTTEQKAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIK
FT                   ALTSQIVARNEKLKNQARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKL
FT                   LEQQKADKVSLEEKQAANQTAINTIAANMAMAEENQNTLRTQQANLEAATANLALQLAS
FT                   ATEDKANLVAQKEAAEKAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATP
FT                   AAQSSNAIEPAALTAPAAPSARPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQW
FT                   AYSAQAAGYRTGSTPMVGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADH
FT                   RGWFNPTGVTFIYPH"
FT   gene            32567..33541
FT                   /gene="prsA2"
FT                   /locus_tag="MGAS10750_Spy0018"
FT   CDS_pept        32567..33541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA2"
FT                   /locus_tag="MGAS10750_Spy0018"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36968"
FT                   /db_xref="GOA:Q1J943"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J943"
FT                   /protein_id="ABF36968.1"
FT                   /translation="MEEKMSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGE
FT                   IQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQD
FT                   RKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDR
FT                   HGLVGEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGK
FT                   KCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLD
FT                   TIYLPKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            33727..34482
FT                   /gene="recO"
FT                   /locus_tag="MGAS10750_Spy0019"
FT   CDS_pept        33727..34482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="MGAS10750_Spy0019"
FT                   /product="DNA repair protein recO"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36969"
FT                   /db_xref="GOA:Q1J942"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J942"
FT                   /protein_id="ABF36969.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            34507..35592
FT                   /gene="plsX"
FT                   /locus_tag="MGAS10750_Spy0020"
FT   CDS_pept        34507..35592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="MGAS10750_Spy0020"
FT                   /product="Fatty acid/phospholipid synthesis protein plsX"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36970"
FT                   /db_xref="GOA:Q1J941"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J941"
FT                   /protein_id="ABF36970.1"
FT                   /translation="MVSEYAIIKILLIDCVRTQDIIKGVEMKRIAIDAMGGDNAPKAIV
FT                   EGVNQAIEAFSDIEIQLYGDQTKINSYLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKA
FT                   SMVLAAKAVKEGKADAIISAGNTGALLAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDM
FT                   LDLGANAENTAKHLHQYAILGSFYAKNVRGIANPRVGLLNNGTEETKGDPLRKATYELL
FT                   TADNTISFVGNVEARELMSGVADVIVSDGFTGNAVLKSIEGTAISIMGQLKQIINSGGI
FT                   KTKIGASLLKSSLYEMKKTLDYSSAGGAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTM
FT                   LDTNVVGQLVEEFAKETQVND"
FT   gene            35585..35827
FT                   /gene="acpP2"
FT                   /locus_tag="MGAS10750_Spy0021"
FT   CDS_pept        35585..35827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP2"
FT                   /locus_tag="MGAS10750_Spy0021"
FT                   /product="acyl-carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36971"
FT                   /db_xref="GOA:Q1J940"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J940"
FT                   /protein_id="ABF36971.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDVEDMVFMEDVLDYLVQRLT"
FT   gene            35948..36682
FT                   /locus_tag="MGAS10750_Spy0022"
FT   CDS_pept        35948..36682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0022"
FT                   /product="Phosphoribosylamidoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36972"
FT                   /db_xref="GOA:Q1J939"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J939"
FT                   /protein_id="ABF36972.1"
FT                   /translation="MKTERKANNQVTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLN
FT                   GARKETIDGKGALNNQISSLIFEKLNKAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRN
FT                   VTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGE
FT                   TRRINELLKGWFAQIGLNLIDFKLEFGFDQEGTIILADELSPDNCRLWDKNGNHMDKDV
FT                   FRRDLGNLTDVYQVVLEKLIAL"
FT   gene            36758..40531
FT                   /locus_tag="MGAS10750_Spy0023"
FT   CDS_pept        36758..40531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0023"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36973"
FT                   /db_xref="GOA:Q1J938"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J938"
FT                   /protein_id="ABF36973.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKDLRIVQVYDVFNLAEDLLARAEKHIFSEQVTDRLLTEAEITSELDKVAFFAIEA
FT                   LPGQFDQRAASSQEALLLFGSDSQVKVNTAQLYLVNKDIAEAELEAVKNYLLNPVDSRF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFENYKADDFAAYKADQGLAMEVDDLLFIQDYFKSI
FT                   GRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRAGKFPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDGEVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPSD
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNGETIVDLERRFLDTNGVRVVIDAKVVD
FT                   KDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTRTVSVMAQGYNPYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPT
FT                   LVAFGVTTADSRKILSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFEAIQAQHKI
FT                   TAASAAKYGGVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKFEEVYPTEFEQADALEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEIAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGGLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANANSPWLAGVEVGDIHAIPVSHGEG
FT                   KFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   gene            40635..42146
FT                   /gene="purF"
FT                   /locus_tag="MGAS10750_Spy0024"
FT   CDS_pept        40635..42146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="MGAS10750_Spy0024"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36974"
FT                   /db_xref="GOA:Q1J937"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J937"
FT                   /protein_id="ABF36974.1"
FT                   /translation="MCEKLSIFALLDSLCIEVKMTYEVKSLNEECGVFGIWGHPQAAQV
FT                   TYFGLHSLQHRGQEGAGIVSNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRY
FT                   ATAGSADIRNIQPFLYKFHDGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMH
FT                   LIRRSHNSNFMGKVKEALNTVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVI
FT                   SSETCAFEVVGAKWVRDVEPGEVILIDDSGIQCDRYTDETQLAICSMEYVYFARPDSTI
FT                   HGVNVHTARKNMGKRLAQEFKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYT
FT                   QRTFIQPTQELREQGVRMKLSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASE
FT                   VHVAIASPELKYPCFYGIDIQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGL
FT                   ETKAPNGGLCVAYFDGHYPTPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            42174..43196
FT                   /gene="purM"
FT                   /locus_tag="MGAS10750_Spy0025"
FT   CDS_pept        42174..43196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="MGAS10750_Spy0025"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36975"
FT                   /db_xref="GOA:Q1J936"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J936"
FT                   /protein_id="ABF36975.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGVLGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNNPVKLEEVVSGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKQLKDVLL
FT                   EPTRIYVKAALPLIKEELVNGIGHITGGGFIENIPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIKKADDSVVIK
FT                   "
FT   gene            43364..43918
FT                   /gene="purN"
FT                   /locus_tag="MGAS10750_Spy0026"
FT   CDS_pept        43364..43918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="MGAS10750_Spy0026"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36976"
FT                   /db_xref="GOA:Q1J935"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J935"
FT                   /protein_id="ABF36976.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFLVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            44102..45649
FT                   /locus_tag="MGAS10750_Spy0027"
FT   CDS_pept        44102..45649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0027"
FT                   /product="Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36977"
FT                   /db_xref="GOA:Q1J934"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J934"
FT                   /protein_id="ABF36977.1"
FT                   /translation="MTKRALISVSDKSGIIDFAKELKNLGWDIISTGGTKVALDNAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDNNIELIDLVVINLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADAGQT
FT                   TFETRQRLAAKVFRHTAAYDALIAEYFTAQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVIALKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAKKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEVAAAGVKAIIQPGGSVRDQDSIDAANKHGLTMIFTGVRHFRH"
FT   gene            complement(45708..46133)
FT                   /locus_tag="MGAS10750_Spy0028"
FT   CDS_pept        complement(45708..46133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0028"
FT                   /product="Autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36978"
FT                   /db_xref="GOA:Q1J933"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J933"
FT                   /protein_id="ABF36978.1"
FT                   /translation="MTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDT
FT                   VTFPGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYF
FT                   TVTGSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            complement(46439..46831)
FT                   /locus_tag="MGAS10750_Spy0029"
FT   CDS_pept        complement(46439..46831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0029"
FT                   /product="Autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36979"
FT                   /db_xref="GOA:Q1J932"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J932"
FT                   /protein_id="ABF36979.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHEHG"
FT   gene            46937..48349
FT                   /gene="purD"
FT                   /locus_tag="MGAS10750_Spy0030"
FT   CDS_pept        46937..48349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="MGAS10750_Spy0030"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36980"
FT                   /db_xref="GOA:Q1J931"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J931"
FT                   /protein_id="ABF36980.1"
FT                   /translation="MANRVFLISRIVVYYHIFTMFQLLIINTLYQKANVYDIISNYNTK
FT                   EVGVLKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLDLVNIVVSEHSRL
FT                   IAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKY
FT                   NVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQAVEAAQEMLLD
FT                   NKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAY
FT                   APVPHLPQSVVDTAVETIVRPVLEGMVAEGRPYLGVLYVGLILTADGPKVIEFNSRFGD
FT                   PETQIILPRLTSDFAQNIDDIMMGIEPYITWQNDGVTLGVVVASEGYPLDYEKGVPLPE
FT                   KTDGDIITYYAGAKFAENSKALLSNGGRVYMLVTTEDSVKAGQDKIYTQLAQQDPTGLF
FT                   YRNDIGSKAIRE"
FT   gene            48627..49118
FT                   /gene="purE"
FT                   /locus_tag="MGAS10750_Spy0031"
FT   CDS_pept        48627..49118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="MGAS10750_Spy0031"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   carboxyltransferase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36981"
FT                   /db_xref="GOA:Q1J930"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J930"
FT                   /protein_id="ABF36981.1"
FT                   /translation="MKTPIISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPD
FT                   LMFKYAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIV
FT                   QMPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSGELI
FT                   "
FT   gene            49069..50202
FT                   /gene="purK"
FT                   /locus_tag="MGAS10750_Spy0032"
FT   CDS_pept        49069..50202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="MGAS10750_Spy0032"
FT                   /product="Phosphoribosylaminoimidazole carboxylase NCAIR
FT                   mutase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36982"
FT                   /db_xref="GOA:Q1J929"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J929"
FT                   /protein_id="ABF36982.1"
FT                   /translation="MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITL
FT                   DPASDCPASRVSEVIVAPYDDVEALGQLAARCDVLTYEFENVDADGLDAVVSACQLPQG
FT                   TDLLRISQNRIVEKDFLANKAGVTVAPYKVMTSSLDLGGLDLTKTYVLKTATGGYDGHG
FT                   QKIIRSAEDLPEAQQLANSAQCVLEEFVNFDLEISVIVSGNGEDVTVFPVQENIHCNNI
FT                   LSKTIVPARISDQLADKAKKMAVQIAKKLQLSGTLCVEMFATADDIIVNEIAPRPHNSG
FT                   HYSIEACDFSQFDTHILGVLGAPLPTIHLHAPAVMLNVLGQHVQQAIDYVTENPSAHLH
FT                   MYGKLEAKHNRKMGHVTVLKEDEVEFGEEINWKYGEI"
FT   gene            50181..51740
FT                   /locus_tag="MGAS10750_Spy0033"
FT   CDS_pept        50181..51740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0033"
FT                   /product="Putative phage resistance endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36983"
FT                   /db_xref="GOA:Q1J928"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J928"
FT                   /protein_id="ABF36983.1"
FT                   /translation="MEVWRNLNMTFKVVETYWDIQNDGYYLVHSNWDDWFKYETTYLFY
FT                   IKKNNQTTNVGSIKIGQFSMVEGQRVPNLPEEFDSLTDDFFSVATDESFYYEINRLESE
FT                   KREYILTALKDVAFDNDLYHKAVKTDVFNVSLTRDLLPQVIVNKYRRLANGNTKLSNYD
FT                   FSFKMSDACTLNFKVSPTEFPASNIHAIIGRNGVGKSYLLTEMVESAIQNDGRFSFNTE
FT                   FDDNFFSNIISVNFSSFENKKLFEENHEASKGYLYYHLSNRTTAKESKNYKLYKEEDGE
FT                   IVEYVPEGWDAVFIESVSTALRKKPKLWRDCIKILYSDPIFSQIGIDTLVETFQQEDDI
FT                   RKFYKEAYKIFRGLSSGHKIVILTITKLVEMVSEKTLVILDEPELHLHPPLLSSFIRSL
FT                   SQLLIKANGVAILATHSPIILQEVQKECVYKLSREMSTDFMQAVRPSNETFAEDIGSLT
FT                   FDIFELEAIESGFYTLINQIVKENLSFEDSLQRFDGRMGTLGYKLLLTEILKRDKEEGR
FT                   NA"
FT   gene            51733..52617
FT                   /locus_tag="MGAS10750_Spy0034"
FT   CDS_pept        51733..52617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0034"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36984"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J927"
FT                   /protein_id="ABF36984.1"
FT                   /translation="MLKLTPPCFSVKDILDELLDGVTKSKEFTDDQGNRIDSKKYTELF
FT                   NDSVKNRIFEFEVIYIKLAESGTLHSLRQSDCRVSEEIGKEEMEFLYKQKLVTKYKDSY
FT                   YLRLRTNENKNFNQCVYCERDLVSDLDHLLPQSEFPIFAVTPANLIPSCHICNKNKSAN
FT                   LSDVVNPYFEDTTQELWLKCTIEQKNNTLIPEFRIDFSQTSYQQELQIKISNIYTMGNT
FT                   SILDRINTWGVNKFTNKLQFWIDIESVAGTQQLVQMLNSQIELDVTHSQNFYELSLYRG
FT                   VINYLNTGHRLRL"
FT   gene            53126..54418
FT                   /gene="purB"
FT                   /locus_tag="MGAS10750_Spy0035"
FT   CDS_pept        53126..54418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="MGAS10750_Spy0035"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36985"
FT                   /db_xref="GOA:Q1J926"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J926"
FT                   /protein_id="ABF36985.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIRKKADFDIDRILEIEQDTRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEQYVCDKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIGELFNPIYYTKRVDDIFKRLGI"
FT   gene            54550..55461
FT                   /locus_tag="MGAS10750_Spy0036"
FT   CDS_pept        54550..55461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0036"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36986"
FT                   /db_xref="GOA:Q1J925"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J925"
FT                   /protein_id="ABF36986.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLIL
FT                   LELYLAYLDIEGMDGQYSDKIFYDSLLDNLSEQFEQFELDELFIVNKIIIDISSLSLKN
FT                   NRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKQKDVIKAEQSFMKACLFAQ
FT                   MTADQYLENKLIQEWEKDVKSY"
FT   gene            55615..56685
FT                   /gene="ruvB"
FT                   /locus_tag="MGAS10750_Spy0037"
FT   CDS_pept        55615..56685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="MGAS10750_Spy0037"
FT                   /product="Holliday junction DNA helicase ruvB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36987"
FT                   /db_xref="GOA:Q1J924"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J924"
FT                   /protein_id="ABF36987.1"
FT                   /translation="MLLTGGDYNKSRTLLSFTLCYNSPMARILDNNVMGNEEFSDRTLR
FT                   PQYLHEYIGQDKVKEQFAIFIEAAKRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNL
FT                   KQTSGPAVEKAGDLVAILNELEPGDILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAG
FT                   DTSRSIHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYQEKDLTEIVERTATIFE
FT                   IKIDHEAARKLACRSRGTPRIANRLLKRVRDYAQIIGDGIITAQITDRALTMLDVDREG
FT                   LDYIDQKILRTMIEMYQGGPVGLGTLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRV
FT                   ATQKAYRHLGYPYQNT"
FT   gene            56823..57260
FT                   /locus_tag="MGAS10750_Spy0038"
FT   CDS_pept        56823..57260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0038"
FT                   /product="Protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36988"
FT                   /db_xref="GOA:Q1J923"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J923"
FT                   /protein_id="ABF36988.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGK
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMNKEY"
FT   gene            57284..57685
FT                   /locus_tag="MGAS10750_Spy0039"
FT   CDS_pept        57284..57685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0039"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36989"
FT                   /db_xref="GOA:Q1J922"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J922"
FT                   /protein_id="ABF36989.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRMHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            57682..59457
FT                   /locus_tag="MGAS10750_Spy0040"
FT   CDS_pept        57682..59457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0040"
FT                   /product="Acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36990"
FT                   /db_xref="GOA:Q1J921"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J921"
FT                   /protein_id="ABF36990.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLLWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMFIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGALALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPKGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   gene            59765..62407
FT                   /locus_tag="MGAS10750_Spy0041"
FT   CDS_pept        59765..62407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0041"
FT                   /product="Alcohol dehydrogenase / Acetaldehyde
FT                   dehydrogenase (acetylating)"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36991"
FT                   /db_xref="GOA:Q1J920"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J920"
FT                   /protein_id="ABF36991.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAEC
FT                   TEVSEKEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAISTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWHKYNYYRADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   gene            62659..63675
FT                   /gene="adhA"
FT                   /locus_tag="MGAS10750_Spy0042"
FT   CDS_pept        62659..63675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="MGAS10750_Spy0042"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36992"
FT                   /db_xref="GOA:Q1J919"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J919"
FT                   /protein_id="ABF36992.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVDTAPGVFDEMERGLIQGRKVLDFIS"
FT   gene            64063..65352
FT                   /locus_tag="MGAS10750_Spy0043"
FT   CDS_pept        64063..65352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0043"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36993"
FT                   /db_xref="GOA:Q1J918"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J918"
FT                   /protein_id="ABF36993.1"
FT                   /translation="MIYNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEASVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFSLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPATAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   gene            65552..65860
FT                   /gene="rpsJ"
FT                   /locus_tag="MGAS10750_Spy0044"
FT   CDS_pept        65552..65860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="MGAS10750_Spy0044"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36994"
FT                   /db_xref="GOA:Q1J917"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J917"
FT                   /protein_id="ABF36994.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            66108..66374
FT                   /gene="rplC"
FT                   /locus_tag="MGAS10750_Spy0045"
FT   CDS_pept        66108..66374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="MGAS10750_Spy0045"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36995"
FT                   /db_xref="GOA:Q1J916"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J916"
FT                   /protein_id="ABF36995.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEA"
FT   gene            66497..66733
FT                   /locus_tag="MGAS10750_Spy0046"
FT   CDS_pept        66497..66733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0046"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36996"
FT                   /db_xref="GOA:Q1J915"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J915"
FT                   /protein_id="ABF36996.1"
FT                   /translation="MAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMGGNRVTVQNLEIV
FT                   QVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   gene            66757..67086
FT                   /locus_tag="MGAS10750_Spy0047"
FT   CDS_pept        66757..67086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0047"
FT                   /product="LSU ribosomal protein L1E (L4P)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36997"
FT                   /db_xref="GOA:Q1J914"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J914"
FT                   /protein_id="ABF36997.1"
FT                   /translation="MANVNLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QVLMRLKTVQQYQVVDVNHGVKKELDALVKVLSAHHNGVVVVLSLDQLPVHTDTNFHKK
FT                   FVALR"
FT   gene            67083..67379
FT                   /gene="rplD"
FT                   /locus_tag="MGAS10750_Spy0048"
FT   CDS_pept        67083..67379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="MGAS10750_Spy0048"
FT                   /product="LSU ribosomal protein L1E (L4P)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36998"
FT                   /db_xref="GOA:Q1J913"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J913"
FT                   /protein_id="ABF36998.1"
FT                   /translation="MKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLV
FT                   LVEEGNEFAALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   gene            67379..67675
FT                   /gene="rplW"
FT                   /locus_tag="MGAS10750_Spy0049"
FT   CDS_pept        67379..67675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="MGAS10750_Spy0049"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF36999"
FT                   /db_xref="GOA:Q1J912"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J912"
FT                   /protein_id="ABF36999.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            67693..68526
FT                   /gene="rplB"
FT                   /locus_tag="MGAS10750_Spy0050"
FT   CDS_pept        67693..68526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="MGAS10750_Spy0050"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37000"
FT                   /db_xref="GOA:Q1J911"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J911"
FT                   /protein_id="ABF37000.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            68611..68943
FT                   /gene="rpsS"
FT                   /locus_tag="MGAS10750_Spy0051"
FT   CDS_pept        68611..68943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="MGAS10750_Spy0051"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37001"
FT                   /db_xref="GOA:Q1J910"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J910"
FT                   /protein_id="ABF37001.1"
FT                   /translation="MLLNSSRCGTFFKGENYKMGRSLKKGPFVDEHLMKKVEAQANDEK
FT                   KKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAAD
FT                   DKKTRR"
FT   gene            68959..69303
FT                   /gene="rplV"
FT                   /locus_tag="MGAS10750_Spy0052"
FT   CDS_pept        68959..69303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="MGAS10750_Spy0052"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37002"
FT                   /db_xref="GOA:Q1J909"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J909"
FT                   /protein_id="ABF37002.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            69316..69969
FT                   /gene="rpsC"
FT                   /locus_tag="MGAS10750_Spy0053"
FT   CDS_pept        69316..69969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="MGAS10750_Spy0053"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37003"
FT                   /db_xref="GOA:Q1J908"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J908"
FT                   /protein_id="ABF37003.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            69973..70386
FT                   /gene="rplP"
FT                   /locus_tag="MGAS10750_Spy0054"
FT   CDS_pept        69973..70386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="MGAS10750_Spy0054"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37004"
FT                   /db_xref="GOA:Q1J907"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J907"
FT                   /protein_id="ABF37004.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            70396..70602
FT                   /gene="rpmC"
FT                   /locus_tag="MGAS10750_Spy0055"
FT   CDS_pept        70396..70602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="MGAS10750_Spy0055"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37005"
FT                   /db_xref="GOA:Q1J906"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J906"
FT                   /protein_id="ABF37005.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            70628..70888
FT                   /gene="rpsQ"
FT                   /locus_tag="MGAS10750_Spy0056"
FT   CDS_pept        70628..70888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="MGAS10750_Spy0056"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37006"
FT                   /db_xref="GOA:Q1J905"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J905"
FT                   /protein_id="ABF37006.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            70913..71281
FT                   /gene="rplN"
FT                   /locus_tag="MGAS10750_Spy0057"
FT   CDS_pept        70913..71281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="MGAS10750_Spy0057"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37007"
FT                   /db_xref="GOA:Q1J904"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J904"
FT                   /protein_id="ABF37007.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            71081..71281
FT                   /locus_tag="MGAS10750_Spy0058"
FT   CDS_pept        71081..71281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0058"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37008"
FT                   /db_xref="GOA:Q1J904"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J904"
FT                   /protein_id="ABF37008.1"
FT                   /translation="MVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGP
FT                   VARELREGGYMKIVSLAPEVL"
FT   gene            71360..71665
FT                   /gene="rplX"
FT                   /locus_tag="MGAS10750_Spy0059"
FT   CDS_pept        71360..71665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="MGAS10750_Spy0059"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37009"
FT                   /db_xref="GOA:Q1J902"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J902"
FT                   /protein_id="ABF37009.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   gene            71689..72231
FT                   /gene="rplE"
FT                   /locus_tag="MGAS10750_Spy0060"
FT   CDS_pept        71689..72231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="MGAS10750_Spy0060"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37010"
FT                   /db_xref="GOA:Q1J901"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J901"
FT                   /protein_id="ABF37010.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            72247..72432
FT                   /gene="rpsN"
FT                   /locus_tag="MGAS10750_Spy0061"
FT   CDS_pept        72247..72432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="MGAS10750_Spy0061"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37011"
FT                   /db_xref="GOA:Q1J900"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J900"
FT                   /protein_id="ABF37011.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            72583..72981
FT                   /gene="rpsH"
FT                   /locus_tag="MGAS10750_Spy0062"
FT   CDS_pept        72583..72981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="MGAS10750_Spy0062"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37012"
FT                   /db_xref="GOA:Q1J8Z9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z9"
FT                   /protein_id="ABF37012.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            73184..73720
FT                   /gene="rplF"
FT                   /locus_tag="MGAS10750_Spy0063"
FT   CDS_pept        73184..73720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="MGAS10750_Spy0063"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37013"
FT                   /db_xref="GOA:Q1J8Z8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z8"
FT                   /protein_id="ABF37013.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            73816..74181
FT                   /gene="rplR"
FT                   /locus_tag="MGAS10750_Spy0064"
FT   CDS_pept        73816..74181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="MGAS10750_Spy0064"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37014"
FT                   /db_xref="GOA:Q1J8Z7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z7"
FT                   /protein_id="ABF37014.1"
FT                   /translation="MKIVISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYA
FT                   QVIDDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYH
FT                   GRVKALADAARENGLKF"
FT   gene            74200..74694
FT                   /gene="rpsE"
FT                   /locus_tag="MGAS10750_Spy0065"
FT   CDS_pept        74200..74694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="MGAS10750_Spy0065"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37015"
FT                   /db_xref="GOA:Q1J8Z6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z6"
FT                   /protein_id="ABF37015.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            74709..74891
FT                   /gene="rpmD"
FT                   /locus_tag="MGAS10750_Spy0066"
FT   CDS_pept        74709..74891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="MGAS10750_Spy0066"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37016"
FT                   /db_xref="GOA:Q1J8Z5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z5"
FT                   /protein_id="ABF37016.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            75107..75547
FT                   /gene="rplO"
FT                   /locus_tag="MGAS10750_Spy0067"
FT   CDS_pept        75107..75547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="MGAS10750_Spy0067"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37017"
FT                   /db_xref="GOA:Q1J8Z4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z4"
FT                   /protein_id="ABF37017.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            75516..76868
FT                   /gene="secY"
FT                   /locus_tag="MGAS10750_Spy0068"
FT   CDS_pept        75516..76868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="MGAS10750_Spy0068"
FT                   /product="Protein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37018"
FT                   /db_xref="GOA:Q1J8Z3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Z3"
FT                   /protein_id="ABF37018.1"
FT                   /translation="MLKVVQSKSSNEGILIMFLKILKDALKIKTVRNKIFFTIFIILVF
FT                   RIGTHITVPGVNAKSLEQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLL
FT                   QMDILPKFVEWGKQGEVGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDI
FT                   KTYLLIGALLTTGSVIVTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVN
FT                   VKASDLHSSYLIVGILIIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVN
FT                   PAGVIPVIFASSITTIPSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFS
FT                   FFYTFVQVNPEKTAENLQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAP
FT                   IAAQQALNLSSSIALGGTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            77018..77656
FT                   /gene="adk"
FT                   /locus_tag="MGAS10750_Spy0069"
FT   CDS_pept        77018..77656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="MGAS10750_Spy0069"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37019"
FT                   /db_xref="GOA:Q1J8Z2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z2"
FT                   /protein_id="ABF37019.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLGLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            77720..77992
FT                   /gene="infA"
FT                   /locus_tag="MGAS10750_Spy0070"
FT   CDS_pept        77720..77992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="MGAS10750_Spy0070"
FT                   /product="Bacterial Protein Translation Initiation Factor 1
FT                   (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37020"
FT                   /db_xref="GOA:Q1J8Z1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z1"
FT                   /protein_id="ABF37020.1"
FT                   /translation="MLPLCSEDIKSKFRGYFCVAKEDVIEIEGKVVETMPNAMFTVELE
FT                   NGHQILATVSGKIRKNYIRILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            78018..78134
FT                   /gene="rpmJ"
FT                   /locus_tag="MGAS10750_Spy0071"
FT   CDS_pept        78018..78134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="MGAS10750_Spy0071"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37021"
FT                   /db_xref="GOA:Q1J8Z0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Z0"
FT                   /protein_id="ABF37021.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            78152..78517
FT                   /gene="rpsM"
FT                   /locus_tag="MGAS10750_Spy0072"
FT   CDS_pept        78152..78517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="MGAS10750_Spy0072"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37022"
FT                   /db_xref="GOA:Q1J8Y9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Y9"
FT                   /protein_id="ABF37022.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            78535..78918
FT                   /gene="rpsK"
FT                   /locus_tag="MGAS10750_Spy0073"
FT   CDS_pept        78535..78918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="MGAS10750_Spy0073"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37023"
FT                   /db_xref="GOA:Q1J8Y8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Y8"
FT                   /protein_id="ABF37023.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            78964..79902
FT                   /gene="rpoA"
FT                   /locus_tag="MGAS10750_Spy0074"
FT   CDS_pept        78964..79902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="MGAS10750_Spy0074"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37024"
FT                   /db_xref="GOA:Q1J8Y7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Y7"
FT                   /protein_id="ABF37024.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            79917..80303
FT                   /gene="rplQ"
FT                   /locus_tag="MGAS10750_Spy0075"
FT   CDS_pept        79917..80303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="MGAS10750_Spy0075"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37025"
FT                   /db_xref="GOA:Q1J8Y6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Y6"
FT                   /protein_id="ABF37025.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            complement(80809..81801)
FT                   /locus_tag="MGAS10750_Spy0076"
FT   CDS_pept        complement(80809..81801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0076"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37026"
FT                   /db_xref="GOA:Q1J8Y5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Y5"
FT                   /protein_id="ABF37026.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLISKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVIMTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNEALT
FT                   GILKDYTVNSITTDNRTEFSRLSDVFPASAIYYAHPYASWERGTNENHNRLILRWLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGILLETA"
FT   gene            complement(81989..82123)
FT                   /locus_tag="MGAS10750_Spy0077"
FT   CDS_pept        complement(81989..82123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37027"
FT                   /db_xref="GOA:Q1J4W2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J4W2"
FT                   /protein_id="ABF37027.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            82231..84059
FT                   /locus_tag="MGAS10750_SpyR02257"
FT   rRNA            82231..84059
FT                   /locus_tag="MGAS10750_SpyR02257"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            84184..87086
FT                   /locus_tag="MGAS10750_SpyR02258"
FT   rRNA            84184..87086
FT                   /locus_tag="MGAS10750_SpyR02258"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            87171..87287
FT                   /locus_tag="MGAS10750_SpyR02259"
FT   rRNA            87171..87287
FT                   /locus_tag="MGAS10750_SpyR02259"
FT                   /product="5S RNA"
FT   gene            87305..87377
FT                   /locus_tag="MGAS10750_SpyR02260"
FT   tRNA            87305..87377
FT                   /locus_tag="MGAS10750_SpyR02260"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            87383..87453
FT                   /locus_tag="MGAS10750_SpyR02261"
FT   tRNA            87383..87453
FT                   /locus_tag="MGAS10750_SpyR02261"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            87488..87561
FT                   /locus_tag="MGAS10750_SpyR02262"
FT   tRNA            87488..87561
FT                   /locus_tag="MGAS10750_SpyR02262"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            87584..87655
FT                   /locus_tag="MGAS10750_SpyR02263"
FT   tRNA            87584..87655
FT                   /locus_tag="MGAS10750_SpyR02263"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            87669..87751
FT                   /pseudo
FT                   /locus_tag="MGAS10750_SpyR02264"
FT   tRNA            87669..87751
FT                   /pseudo
FT                   /locus_tag="MGAS10750_SpyR02264"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            87765..87838
FT                   /locus_tag="MGAS10750_SpyR02265"
FT   tRNA            87765..87838
FT                   /locus_tag="MGAS10750_SpyR02265"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            87859..87931
FT                   /locus_tag="MGAS10750_SpyR02266"
FT   tRNA            87859..87931
FT                   /locus_tag="MGAS10750_SpyR02266"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            87951..88031
FT                   /locus_tag="MGAS10750_SpyR02267"
FT   tRNA            87951..88031
FT                   /locus_tag="MGAS10750_SpyR02267"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            88038..88108
FT                   /locus_tag="MGAS10750_SpyR02268"
FT   tRNA            88038..88108
FT                   /locus_tag="MGAS10750_SpyR02268"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            88120..88192
FT                   /locus_tag="MGAS10750_SpyR02269"
FT   tRNA            88120..88192
FT                   /locus_tag="MGAS10750_SpyR02269"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   gene            88201..88272
FT                   /locus_tag="MGAS10750_SpyR02270"
FT   tRNA            88201..88272
FT                   /locus_tag="MGAS10750_SpyR02270"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            88292..88375
FT                   /locus_tag="MGAS10750_SpyR02271"
FT   tRNA            88292..88375
FT                   /locus_tag="MGAS10750_SpyR02271"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   gene            88544..88744
FT                   /locus_tag="MGAS10750_Spy0078"
FT   CDS_pept        88544..88744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0078"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37028"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J540"
FT                   /protein_id="ABF37028.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETWKEMEDFIEMNDCLRPTLI"
FT   gene            88829..89617
FT                   /locus_tag="MGAS10750_Spy0079"
FT   CDS_pept        88829..89617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0079"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37029"
FT                   /db_xref="GOA:Q1J8M8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M8"
FT                   /protein_id="ABF37029.1"
FT                   /translation="MSNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIEVREYWVSSDIKWLCQNRPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRDHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLRVMVFPKKGLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            89601..89771
FT                   /locus_tag="MGAS10750_Spy0080"
FT   CDS_pept        89601..89771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Y1"
FT                   /protein_id="ABF37030.1"
FT                   /translation="MEKEAKQMIDLKRNLFKIDVRAQKDEEKGFMRTACYITDKVYLMR
FT                   KICGMMNMIEY"
FT   gene            89892..90077
FT                   /locus_tag="MGAS10750_Spy0081"
FT   CDS_pept        89892..90077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37031"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Y0"
FT                   /protein_id="ABF37031.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVRDE
FT                   MLSQQGHEDKADWLEP"
FT   gene            90715..91023
FT                   /locus_tag="MGAS10750_Spy0082"
FT   CDS_pept        90715..91023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0082"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37032"
FT                   /db_xref="GOA:Q1J8X9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X9"
FT                   /protein_id="ABF37032.1"
FT                   /translation="MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLT
FT                   LSRKDMMDIGIPIGSDVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST"
FT   gene            91063..91290
FT                   /locus_tag="MGAS10750_Spy0083"
FT   CDS_pept        91063..91290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0083"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37033"
FT                   /db_xref="GOA:Q1J8X8"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X8"
FT                   /protein_id="ABF37033.1"
FT                   /translation="MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKT
FT                   LQAGAATVLMTGSGPTVFALCQTEKQTIIV"
FT   gene            91400..91843
FT                   /gene="adcR"
FT                   /locus_tag="MGAS10750_Spy0084"
FT   CDS_pept        91400..91843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="MGAS10750_Spy0084"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37034"
FT                   /db_xref="GOA:Q1J8X7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X7"
FT                   /protein_id="ABF37034.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            91847..92566
FT                   /gene="adcC"
FT                   /locus_tag="MGAS10750_Spy0085"
FT   CDS_pept        91847..92566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="MGAS10750_Spy0085"
FT                   /product="High-affinity zinc uptake system ATP-binding
FT                   protein znuC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37035"
FT                   /db_xref="GOA:Q1J8X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X6"
FT                   /protein_id="ABF37035.1"
FT                   /translation="MRYISVENLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEVETDDEKGGHGHA"
FT   gene            92520..93374
FT                   /gene="adcB"
FT                   /locus_tag="MGAS10750_Spy0086"
FT   CDS_pept        92520..93374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="MGAS10750_Spy0086"
FT                   /product="High-affinity zinc uptake system membrane protein
FT                   znuB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37036"
FT                   /db_xref="GOA:Q1J8X5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X5"
FT                   /protein_id="ABF37036.1"
FT                   /translation="MKLKQMTKKEVMVMLDILSYDFMQRAVMAVVAISIFAPILGIFLI
FT                   LRRQSLMSDTLSHVSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEIST
FT                   AILMSLGLALSLIIMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLF
FT                   IRPMYILTFDEDTAFVDGLPVRLMSALFNIVTGVAIALTIPAAGALLVSTIMVLPASIA
FT                   MRLGKNFKTVILLGIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKK
FT                   RLF"
FT   gene            complement(93414..93797)
FT                   /locus_tag="MGAS10750_Spy0087"
FT   CDS_pept        complement(93414..93797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0087"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37037"
FT                   /db_xref="GOA:Q1J8X4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X4"
FT                   /protein_id="ABF37037.1"
FT                   /translation="MTECIFCHQLKANQLLTQSQYFKVVFDIDPIQKGHLLLISKDHYT
FT                   SLTQLPKEVRYDLINLQAALVAKLEQHLPISGVTSVSNDKELMDEGTHFHLHLIPRLTN
FT                   DSFWEGITINQENWDLTPFLKHL"
FT   gene            complement(93848..95104)
FT                   /gene="tyrS"
FT                   /locus_tag="MGAS10750_Spy0088"
FT   CDS_pept        complement(93848..95104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="MGAS10750_Spy0088"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37038"
FT                   /db_xref="GOA:Q1J8X3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8X3"
FT                   /protein_id="ABF37038.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSIDNHNIVEILVAAKISPSKRQAREDVQNGAIYINGDRVQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            95196..97508
FT                   /gene="pbp1b"
FT                   /locus_tag="MGAS10750_Spy0089"
FT   CDS_pept        95196..97508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1b"
FT                   /locus_tag="MGAS10750_Spy0089"
FT                   /product="Multimodular transpeptidase-transglycosylase PBP
FT                   1B"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37039"
FT                   /db_xref="GOA:Q1J8X2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8X2"
FT                   /protein_id="ABF37039.1"
FT                   /translation="MRYFMVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIF
FT                   LFGMMGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLR
FT                   TPVANDAISENIKKAIVSTEDEHFQEHKGIVPKAVFRATLASVLGFGEASGGSTLTQQL
FT                   VKQQVLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNM
FT                   YRTGVLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKV
FT                   SSRDLKNDDTKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGDLLDDGTGTV
FT                   QMGNVLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENY
FT                   MTKMGYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVV
FT                   YKHENKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTE
FT                   NYTDVWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVG
FT                   QRFNLDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGG
FT                   TDADYQKAWGNFGFRKN"
FT   gene            97772..101338
FT                   /gene="rpoB"
FT                   /locus_tag="MGAS10750_Spy0090"
FT   CDS_pept        97772..101338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="MGAS10750_Spy0090"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37040"
FT                   /db_xref="GOA:Q1J8X1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8X1"
FT                   /protein_id="ABF37040.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   gene            101429..105070
FT                   /gene="rpoC"
FT                   /locus_tag="MGAS10750_Spy0091"
FT   CDS_pept        101429..105070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="MGAS10750_Spy0091"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37041"
FT                   /db_xref="GOA:Q1J8X0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8X0"
FT                   /protein_id="ABF37041.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAVFTAEAE"
FT   gene            105222..105587
FT                   /locus_tag="MGAS10750_Spy0092"
FT   CDS_pept        105222..105587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0092"
FT                   /product="Putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37042"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W9"
FT                   /protein_id="ABF37042.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   gene            105680..106618
FT                   /gene="comYA"
FT                   /locus_tag="MGAS10750_Spy0093"
FT   CDS_pept        105680..106618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYA"
FT                   /locus_tag="MGAS10750_Spy0093"
FT                   /product="ComG operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37043"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W8"
FT                   /protein_id="ABF37043.1"
FT                   /translation="MVQALAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISSYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGITKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            106497..107588
FT                   /gene="comYB"
FT                   /locus_tag="MGAS10750_Spy0094"
FT   CDS_pept        106497..107588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYB"
FT                   /locus_tag="MGAS10750_Spy0094"
FT                   /product="ComG operon protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37044"
FT                   /db_xref="GOA:Q1J8W7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W7"
FT                   /protein_id="ABF37044.1"
FT                   /translation="MTLLKTNLNIIPHRTGINKLISFLRQDISIPSKLSLKKLSSKHQH
FT                   KFIQLLANLLSTGFSFAEVIAFLKRSQLLQLDYVLKMEESLLKGQGLADMLSGLGFSDA
FT                   ILTQISLADRHGNIETTLVAIQHYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRY
FT                   LVPQLETQNQITYFLNHFPAFFIGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLG
FT                   KLLKQYLTSYYAREWGTLIGQGLDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHI
FT                   KVATYPFFKKELSLMIEYGEIKSKLGAELEIYAQESWEQFFSQLYQVTQLIQPAIFLVV
FT                   AVTIVMIYAAILLPIYQNMGGIF"
FT   gene            107590..107916
FT                   /gene="comYC"
FT                   /locus_tag="MGAS10750_Spy0095"
FT   CDS_pept        107590..107916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="MGAS10750_Spy0095"
FT                   /product="ComG operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37045"
FT                   /db_xref="GOA:Q1J8W6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W6"
FT                   /protein_id="ABF37045.1"
FT                   /translation="MINQWNNLRHKNLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            107891..108319
FT                   /locus_tag="MGAS10750_Spy0096"
FT   CDS_pept        107891..108319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0096"
FT                   /product="ComG operon protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37046"
FT                   /db_xref="GOA:Q1J8W5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W5"
FT                   /protein_id="ABF37046.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            108276..108560
FT                   /locus_tag="MGAS10750_Spy0097"
FT   CDS_pept        108276..108560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0097"
FT                   /product="ComG operon protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37047"
FT                   /db_xref="GOA:Q1J8W4"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W4"
FT                   /protein_id="ABF37047.1"
FT                   /translation="MGIIKKQVKAYIALESMIATGILFSIVILILSSLQQSQAALTYYR
FT                   KQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   gene            108553..108987
FT                   /gene="comYD"
FT                   /locus_tag="MGAS10750_Spy0098"
FT   CDS_pept        108553..108987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYD"
FT                   /locus_tag="MGAS10750_Spy0098"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37048"
FT                   /db_xref="GOA:Q1J8W3"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W3"
FT                   /protein_id="ABF37048.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIEQSQICITLKWKSGLERTFYYAFQD"
FT   gene            108971..109297
FT                   /locus_tag="MGAS10750_Spy0099"
FT   CDS_pept        108971..109297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0099"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37049"
FT                   /db_xref="GOA:Q1J8W2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W2"
FT                   /protein_id="ABF37049.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVFFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            109350..110348
FT                   /locus_tag="MGAS10750_Spy0100"
FT   CDS_pept        109350..110348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0100"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37050"
FT                   /db_xref="GOA:Q1J8W1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8W1"
FT                   /protein_id="ABF37050.1"
FT                   /translation="MTLLFISSVIWYDKVMTFEKIEEAYQLLLENCQLIENDLKTHIYD
FT                   AIVEQNSFYLGAEGASPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQF
FT                   TPDAIGFILLYLLEQLSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLID
FT                   LSASIAEIMDSSAHFIQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHT
FT                   YAHHLLMEQSLKYLKKDGFAIFLVPVNLLTSPQSQLLKQWLKDYAQVVTLITLPDSIFG
FT                   HPSNAKSIIVLQKQTDHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            110407..111603
FT                   /gene="ackA"
FT                   /locus_tag="MGAS10750_Spy0101"
FT   CDS_pept        110407..111603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="MGAS10750_Spy0101"
FT                   /product="Acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37051"
FT                   /db_xref="GOA:Q1J8W0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8W0"
FT                   /protein_id="ABF37051.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEAVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEQIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGQSA
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            111790..112098
FT                   /locus_tag="MGAS10750_Spy0102"
FT   CDS_pept        111790..112098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37052"
FT                   /db_xref="GOA:Q1J8V9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V9"
FT                   /protein_id="ABF37052.1"
FT                   /translation="MYVFIESNDLKDYLITVYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKITTNSQKPPFDTSQVLC"
FT   gene            complement(112181..112951)
FT                   /gene="proC"
FT                   /locus_tag="MGAS10750_Spy0103"
FT   CDS_pept        complement(112181..112951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="MGAS10750_Spy0103"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37053"
FT                   /db_xref="GOA:Q1J8V8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V8"
FT                   /protein_id="ABF37053.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   gene            complement(112999..114066)
FT                   /gene="pepA"
FT                   /locus_tag="MGAS10750_Spy0104"
FT   CDS_pept        complement(112999..114066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="MGAS10750_Spy0104"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37054"
FT                   /db_xref="GOA:Q1J8V7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V7"
FT                   /protein_id="ABF37054.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKAEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPNIENIVFDGGFTDKAEAESFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNPGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEDA
FT                   GVNFQYYCGKGGTDAGAAHLQNDGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKRY"
FT   gene            complement(114176..114340)
FT                   /locus_tag="MGAS10750_Spy0105"
FT   CDS_pept        complement(114176..114340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37055"
FT                   /db_xref="GOA:Q1J8V6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V6"
FT                   /protein_id="ABF37055.1"
FT                   /translation="MTPLSLLFASEESFRILSALLFLLTSLCFIILMISLLPKKTGYRQ
FT                   KTNTSSRDL"
FT   gene            114522..114815
FT                   /locus_tag="MGAS10750_Spy0106"
FT   CDS_pept        114522..114815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0106"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37056"
FT                   /db_xref="GOA:Q1J8V5"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V5"
FT                   /protein_id="ABF37056.1"
FT                   /translation="MRDMSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLR
FT                   TFFSPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG"
FT   gene            114812..115129
FT                   /locus_tag="MGAS10750_Spy0107"
FT   CDS_pept        114812..115129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0107"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37057"
FT                   /db_xref="GOA:Q1J8V4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V4"
FT                   /protein_id="ABF37057.1"
FT                   /translation="MIRPTSYEPLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAE
FT                   LTDMTFVCVNRDQFIEVAQKWNIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   Q"
FT   gene            115147..115773
FT                   /locus_tag="MGAS10750_Spy0108"
FT   CDS_pept        115147..115773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0108"
FT                   /product="tRNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37058"
FT                   /db_xref="GOA:Q1J8V3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V3"
FT                   /protein_id="ABF37058.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPIVGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMQNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   gene            115925..116320
FT                   /locus_tag="MGAS10750_Spy0109"
FT   CDS_pept        115925..116320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0109"
FT                   /product="Single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37059"
FT                   /db_xref="GOA:Q1J8V2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V2"
FT                   /protein_id="ABF37059.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   gene            complement(116580..117269)
FT                   /locus_tag="MGAS10750_Spy0110"
FT   CDS_pept        complement(116580..117269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0110"
FT                   /product="Deoxyadenosine kinase / Deoxyguanosine kinase"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.113"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37060"
FT                   /db_xref="GOA:Q1J8V1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V1"
FT                   /protein_id="ABF37060.1"
FT                   /translation="MKPSSKQYANDIRRRRMLIVLAGTIGAGKSSLAAALGEHLGTDVF
FT                   YEAVDNNPVLDLYYQDPKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLK
FT                   LNYKNGNVTKTELDIYQELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSF
FT                   EQVDGNPSLEQYYHQVHGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTK
FT                   LKELHLL"
FT   gene            complement(117241..118290)
FT                   /locus_tag="MGAS10750_Spy0111"
FT   CDS_pept        complement(117241..118290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0111"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37061"
FT                   /db_xref="GOA:Q1J8V0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8V0"
FT                   /protein_id="ABF37061.1"
FT                   /translation="MLRLFANFVVPSTNLMKVIWRPSSMTKLNSSFRIGDVEIPHRTVL
FT                   APMAGVTNSAFRTIAKEFGAGLVVMEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFG
FT                   GDAEGLKRAADFIQTNTKADIVDINMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSV
FT                   LDIPLTVKMRTGWADSSLAVENALAAESAGVSALAMHGRTREQMYTGTCDHETLARVSK
FT                   AITKIPFIGNGDVRSVQDAKFMIEEIGVDAVMIGRAAMNNPYLFTQINHFFETGQELAD
FT                   LPFAKKLDIAKDHLKRLINLKGETIAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAE
FT                   VEAIFETVR"
FT   gene            complement(118205..119077)
FT                   /locus_tag="MGAS10750_Spy0112"
FT   CDS_pept        complement(118205..119077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0112"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37062"
FT                   /db_xref="GOA:Q1J8U9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8U9"
FT                   /protein_id="ABF37062.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYASTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEALINDKA"
FT   gene            complement(119224..120816)
FT                   /gene="rofA"
FT                   /locus_tag="MGAS10750_Spy0113"
FT   CDS_pept        complement(119224..120816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rofA"
FT                   /locus_tag="MGAS10750_Spy0113"
FT                   /product="Transcriptional regulator RofA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37063"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U8"
FT                   /protein_id="ABF37063.1"
FT                   /translation="MISIFSLDRIEIGEYTYQRLIWLSKCRKRGPLYLIEKYLESSIES
FT                   KCQLVVLFFKTSYLPITEVAEKTGLTFLQLNHYCEELNAFFPGSLSMTIQKRMISCQFT
FT                   HPFKETYLYQLYASSNVLQLLAFLIKNGSHSRPLTDFARSHFLSNSSAYRMREALIPLL
FT                   RNFELKLSKNKIVGEEYRIRYLIALLYSKFGIKVYDLTQQDKNTIHSFLSHSSTHLKTS
FT                   PWLSESFSFYDILLALSWKRHQFSVTIPQTRIFQQLKKLFVYDSLKKSSHDIIETYCQL
FT                   NFSAGDLDYLYLIYITANNSFASLQWTPEHTRQCCQLFEENDTFRLLLNPIITLLPNLK
FT                   EQKASLVKALMFFSKSFLFNLQHFIPETNLFVSPYYKGNQKLYTSLKLIVEEWMAKLPG
FT                   KRYLNHKHFHLFCHYVEQILRNIQPPLVVVFVASNFINAHLLTDSFPRYFSDKSIDFHS
FT                   YYLLQDNVYQIPDLKPDLVITHSQLIPFVQHELTKGIAVAEISFDESILSIQELMYQVK
FT                   EEKFQADLTKQLT"
FT   gene            120949..122568
FT                   /locus_tag="MGAS10750_Spy0114"
FT   CDS_pept        120949..122568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0114"
FT                   /product="Fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37064"
FT                   /db_xref="GOA:Q1J8U7"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U7"
FT                   /protein_id="ABF37064.1"
FT                   /translation="MVSSYMFVRGEKMNNKMFLNKEAGFLAHTKRKRRFAVTLVGVFFM
FT                   LLAYAGAIGFGQVAYAADEKTVPNFKSPDPDYPWYGYDAYGKGYPGYDISKYYHDLRVN
FT                   LNGSQVYQVYCFNIQKIFPYNVKSVTQKWFKKVEGNSDTFGLYAMNPRVQGEELSQKLR
FT                   SVMYNAYPKNANNIMDGLDTLNAIKVTQSAVWYYSDKSEFEVDKQWESELNNHEIDQEQ
FT                   VTLMREALRKLISSNLEETVEKKLPENYKLNIFNPQDTSIQHLLSAEFVPENPPRPGET
FT                   PEYGPKTPELDGSPIPEDPKHPDDNLEPTLPPVMLDGEEVPEVPSESLEPALPPLMPEL
FT                   DGQEVPEVPSESLEPALPPLMPELDGQEVPEKPSIDLPIEVPRYEFNNKDQSPLAGESG
FT                   ETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDTKEPEVLMGGQSESVEFTKDTQ
FT                   TGMSGFSETATVVEDTRPKLVFHFDNNEPEVEENREKPTKNITPILPATGDIENVLAFL
FT                   GILILSVLSIFSLLKNKQNNKV"
FT   gene            123778..127881
FT                   /locus_tag="MGAS10750_Spy0115"
FT   CDS_pept        123778..127881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0115"
FT                   /product="Fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37065"
FT                   /db_xref="GOA:Q1J8U6"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U6"
FT                   /protein_id="ABF37065.1"
FT                   /translation="MYSRLKRELVIVINRKKKYKLIRLMVTLGLIFSQLAPPFGTLMAL
FT                   SGHSRSKSPVTEVKADNVSTLKTGSFKLKKFDEDGKTPIKDVTFQLTSETNPSNYKIEQ
FT                   ITSGAGDASFANIPPGTYLLKEVAPPSGYQVMADYYRITVSPDGYTQYTYVKVGTTTSS
FT                   PTTSLPSTSGGGTGGTVFRTSKTSGVVTVTDYNFTTKNKAQGNTDYTTLWATSGEFFDM
FT                   SFKLKVNEGTQAGDSFTIKLSDYLSPNGIREKFISAPPLMLDKKVVATGIYDESTNSYI
FT                   YTFNDLINHKQNAEITVNYTFSPEAKKVDRDWYVNTYNITNIIDGQKQDSGNFTIDYGQ
FT                   GQYMTGTLNSGLRLRNNITYLNRTTGEVEYTIYLNNGASPRDKDFTVKNPVTGRHFLNL
FT                   EDKSASVAFTQKNITVYRVPLSQKTSKMPYSMSGETDGLESIPFDYSSKGITFTKESFH
FT                   DNETNSNTAGLLIKIKAYITADNKRSADVSLSAGWTYTNLIRSRSDAKASAFELGNTSS
FT                   GVANNIEPTVTIRNYKIKKGSIVFTKQDVETKMTLSGVAFRLEKKEENDWQIVEKYKDV
FT                   QTGTEGKLILSDLDPGEYQLIETKPLDGYLVSSGPVVTFTITDQGTEGTVKPSDKIIPN
FT                   TKPGKQKIKVIKKDEQSRVPLAGAKFQLESNKGVVLTGETDGKGEYTFTNLPFGDYILT
FT                   EIAAPKGYILDKTPRSIAIGDTVDKEPEPTVVEAATPRTVRSVSPSATVSDKDVSRNIL
FT                   VKKVEFTTTNGQTPLQVKPNQGENLIARSEFELKKEIDIKKGDYFAVKLSDNIDPFGVS
FT                   TGETTTFNITGPYGTLAVGKYDSKSRSIIYTFTDYVEKYEVSNFSTILPYFIDRYAVTR
FT                   DADINISTSVGSQTNTARVRVLYTPYYGATDSYSPVNIGSMITKLDEKNGTFTNYIYIN
FT                   PMQQFIRNGKLTFQGGGSAIIDNETQVTLFKVNNSTDMPPSWGITDSTLRVENDILVNK
FT                   KQGEISVDFENILEARNSFIMKVVGKIASSGTSVRTSATLSQKYDNTYGYYSTNGRWIP
FT                   KGPYSEYYRYDTTAILHSGDSNVDGAIRISVTNRKNSVAFTKTNGLEKPLEATFELRRL
FT                   NSNKTFTSVKTTKSTKDTGKFSFEGMESGSYEVWETQSPEGYLKPDKAVATFKVDKDGT
FT                   IKDLTPDNGKIINYPNTAKIIFTKMLASEKEELSPATKEKSATFSLWRLKEESLKETNT
FT                   VSQAYDEQYYEPVMENNSVRTVTSDSSGNVLFDKLSPGFYAIKEEKAPDGYVKQQGIVR
FT                   IFQVDSSGKVIKYQYFKDKSIAGKLTEITDLETEQLKQFNEIINKKFVFPMTGGQGIAL
FT                   LMIIGGTMMGIAYFGHRRKQRLND"
FT   gene            128002..130164
FT                   /locus_tag="MGAS10750_Spy0116"
FT   CDS_pept        128002..130164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0116"
FT                   /product="Cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37066"
FT                   /db_xref="GOA:Q1J8U5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032332"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR032364"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U5"
FT                   /protein_id="ABF37066.1"
FT                   /translation="MKTKIFSRLAAVLLVLGSLLPTVVAVAEAESSHKTDVVIHKIKMT
FT                   SLKGWPKEKNPDGTYTGLGDKNYNGEKIDTITSYFGEGAEELDGVSFTYWSVDKEKYKK
FT                   LTKNPQNYDTVPKMKAFLQGTEKNKALENSSETIDGKTTGHTADKGGVKVKDLADGYYW
FT                   FVENSGSNIANGETLSSSAAVPFGLELPVYKADGSTITELHVYPKNTTTKPKIDKNFSK
FT                   DEKDAALAGGANYDYYQKDKGYVSRIIGSEVSYQIKTEIPAGAQYQTLRWEDTMTKGLT
FT                   YKAGSLELTITTKGDGKAALNFEFQTDYKLTENQSGFVLKFTESGLEKVKKAVQATKDA
FT                   KGQVTADGHPMTVDISYKATVNSDAVVDQPDKNTVIFDYSNNPKEHKDPREKSTKPKDK
FT                   QITVEKTWASQSAPTGIAVTYYLYQKGDESGKDKVVDSVTLTTDYKHIFTNLDDSKDYY
FT                   VKESAIGYTPEYTEAKDGKISIKNTKDDKNPDPLKPTSPAIVTHGKKFVKTSQDDERLK
FT                   GATFVVVDQKTNEKYLAIKADEKQSAEEKAYHDTEQKYQDEVKKATTEKPNSQAIEKAK
FT                   KARDDAFKKARTAYEWVSDKQKAVKFTSNSKGQFEVTGLAAGTYYLEEVAAPTGFAKLQ
FT                   EKVEFTLGFNSYNGHKDQSGQSLEGHTQYEKGTPDFGYGQRVINKKITIPQTGGIGTVI
FT                   FTVVGLAIMTVTGLMMIRRNKNDKSE"
FT   gene            130177..131022
FT                   /locus_tag="MGAS10750_Spy0117"
FT   CDS_pept        130177..131022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0117"
FT                   /product="Cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37067"
FT                   /db_xref="GOA:Q1J8U4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U4"
FT                   /protein_id="ABF37067.1"
FT                   /translation="MGGTQLKIGRLIRLMLSICACLYFLTSPIFALQKTSSVTIHFENS
FT                   DKDTQLALWQLPEGQTLPELETLFEKTDAELTRQYPQVSTVTVPKGETKLVLSNLPVGA
FT                   IYYVREAEERLGVRSLAPFILKVDTDDDQAVYTKKAKAQKRGSYPFVKVSAQGGSLEGA
FT                   TFEVWKQTQKQLQPVIKGSSRYLLTSSKDGSFMARDLPFGSYVLKEITAPKGYLLSKKT
FT                   IPFEVTDYSEKQAPVKVVNQPKIPPRIEIPYTGNAIMILVVLLGFALFTLGVYLVRRNG
FT                   "
FT   gene            131104..131976
FT                   /locus_tag="MGAS10750_Spy0118"
FT   CDS_pept        131104..131976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0118"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37068"
FT                   /db_xref="GOA:Q1J8U3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U3"
FT                   /protein_id="ABF37068.1"
FT                   /translation="MKKQSKRHRLNQNIALIVVFLIGLTILLYPQISRIYYTIESNYQS
FT                   KQFDREKSTLHQEDISQRIALAKAFNASLHDVDLKDPYSDDEKTKGRAEYARMLELHEQ
FT                   IGHVEIPKIRVDLPIYAGTSDEIISKGSGHLEGTSLPVGGENTHTVLTSHSGLPSAKLF
FT                   SDLAKLKKGDIFYIHNIKEILAYQIDQIKIIEPDNFSDLLIVPGKDYATLLTCTPVGIN
FT                   THRLIVRGHRVPYVSNEHKNNKQKASSGYMCYLFVLLALLTLLFGYWFYRQKKKKSQKV
FT                   KREEFHAKE"
FT   gene            131963..132796
FT                   /locus_tag="MGAS10750_Spy0119"
FT   CDS_pept        131963..132796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0119"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37069"
FT                   /db_xref="GOA:Q1J8U2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U2"
FT                   /protein_id="ABF37069.1"
FT                   /translation="MLKNKQSLSLRERLIQVMFPLLFLMGCLIVLYPLMSNYYYRVKQN
FT                   QAVTSFESAKVIVNKDDIKRRMALARAYNATLDPGRINDPYTDLEKKGVAEYARMLELN
FT                   EQIGYVEVPRFDINLPIYAGTSDDVLQKAAGHLEGTSLPIGGDSTHTVITAHTGLPQAK
FT                   LFTNIHKMKKGDLFFIHNIDKTLAYKVDQILVVEPDNFTPVLVKNGFDYATLLTCTPYG
FT                   INSHRLLVRGYRVPYQKAFEKADAQRPWYTKVIFLVSFLLFVILVIILLIDWHRK"
FT   gene            132816..133532
FT                   /locus_tag="MGAS10750_Spy0120"
FT   CDS_pept        132816..133532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0120"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37070"
FT                   /db_xref="GOA:Q1J8U1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U1"
FT                   /protein_id="ABF37070.1"
FT                   /translation="MSKQKCVGYVLMILGLGLPLFFLTLMSLNQFQEQVAYQKFQTENR
FT                   SWKNSQKEWVNRHNQEQALADRATTDPFVDAQNQLKQSPFDDNIIGYIIIPKLRMAQPI
FT                   RVGASERHLEKGVAQVTGTSLPIGGLGTRSVIAGHRSWYDNERFLRIAELSLGDQIVID
FT                   LGVYQLEYRVKSVEIIDAKDWRQLTAKKSQDLITLLTCNPLYPPFNERLLVMQRECCLA
FT                   FLIYQLKREIRWINLN"
FT   gene            complement(134014..134673)
FT                   /locus_tag="MGAS10750_Spy0121"
FT   CDS_pept        complement(134014..134673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37071"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8U0"
FT                   /protein_id="ABF37071.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEEGKVHLYWQGNY
FT                   YVDNYVDYTKKLVNNSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPKEITYEHHYGNGT
FT                   VDSKKRSNTQWHYDWEKQKTNFNQEFDKFPGYTGWSRSLDKFYKLKNEGKFSHVLVDTY
FT                   GRQSHTYFSHKMVWKFKTELEDNYKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            134993..136432
FT                   /gene="atoE"
FT                   /locus_tag="MGAS10750_Spy0122"
FT   CDS_pept        134993..136432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="MGAS10750_Spy0122"
FT                   /product="Short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37072"
FT                   /db_xref="GOA:Q1J8T9"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T9"
FT                   /protein_id="ABF37072.1"
FT                   /translation="MLLDNVKGIDNMNNIKTKKRFMDRYIDGFMKWMPESLFICFILTF
FT                   LVVTMSVLMTDSPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHK
FT                   MFKSLAKLPQTRTQIFIFSLVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTP
FT                   LFVATLFFTFLPATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFI
FT                   SLLVVCMLVPLCFTLLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRL
FT                   VMYLVGGAIVSYSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVM
FT                   SSWGLVLQFPFYAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSG
FT                   GSKFVIEAPYIVPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIV
FT                   AYTIPCVLVVTGIAIIYLFVF"
FT   gene            complement(136500..137411)
FT                   /locus_tag="MGAS10750_Spy0123"
FT   CDS_pept        complement(136500..137411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0123"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37073"
FT                   /db_xref="GOA:Q1J8T8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T8"
FT                   /protein_id="ABF37073.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   VVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDATIADIDI
FT                   LLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLP
FT                   VVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHN
FT                   KTSHLKHYIKHTILDYFTNQRF"
FT   gene            137532..138716
FT                   /locus_tag="MGAS10750_Spy0124"
FT   CDS_pept        137532..138716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0124"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37074"
FT                   /db_xref="GOA:Q1J8T7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T7"
FT                   /protein_id="ABF37074.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPK
FT                   FGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            138671..139387
FT                   /gene="atoD2"
FT                   /locus_tag="MGAS10750_Spy0125"
FT   CDS_pept        138671..139387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoD2"
FT                   /locus_tag="MGAS10750_Spy0125"
FT                   /product="Acetate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37075"
FT                   /db_xref="GOA:Q1J8T6"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T6"
FT                   /protein_id="ABF37075.1"
FT                   /translation="MYWWWPRSKYHRNKIEGNRMKENKRIAIAEAISHIKDGDTIMVGG
FT                   FMANGTPEALIDALVDKGTKDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEA
FT                   GRQMTAGETTIELIPQGTFAEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLL
FT                   EYPFEADVALIFANKADEMGNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPEC
FT                   VHTPHIFVDYIVKEGV"
FT   gene            139390..140037
FT                   /locus_tag="MGAS10750_Spy0126"
FT   CDS_pept        139390..140037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0126"
FT                   /product="Acetate CoA-transferase beta subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37076"
FT                   /db_xref="GOA:Q1J8T5"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T5"
FT                   /protein_id="ABF37076.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   gene            complement(140159..140839)
FT                   /locus_tag="MGAS10750_Spy0127"
FT   CDS_pept        complement(140159..140839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0127"
FT                   /product="Putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37077"
FT                   /db_xref="GOA:Q1J8T4"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T4"
FT                   /protein_id="ABF37077.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            141013..141378
FT                   /locus_tag="MGAS10750_Spy0128"
FT   CDS_pept        141013..141378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0128"
FT                   /product="Translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37078"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T3"
FT                   /protein_id="ABF37078.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            141415..142434
FT                   /gene="sloR"
FT                   /locus_tag="MGAS10750_Spy0129"
FT   CDS_pept        141415..142434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sloR"
FT                   /locus_tag="MGAS10750_Spy0129"
FT                   /product="Transcriptional regulator pfoR"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37079"
FT                   /db_xref="GOA:Q1J8T2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T2"
FT                   /protein_id="ABF37079.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSRTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            142885..143208
FT                   /locus_tag="MGAS10750_Spy0130"
FT   CDS_pept        142885..143208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37080"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T1"
FT                   /protein_id="ABF37080.1"
FT                   /translation="MMNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEY
FT                   EQETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVET
FT                   YGH"
FT   gene            143198..145198
FT                   /gene="ntpI"
FT                   /locus_tag="MGAS10750_Spy0131"
FT   CDS_pept        143198..145198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="MGAS10750_Spy0131"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37081"
FT                   /db_xref="GOA:Q1J8T0"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8T0"
FT                   /protein_id="ABF37081.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEESHRQQAAQTALKMMSQKIERLEQLQNKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANDHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   gene            145158..145679
FT                   /gene="ntpK"
FT                   /locus_tag="MGAS10750_Spy0132"
FT   CDS_pept        145158..145679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpK"
FT                   /locus_tag="MGAS10750_Spy0132"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37082"
FT                   /db_xref="GOA:Q1J8S9"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S9"
FT                   /protein_id="ABF37082.1"
FT                   /translation="MSMSMKKQIWRTINMEHLAHYFTAHGGVFFAALGIVLAVALSGMG
FT                   SAYGVGKGGQAAAALLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQ
FT                   GLAYFLVSLPIAIVGYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFV
FT                   VSFILLNKIG"
FT   gene            145748..146332
FT                   /gene="ntpE"
FT                   /locus_tag="MGAS10750_Spy0133"
FT   CDS_pept        145748..146332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpE"
FT                   /locus_tag="MGAS10750_Spy0133"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37083"
FT                   /db_xref="GOA:Q1J8S8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S8"
FT                   /protein_id="ABF37083.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   gene            146348..147346
FT                   /gene="ntpC"
FT                   /locus_tag="MGAS10750_Spy0134"
FT   CDS_pept        146348..147346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpC"
FT                   /locus_tag="MGAS10750_Spy0134"
FT                   /product="V-type sodium ATP synthase subunit C"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37084"
FT                   /db_xref="GOA:Q1J8S7"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S7"
FT                   /protein_id="ABF37084.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLAALEHLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPIA"
FT   gene            147343..147663
FT                   /gene="ntpF"
FT                   /locus_tag="MGAS10750_Spy0135"
FT   CDS_pept        147343..147663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpF"
FT                   /locus_tag="MGAS10750_Spy0135"
FT                   /product="V-type sodium ATP synthase subunit F"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37085"
FT                   /db_xref="GOA:Q1J8S6"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S6"
FT                   /protein_id="ABF37085.1"
FT                   /translation="MTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQDAINQLRQLAM
FT                   EDYGIIYITEDIAAAIPEALTHYDNQVLPAVIPLPTHQGAQGIGLSRIQAMVEKAVGQN
FT                   IL"
FT   gene            147864..149639
FT                   /gene="ntpA"
FT                   /locus_tag="MGAS10750_Spy0136"
FT   CDS_pept        147864..149639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="MGAS10750_Spy0136"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37086"
FT                   /db_xref="GOA:Q1J8S5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8S5"
FT                   /protein_id="ABF37086.1"
FT                   /translation="MNQGKIITVSGPLVVASGMQEANIQDICRVGHLGLVGEIIEMRRD
FT                   QASIQVYEETSGIGPGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLI
FT                   RGVAIPSLDRKAKWAFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIH
FT                   AGDFTVTDTVYEIKQEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFP
FT                   VTKGGAAAVPGPFGAGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPN
FT                   TGQSIMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALR
FT                   EMSGRLQEMPGDEGYPAYLGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDIS
FT                   EPVTQNTLRIVKVFWGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQQSNWSNKV
FT                   TRAMAILQREASLEEIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFP
FT                   KQEAMLTNILTFNEEASKALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQ
FT                   KVTKEIHHVLAKGGI"
FT   gene            149640..151055
FT                   /gene="ntpB"
FT                   /locus_tag="MGAS10750_Spy0137"
FT   CDS_pept        149640..151055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpB"
FT                   /locus_tag="MGAS10750_Spy0137"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37087"
FT                   /db_xref="GOA:Q1J8S4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8S4"
FT                   /protein_id="ABF37087.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            151079..151726
FT                   /gene="ntpD"
FT                   /locus_tag="MGAS10750_Spy0138"
FT   CDS_pept        151079..151726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpD"
FT                   /locus_tag="MGAS10750_Spy0138"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37088"
FT                   /db_xref="GOA:Q1J8S3"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S3"
FT                   /protein_id="ABF37088.1"
FT                   /translation="MTKGVISMARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELM
FT                   RRFVDLIRENNELRQTIEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIEN
FT                   IMSVNVPKFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTC
FT                   QLMADDIEKTRRRVNGLEYSIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(151846..153108)
FT                   /locus_tag="MGAS10750_Spy0139"
FT   CDS_pept        complement(151846..153108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0139"
FT                   /product="Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37089"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S2"
FT                   /protein_id="ABF37089.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLKEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   ATPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIINANNAALQMLAETSKEAIPALEQSAQ
FT                   NPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   gene            complement(153121..153999)
FT                   /locus_tag="MGAS10750_Spy0140"
FT   CDS_pept        complement(153121..153999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0140"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37090"
FT                   /db_xref="GOA:Q1J8S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8S1"
FT                   /protein_id="ABF37090.1"
FT                   /translation="MIRKHDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            154437..155729
FT                   /gene="purA"
FT                   /locus_tag="MGAS10750_Spy0141"
FT   CDS_pept        154437..155729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="MGAS10750_Spy0141"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37091"
FT                   /db_xref="GOA:Q1J8S0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8S0"
FT                   /protein_id="ABF37091.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHNEGVTTDNLRISDRAQV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGKRIDYYPANLEQLKRCKPIYEELPGWQEDITGVRSLEELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            156056..157099
FT                   /locus_tag="MGAS10750_Spy0142"
FT   CDS_pept        156056..157099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0142"
FT                   /product="Nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37092"
FT                   /db_xref="GOA:Q1J8R9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R9"
FT                   /protein_id="ABF37092.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSAKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEDQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEG
FT                   TITVPEN"
FT   gene            complement(157125..157238)
FT                   /locus_tag="MGAS10750_Spy0143"
FT   CDS_pept        complement(157125..157238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R8"
FT                   /protein_id="ABF37093.1"
FT                   /translation="MAFALFSITFIIIKGRAAVNVSVELLDTFIKKSKVGS"
FT   gene            157256..157810
FT                   /gene="nusG"
FT                   /locus_tag="MGAS10750_Spy0144"
FT   CDS_pept        157256..157810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="MGAS10750_Spy0144"
FT                   /product="Transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37094"
FT                   /db_xref="GOA:Q1J8R7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R7"
FT                   /protein_id="ABF37094.1"
FT                   /translation="MKGNIMLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNIL
FT                   RVEIPTQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNR
FT                   SKPTPLLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKL
FT                   MLNMFGSETVAEVELYQIAEL"
FT   gene            158172..159536
FT                   /gene="nga"
FT                   /locus_tag="MGAS10750_Spy0145"
FT   CDS_pept        158172..159536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="MGAS10750_Spy0145"
FT                   /product="NAD glycohydrolase"
FT                   /EC_number="3.2.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37095"
FT                   /db_xref="GOA:Q1J8R6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="InterPro:IPR041934"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R6"
FT                   /protein_id="ABF37095.1"
FT                   /translation="MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKE
FT                   NKKSDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASP
FT                   MHIGRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEI
FT                   DKKLDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADE
FT                   FIETADKYADKAVQMSAVASRAEYYRMYVSRKYQYKKEFVEKLKQVYKESGASHVTSKK
FT                   DLMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYS
FT                   DGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPS
FT                   ISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   gene            159541..160026
FT                   /gene="ifs"
FT                   /locus_tag="MGAS10750_Spy0146"
FT   CDS_pept        159541..160026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ifs"
FT                   /locus_tag="MGAS10750_Spy0146"
FT                   /product="streptococcal NAD glycohydrolase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37096"
FT                   /db_xref="GOA:Q1J8R5"
FT                   /db_xref="InterPro:IPR032002"
FT                   /db_xref="InterPro:IPR038509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R5"
FT                   /protein_id="ABF37096.1"
FT                   /translation="MYKVPKGLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMG
FT                   DISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALDIYQAVQTLNAENMLLN
FT                   YYESLPFYLNRQSILANMTKVLKDAHIREAMAHYKLGEFAHYQDTMLDMVERTIKTF"
FT   gene            160041..161765
FT                   /gene="slo"
FT                   /locus_tag="MGAS10750_Spy0147"
FT   CDS_pept        160041..161765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="MGAS10750_Spy0147"
FT                   /product="Streptolysin O"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37097"
FT                   /db_xref="GOA:Q1J8R4"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R4"
FT                   /protein_id="ABF37097.1"
FT                   /translation="MKDMSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTE
FT                   TTTTNEQPKPESSELTTEKAGQKTDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKS
FT                   EEDHTEEINDKIYSLNYNELEVLAKNGETIENFAPKEGVKKADKFIVIERKKKNINTTP
FT                   VDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVND
FT                   PTYANVSTAIDNLINQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTL
FT                   GIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFAKSVTFKELQRKGVSNEAPPL
FT                   FVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGG
FT                   DAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVET
FT                   TSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVI
FT                   PLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            162020..162373
FT                   /locus_tag="MGAS10750_Spy0148"
FT   CDS_pept        162020..162373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37098"
FT                   /db_xref="GOA:Q1J8R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R3"
FT                   /protein_id="ABF37098.1"
FT                   /translation="MKQQSYQPLRFVYLLVALFAALLLIARPVMADEENDPWILGYKQG
FT                   LTKGKEAGKAADWTDLTPPDQEPPSDIEEANKEGYKDGYRDGYNEGFGESYPLLIPVKF
FT                   IWGIILHWWGKLI"
FT   gene            complement(162657..162887)
FT                   /locus_tag="MGAS10750_Spy0149"
FT   CDS_pept        complement(162657..162887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R2"
FT                   /protein_id="ABF37099.1"
FT                   /translation="MKKKLSLFMIATAAVVGLSLATPENQTVSANAQTPAVQNCENGCC
FT                   DRPFFGYCGPFSWLYYNTRYFLGYSDTATNQ"
FT   gene            complement(163299..163466)
FT                   /locus_tag="MGAS10750_Spy0150"
FT   CDS_pept        complement(163299..163466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R1"
FT                   /protein_id="ABF37100.1"
FT                   /translation="MKKKLSLFMIATAAVASLSLATLGSHQTVSANDASYSNGFYGHTG
FT                   PDSWLLYTVW"
FT   gene            complement(163638..163886)
FT                   /locus_tag="MGAS10750_Spy0151"
FT   CDS_pept        complement(163638..163886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8R0"
FT                   /protein_id="ABF37101.1"
FT                   /translation="MKNKLFLVALATITVLGPFLATPHHQTVHAAEQTVTKKTATETCT
FT                   LDGKICYGYEISMKTTPIAWFNLSLKSKVSSVGFGHK"
FT   gene            164118..165509
FT                   /gene="metB"
FT                   /locus_tag="MGAS10750_Spy0152"
FT   CDS_pept        164118..165509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="MGAS10750_Spy0152"
FT                   /product="Cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37102"
FT                   /db_xref="GOA:Q1J8Q9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q9"
FT                   /protein_id="ABF37102.1"
FT                   /translation="MLAAWSKMIKGLANLAKGCIINVIDLKMILLEKFIIHLKGAHYFS
FT                   YRLADHAFLKSFLVCATIGVGPLSKREFIGVNAIAEVHEMRENTTLLHGYTVIDEFTGA
FT                   ASVPIYQTSTFHNSELYCPSQKHLYTRFSNPTTEALEDGLACLEKATYAVAYASGMAAI
FT                   STVLMLLKAGDHVIFPLEVYGGTCQFATAILPNYQIETSFVDMADLATVKASIRPNTRM
FT                   IYLETPSNPLLKICDISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKF
FT                   INGHSDVVAGLAATNNEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKN
FT                   AQQLANYLAKHPKVLKVHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMTFTHRI
FT                   QLPILAVSLGGVESILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLADFE
FT                   QALAF"
FT   gene            165721..168222
FT                   /gene="leuS"
FT                   /locus_tag="MGAS10750_Spy0153"
FT   CDS_pept        165721..168222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MGAS10750_Spy0153"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37103"
FT                   /db_xref="GOA:Q1J8Q8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8Q8"
FT                   /protein_id="ABF37103.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIDKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGNEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSDFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   gene            168529..169962
FT                   /locus_tag="MGAS10750_Spy0154"
FT   CDS_pept        168529..169962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0154"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37104"
FT                   /db_xref="GOA:Q1J8Q7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q7"
FT                   /protein_id="ABF37104.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPIFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSNVELIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QLQFAKAKDKEAYYRGEAQ"
FT   gene            170033..170311
FT                   /locus_tag="MGAS10750_Spy0155"
FT   CDS_pept        170033..170311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0155"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37105"
FT                   /db_xref="GOA:Q1J8Q6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q6"
FT                   /protein_id="ABF37105.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            170434..170919
FT                   /locus_tag="MGAS10750_Spy0156"
FT   CDS_pept        170434..170919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0156"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37106"
FT                   /db_xref="GOA:Q1J8Q5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q5"
FT                   /protein_id="ABF37106.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVQLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKNSPYLEGLDLDA"
FT   gene            171026..171688
FT                   /locus_tag="MGAS10750_Spy0157"
FT   CDS_pept        171026..171688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0157"
FT                   /product="3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37107"
FT                   /db_xref="GOA:Q1J8Q4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q4"
FT                   /protein_id="ABF37107.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAIK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKKL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIKRIWG"
FT   gene            171651..172556
FT                   /locus_tag="MGAS10750_Spy0158"
FT   CDS_pept        171651..172556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0158"
FT                   /product="L-xylulose 5-phosphate 3-epimerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37108"
FT                   /db_xref="GOA:Q1J8Q3"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q3"
FT                   /protein_id="ABF37108.1"
FT                   /translation="MPSKMKSNVSGGNFMARPIGIYEKATPKQFTWRERLQFAKDLGFD
FT                   FVEMSVDESDARLARLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPATEA
FT                   KSLKLMKQCIELAQDLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVML
FT                   SIEIMDDPFINSIEKYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALH
FT                   LKDTYAVTETSKGQFRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETK
FT                   AAIKEAQDFLYPLIEKAGLA"
FT   gene            172534..173262
FT                   /gene="araD"
FT                   /locus_tag="MGAS10750_Spy0159"
FT   CDS_pept        172534..173262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="MGAS10750_Spy0159"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37109"
FT                   /db_xref="GOA:Q1J8Q2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q2"
FT                   /protein_id="ABF37109.1"
FT                   /translation="MRKRGWHNMAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCR
FT                   ELGRIVIKPSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIV
FT                   HTHSTEAVGWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEF
FT                   SKRGLDPMAVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVAKMNRLTEQINPRVEPAPR
FT                   YIMDKHYLRKHGPNAYYGQK"
FT   gene            173320..173466
FT                   /locus_tag="MGAS10750_Spy0160"
FT   CDS_pept        173320..173466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q1"
FT                   /protein_id="ABF37110.1"
FT                   /translation="MLIIVWASPFDLSFSMNCLNANEHKLDESYVVEFLETRYKVLVLD
FT                   QLR"
FT   gene            173587..175233
FT                   /locus_tag="MGAS10750_Spy0161"
FT   CDS_pept        173587..175233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0161"
FT                   /product="Transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37111"
FT                   /db_xref="GOA:Q1J8Q0"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8Q0"
FT                   /protein_id="ABF37111.1"
FT                   /translation="MMILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKI
FT                   NKALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVS
FT                   TERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQ
FT                   YLYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTIN
FT                   TQDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFK
FT                   LHLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDL
FT                   LKQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDD
FT                   IAYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQ
FT                   YQSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTE
FT                   LTKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            175486..176577
FT                   /locus_tag="MGAS10750_Spy0162"
FT   CDS_pept        175486..176577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0162"
FT                   /product="Metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37112"
FT                   /db_xref="GOA:Q1J8P9"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P9"
FT                   /protein_id="ABF37112.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLDHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            177065..178261
FT                   /gene="opuAA"
FT                   /locus_tag="MGAS10750_Spy0163"
FT   CDS_pept        177065..178261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="MGAS10750_Spy0163"
FT                   /product="Glycine betaine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37113"
FT                   /db_xref="GOA:Q1J8P8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P8"
FT                   /protein_id="ABF37113.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILKNTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            178277..180004
FT                   /gene="opuABC"
FT                   /locus_tag="MGAS10750_Spy0164"
FT   CDS_pept        178277..180004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuABC"
FT                   /locus_tag="MGAS10750_Spy0164"
FT                   /product="Glycine betaine-binding protein / Glycine betaine
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37114"
FT                   /db_xref="GOA:Q1J8P7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P7"
FT                   /protein_id="ABF37114.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAVFLIAALGRGIMAMTSGMADKGETVNIAYVQWDSEVASTHV
FT                   IAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGP
FT                   NLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLSSWE
FT                   LVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENINTIA
FT                   RKGLKKDLPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   gene            180135..182777
FT                   /gene="polA"
FT                   /locus_tag="MGAS10750_Spy0165"
FT   CDS_pept        180135..182777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="MGAS10750_Spy0165"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37115"
FT                   /db_xref="GOA:Q1J8P6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P6"
FT                   /protein_id="ABF37115.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVQPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPEEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTAAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKTSKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAVISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRTTLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDKHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   gene            182963..183418
FT                   /locus_tag="MGAS10750_Spy0166"
FT   CDS_pept        182963..183418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0166"
FT                   /product="CoA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37116"
FT                   /db_xref="GOA:Q1J8P5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P5"
FT                   /protein_id="ABF37116.1"
FT                   /translation="MIYSFQNPSEAVLKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   gene            183470..183937
FT                   /gene="perR"
FT                   /locus_tag="MGAS10750_Spy0167"
FT   CDS_pept        183470..183937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="MGAS10750_Spy0167"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37117"
FT                   /db_xref="GOA:Q1J8P4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P4"
FT                   /protein_id="ABF37117.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   gene            complement(184039..184902)
FT                   /locus_tag="MGAS10750_Spy0168"
FT   CDS_pept        complement(184039..184902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0168"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37118"
FT                   /db_xref="GOA:Q1J8P3"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P3"
FT                   /protein_id="ABF37118.1"
FT                   /translation="MSIKAIKSQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGSSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDKVKEGTYLGAIAVIKTSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   gene            184939..185124
FT                   /locus_tag="MGAS10750_Spy0169"
FT   CDS_pept        184939..185124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P2"
FT                   /protein_id="ABF37119.1"
FT                   /translation="MRQLTIILTILFWESMTNYGFFDKMIGARTTCHLEALHYDGNSGR
FT                   SKKLKTVYLDSKEEST"
FT   gene            185121..186263
FT                   /gene="tgt"
FT                   /locus_tag="MGAS10750_Spy0170"
FT   CDS_pept        185121..186263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="MGAS10750_Spy0170"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37120"
FT                   /db_xref="GOA:Q1J8P1"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8P1"
FT                   /protein_id="ABF37120.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVVKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            186480..186791
FT                   /locus_tag="MGAS10750_Spy0171"
FT   CDS_pept        186480..186791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0171"
FT                   /product="Zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37121"
FT                   /db_xref="GOA:Q1J8P0"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8P0"
FT                   /protein_id="ABF37121.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   ADHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            186795..187334
FT                   /locus_tag="MGAS10750_Spy0172"
FT   CDS_pept        186795..187334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0172"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37122"
FT                   /db_xref="GOA:Q1J8N9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N9"
FT                   /protein_id="ABF37122.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALFISGVLLVDVMGAIWLAAYTGMPLMTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            187474..188253
FT                   /locus_tag="MGAS10750_Spy0173"
FT   CDS_pept        187474..188253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0173"
FT                   /product="Metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37123"
FT                   /db_xref="GOA:Q1J8N8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N8"
FT                   /protein_id="ABF37123.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVEQIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPEGI
FT                   NSKNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            188229..188768
FT                   /locus_tag="MGAS10750_Spy0174"
FT   CDS_pept        188229..188768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0174"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37124"
FT                   /db_xref="GOA:Q1J8N7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N7"
FT                   /protein_id="ABF37124.1"
FT                   /translation="MELGESFLMPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKD
FT                   GEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGL
FT                   ARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRER
FT                   KKIAKHLIKEQSDPFD"
FT   gene            complement(189382..190614)
FT                   /locus_tag="MGAS10750_Spy0175"
FT   CDS_pept        complement(189382..190614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0175"
FT                   /product="S-layer protein / Peptidoglycan
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37125"
FT                   /db_xref="GOA:Q1J8N6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N6"
FT                   /protein_id="ABF37125.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASKKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANTPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDYLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAI
FT                   LASLENQLLNRQEQLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   gene            190656..190763
FT                   /locus_tag="MGAS10750_Spy0176"
FT   CDS_pept        190656..190763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0176"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37126"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N5"
FT                   /protein_id="ABF37126.1"
FT                   /translation="MGRGKDFQKAKSCLERVMIFLGIQSILSQNEAILT"
FT   gene            191215..191532
FT                   /locus_tag="MGAS10750_Spy0177"
FT   CDS_pept        191215..191532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N4"
FT                   /protein_id="ABF37127.1"
FT                   /translation="MKKIIRNYSQLFAIALASGLIFSSSQAYAAEIQQETFKTKQETFK
FT                   TKIEAIYQALLTIENAPFNQYYTIKEIPGSDGQPSKFVYEVSILEKVGSIGPKDSSEIN
FT                   E"
FT   gene            191810..191929
FT                   /locus_tag="MGAS10750_Spy0178"
FT   CDS_pept        191810..191929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0178"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N3"
FT                   /protein_id="ABF37128.1"
FT                   /translation="MRKYLQVIGASIAFAGVALCIDHMYDGVITRIEMIKSLK"
FT   gene            192172..193530
FT                   /gene="pgi"
FT                   /locus_tag="MGAS10750_Spy0179"
FT   CDS_pept        192172..193530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="MGAS10750_Spy0179"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37129"
FT                   /db_xref="GOA:Q1J8N2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8N2"
FT                   /protein_id="ABF37129.1"
FT                   /translation="MKLMSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPG
FT                   SDFLGWLDLPENYDKDEFARILTAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNHHFA
FT                   NLQTAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFK
FT                   ELLVKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLP
FT                   IAASGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSL
FT                   QYFGEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDKPRK
FT                   NVIIPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGY
FT                   TIYFFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEELSAELNARL"
FT   gene            complement(193879..194799)
FT                   /locus_tag="MGAS10750_Spy0180"
FT   CDS_pept        complement(193879..194799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0180"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37130"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N1"
FT                   /protein_id="ABF37130.1"
FT                   /translation="MFFDVLLMLTWKRHRYPVHLPHLALFEHLKSLPIFDNIKTIAVDE
FT                   LAPRTRVTFSSDDFDYLFLIYLTTDNSFLSGYWTSHQRQQLYHLITKDPDYHLLIHRLQ
FT                   ALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQYQGNMLLLDKLETVIKDWL
FT                   YDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQETVGNVIANFITSTIPSYK
FT                   VELSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFPKETRLFGLSLDCIQQQRED
FT                   LIKTILALHQNHYQKRLEELWRVPS"
FT   gene            complement(194811..195386)
FT                   /locus_tag="MGAS10750_Spy0181"
FT   CDS_pept        complement(194811..195386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0181"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37131"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8N0"
FT                   /protein_id="ABF37131.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFAAQKTYNLLPF"
FT   gene            195932..196132
FT                   /locus_tag="MGAS10750_Spy0182"
FT   CDS_pept        195932..196132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0182"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37132"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J540"
FT                   /protein_id="ABF37132.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETWKEMEDFIEMNDCLRPTLI"
FT   gene            196217..197005
FT                   /locus_tag="MGAS10750_Spy0183"
FT   CDS_pept        196217..197005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0183"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37133"
FT                   /db_xref="GOA:Q1J8M8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M8"
FT                   /protein_id="ABF37133.1"
FT                   /translation="MSNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIEVREYWVSSDIKWLCQNRPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRDHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLRVMVFPKKGLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            196989..197114
FT                   /locus_tag="MGAS10750_Spy0184"
FT   CDS_pept        196989..197114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37134"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M7"
FT                   /protein_id="ABF37134.1"
FT                   /translation="MEKEAKQMIDLKRNLFKIDVRAQKDEEKGFMRTAWLVSCQP"
FT   gene            197090..197182
FT                   /locus_tag="MGAS10750_Spy0185"
FT   CDS_pept        197090..197182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37135"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M6"
FT                   /protein_id="ABF37135.1"
FT                   /translation="MASFLSALNLFPNLWYDKKMMKKEILKELF"
FT   gene            197195..197302
FT                   /locus_tag="MGAS10750_Spy0186"
FT   CDS_pept        197195..197302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0186"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M5"
FT                   /protein_id="ABF37136.1"
FT                   /translation="MDVDLKRQNDQALLVDVVSNQAYQRANTIAKSNDL"
FT   gene            197330..198001
FT                   /locus_tag="MGAS10750_Spy0187"
FT   CDS_pept        197330..198001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0187"
FT                   /product="Integral membrane protein"
FT                   /note="Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37137"
FT                   /db_xref="GOA:Q1J8M4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M4"
FT                   /protein_id="ABF37137.1"
FT                   /translation="MTRLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(198101..199006)
FT                   /gene="hasC"
FT                   /locus_tag="MGAS10750_Spy0188"
FT   CDS_pept        complement(198101..199006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasC"
FT                   /locus_tag="MGAS10750_Spy0188"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37138"
FT                   /db_xref="GOA:Q1J8M3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M3"
FT                   /protein_id="ABF37138.1"
FT                   /translation="MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVE
FT                   EALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIR
FT                   QSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIA
FT                   VMRVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSI
FT                   LEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQV
FT                   KDDLKAYIIQLGKALEKTKP"
FT   gene            complement(199033..200049)
FT                   /gene="gpsA"
FT                   /locus_tag="MGAS10750_Spy0189"
FT   CDS_pept        complement(199033..200049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="MGAS10750_Spy0189"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37139"
FT                   /db_xref="GOA:Q1J8M2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8M2"
FT                   /protein_id="ABF37139.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            200347..200796
FT                   /locus_tag="MGAS10750_Spy0190"
FT   CDS_pept        200347..200796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0190"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37140"
FT                   /db_xref="GOA:Q1J8M1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M1"
FT                   /protein_id="ABF37140.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            200789..202495
FT                   /locus_tag="MGAS10750_Spy0191"
FT   CDS_pept        200789..202495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0191"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37141"
FT                   /db_xref="GOA:Q1J8M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8M0"
FT                   /protein_id="ABF37141.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINRIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIVVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLVQLIPRLFDPQDGQILLGGKPIKILSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            202495..204282
FT                   /locus_tag="MGAS10750_Spy0192"
FT   CDS_pept        202495..204282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0192"
FT                   /product="Multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37142"
FT                   /db_xref="GOA:Q1J8L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L9"
FT                   /protein_id="ABF37142.1"
FT                   /translation="MMKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLT
FT                   ELGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHS
FT                   TNRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIG
FT                   LVWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQ
FT                   KAIIVQGVQEDTMTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTI
FT                   VLSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEE
FT                   VRPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPKGKMIAVVGPTGSGKTTIM
FT                   NLINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQIIS
FT                   QDMVETAARATHIHDFIMSLPRGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILD
FT                   EATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHE
FT                   LLHQKGFYAELYHNQFVFE"
FT   gene            204400..205167
FT                   /locus_tag="MGAS10750_Spy0193"
FT   CDS_pept        204400..205167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0193"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37143"
FT                   /db_xref="GOA:Q1J8L8"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L8"
FT                   /protein_id="ABF37143.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWAKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            205277..205723
FT                   /locus_tag="MGAS10750_Spy0194"
FT   CDS_pept        205277..205723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0194"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37144"
FT                   /db_xref="GOA:Q1J8L7"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L7"
FT                   /protein_id="ABF37144.1"
FT                   /translation="MTKIRGFELVSSFTNNDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIIMINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NIIDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            205804..207165
FT                   /gene="radA"
FT                   /locus_tag="MGAS10750_Spy0195"
FT   CDS_pept        205804..207165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="MGAS10750_Spy0195"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37145"
FT                   /db_xref="GOA:Q1J8L6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L6"
FT                   /protein_id="ABF37145.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLKAVFS"
FT   gene            207351..207851
FT                   /locus_tag="MGAS10750_Spy0196"
FT   CDS_pept        207351..207851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0196"
FT                   /product="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37146"
FT                   /db_xref="GOA:Q1J8L5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L5"
FT                   /protein_id="ABF37146.1"
FT                   /translation="MMSYFEHFMAANQAYLALHGTAHLPLKPKTKVAIVTCMDSRLHVA
FT                   QALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFA
FT                   KHIHEHLGVDVSGQDFLPFQDVEDSVREDMAKIRASSLISDDVVINGAVYDVDTGKMTQ
FT                   VME"
FT   gene            207946..208692
FT                   /locus_tag="MGAS10750_Spy0197"
FT   CDS_pept        207946..208692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37147"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L4"
FT                   /protein_id="ABF37147.1"
FT                   /translation="MYQVIHTNKESKMVDNRMRFTIDQNMQFPLVEIDLEHGGSVYLQQ
FT                   GSMVYHTENVTLNTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNT
FT                   PGQIVALELGEKQYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTL
FT                   LANSFGSIKKITLDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGH
FT                   GEIYIQSLNLEQFAGTLKRYLPTSSN"
FT   gene            208874..210319
FT                   /gene="gltX"
FT                   /locus_tag="MGAS10750_Spy0198"
FT   CDS_pept        208874..210319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="MGAS10750_Spy0198"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37148"
FT                   /db_xref="GOA:Q1J8L3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8L3"
FT                   /protein_id="ABF37148.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYISEREAAGVVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            210714..211883
FT                   /gene="fasB"
FT                   /locus_tag="MGAS10750_Spy0199"
FT   CDS_pept        210714..211883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasB"
FT                   /locus_tag="MGAS10750_Spy0199"
FT                   /product="Sensory transduction protein kinase FasB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37149"
FT                   /db_xref="GOA:Q1J8L2"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L2"
FT                   /protein_id="ABF37149.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLLVYLLSYFNHSSKEYLKT
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKR"
FT   gene            212056..213339
FT                   /gene="fasC"
FT                   /locus_tag="MGAS10750_Spy0200"
FT   CDS_pept        212056..213339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasC"
FT                   /locus_tag="MGAS10750_Spy0200"
FT                   /product="Sensory transduction protein kinase FasC"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37150"
FT                   /db_xref="GOA:Q1J8L1"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L1"
FT                   /protein_id="ABF37150.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSIIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFIYLAIFIWVIVKLDRFAKDQLSQKLTQAQNE
FT                   RIAYLENYNQSIEQLYREIRTVKHDSENILISLKDSIDSGDIDLITRVYDTVIQQSATS
FT                   MMRTNYEISSLDNIKEAVIRSIMNSKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLF
FT                   TGLVDNAIETAKGSRRPFLSIAYFKQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHF
FT                   LTVLDSYPQITLSTKSDHYRLRQLLEMR"
FT   gene            213343..214083
FT                   /gene="fasA"
FT                   /locus_tag="MGAS10750_Spy0201"
FT   CDS_pept        213343..214083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasA"
FT                   /locus_tag="MGAS10750_Spy0201"
FT                   /product="Response regulator FasA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37151"
FT                   /db_xref="GOA:Q1J8L0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8L0"
FT                   /protein_id="ABF37151.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTRTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            214623..214982
FT                   /gene="fasX"
FT                   /locus_tag="MGAS10750_Spy0202"
FT   CDS_pept        214623..214982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasX"
FT                   /locus_tag="MGAS10750_Spy0202"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37152"
FT                   /db_xref="GOA:Q1J8K9"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8K9"
FT                   /protein_id="ABF37152.1"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            214948..215775
FT                   /locus_tag="MGAS10750_Spy0203"
FT   CDS_pept        214948..215775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0203"
FT                   /product="60 kDa inner membrane protein YIDC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37153"
FT                   /db_xref="GOA:Q1J8K8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K8"
FT                   /protein_id="ABF37153.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKARRLRERRARKKAMKRK"
FT   gene            215787..216701
FT                   /locus_tag="MGAS10750_Spy0204"
FT   CDS_pept        215787..216701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0204"
FT                   /product="Jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37154"
FT                   /db_xref="GOA:Q1J8K7"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K7"
FT                   /protein_id="ABF37154.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINQKNAPAVNSADVEPEEIKATQKLEAEDTK
FT                   VVPLMPEESPAQTLSNLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            217015..217149
FT                   /gene="rpmH"
FT                   /locus_tag="MGAS10750_Spy0205"
FT   CDS_pept        217015..217149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="MGAS10750_Spy0205"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37155"
FT                   /db_xref="GOA:Q1J8K6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8K6"
FT                   /protein_id="ABF37155.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            217425..218129
FT                   /locus_tag="MGAS10750_Spy0206"
FT   CDS_pept        217425..218129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0206"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37156"
FT                   /db_xref="GOA:Q1J8K5"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8K5"
FT                   /protein_id="ABF37156.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLLAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   gene            218178..219497
FT                   /locus_tag="MGAS10750_Spy0207"
FT   CDS_pept        218178..219497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0207"
FT                   /product="N-acetylneuraminate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37157"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K4"
FT                   /protein_id="ABF37157.1"
FT                   /translation="MNMKKLASLAMLGASVLGLAACGGKSQKEADASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTEEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFITDDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMEKIAEWTKFYSPYYNTIDGF
FT                   AEMRTLWFPMVQAVSNGDEKPEDALKAFTEKANKTIKKTQ"
FT   gene            219498..220487
FT                   /locus_tag="MGAS10750_Spy0208"
FT   CDS_pept        219498..220487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0208"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37158"
FT                   /db_xref="GOA:Q1J8K3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K3"
FT                   /protein_id="ABF37158.1"
FT                   /translation="MFLTSGFFSMHMSNGHWKEAFLFRKVEQKKEVFQVNVNKLKMRET
FT                   LISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYSMTDFTFVGFANYARMFQDPIFMKSL
FT                   INTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARSFYRAVFFLPVVTGSVAVTVVWKWIY
FT                   DPMSGILNYVLKYAHVIEQNISWLGDKHWALLAIIVILLTTSVGQPIILYIAAMGNIDN
FT                   SLMEAARVDGATEFQVFWNIKWPSLLPTTLYIAVITTINSFQCFALIQLLTSGGPNYST
FT                   STLMYYLYEKAFKLSEYGYANTMGVFLAVMIAIISFAQFKILGNDVEY"
FT   gene            220500..221330
FT                   /locus_tag="MGAS10750_Spy0209"
FT   CDS_pept        220500..221330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0209"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37159"
FT                   /db_xref="GOA:Q1J8K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K2"
FT                   /protein_id="ABF37159.1"
FT                   /translation="MTKKKLTASDILTAVMLCVLTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSVFISVATMFLVCGTSSLAGYALAKKRFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            221350..221805
FT                   /locus_tag="MGAS10750_Spy0210"
FT   CDS_pept        221350..221805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0210"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37160"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K1"
FT                   /protein_id="ABF37160.1"
FT                   /translation="MFYDRLKNISRYRGIHPHLDAAITFLQTTDLRQLAEGKYPILGEK
FT                   VFAVIQRNQLSKADNSLLEYHKRYADCHLLLAGNECIRYGIGNQAEVVPFEQEADIGFV
FT                   ACDRTYDLDLVDDSFAYFFPNEPHQPNNFNQAGEAVTKCLIKVLMAD"
FT   gene            221849..222511
FT                   /locus_tag="MGAS10750_Spy0211"
FT   CDS_pept        221849..222511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0211"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37161"
FT                   /db_xref="GOA:Q1J8K0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8K0"
FT                   /protein_id="ABF37161.1"
FT                   /translation="MTSKKQGLLHSLFNLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMAFYASLLDWREGQVSQLVTTYRSHFKYYFKSGLRLGLIELGIMSICLLDLFLI
FT                   RNQSGLVFQGFKVLCVAVLFLVVILFLYAYPQAVKRDLSLSTLFKRSFLLAGLFFPWSF
FT                   AFLTFICLTIFSLQLSLLTLFGGVSLLAIIGISSLTYLYLIIMESLLRRFPLNNDIE"
FT   gene            222523..223437
FT                   /gene="nanH"
FT                   /locus_tag="MGAS10750_Spy0212"
FT   CDS_pept        222523..223437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanH"
FT                   /locus_tag="MGAS10750_Spy0212"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37162"
FT                   /db_xref="GOA:Q1J8J9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J9"
FT                   /protein_id="ABF37162.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGNISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDRIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIADKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            223459..224397
FT                   /locus_tag="MGAS10750_Spy0213"
FT   CDS_pept        223459..224397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0213"
FT                   /product="N-acetylmannosamine kinase / Transcriptional
FT                   regulator"
FT                   /EC_number="2.7.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37163"
FT                   /db_xref="GOA:Q1J8J8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J8"
FT                   /protein_id="ABF37163.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDKGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   gene            complement(224508..225350)
FT                   /locus_tag="MGAS10750_Spy0214"
FT   CDS_pept        complement(224508..225350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0214"
FT                   /product="Transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37164"
FT                   /db_xref="GOA:Q1J8J7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J7"
FT                   /protein_id="ABF37164.1"
FT                   /translation="MCFAMPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTA
FT                   SEIVKRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDY
FT                   DALINKTYELVNEEKLLNLAKLIDSSERVYFFGKGSSGLVAREMKLRFMRLGLICDAYS
FT                   DTDGFTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSL
FT                   DIIPVSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   gene            225527..226414
FT                   /gene="tatD"
FT                   /locus_tag="MGAS10750_Spy0215"
FT   CDS_pept        225527..226414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="MGAS10750_Spy0215"
FT                   /product="DNase, TatD family"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37165"
FT                   /db_xref="GOA:Q1J8J6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J6"
FT                   /protein_id="ABF37165.1"
FT                   /translation="MSASKGFYDQPKRQKFSPSFLMWLRSLCYNNIMTNKVEKLTIFDT
FT                   HTHLNVAEFQGHETEELTLAQEMGVAYHNVVGFDQATISGALTLANKYANIYATIGWHP
FT                   TEAGSYSEAVEEAIVSQLSHPKVIALGEIGLDYYWMEDPKEVQIEVFKRQMQLAKDHDL
FT                   PFVVHTRDALEDTYEVIKAAGVGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKK
FT                   ALDIQEAAQHLPLDKILVETDAPYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVA
FT                   KATTANAKRVFKLD"
FT   gene            226365..226976
FT                   /locus_tag="MGAS10750_Spy0216"
FT   CDS_pept        226365..226976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0216"
FT                   /product="Ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37166"
FT                   /db_xref="GOA:Q1J8J5"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J5"
FT                   /protein_id="ABF37166.1"
FT                   /translation="MQKQRLLMQRGYSSLTEKINIQEVLVVEGKDDTANLRRFYEVDTY
FT                   ETRGSAITEEDLERINRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAV
FT                   PSSKSKGRSLGVEHARFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRR
FT                   EYLGEKLRIGYANGKQLLKRLELFGITLAEVEEVMETYEE"
FT   gene            227066..227962
FT                   /gene="ksgA"
FT                   /locus_tag="MGAS10750_Spy0217"
FT   CDS_pept        227066..227962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="MGAS10750_Spy0217"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37167"
FT                   /db_xref="GOA:Q1J8J4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8J4"
FT                   /protein_id="ABF37167.1"
FT                   /translation="MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQK
FT                   IVDTAEIDQNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQV
FT                   VNQDILKADLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQRE
FT                   VADRISAEPNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLI
FT                   EVEDEDFFFRVSRLSFVHRRKTLWNNLTSHFGKSEDIKAKLEKGLALADIKPSIRGEAL
FT                   SIQDFGKLADALKEVGL"
FT   gene            228388..229260
FT                   /locus_tag="MGAS10750_Spy0218"
FT   CDS_pept        228388..229260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0218"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37168"
FT                   /db_xref="GOA:Q1J8J3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J3"
FT                   /protein_id="ABF37168.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPLLADKITVFMGQTGVGKS
FT                   TLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAED
FT                   LNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRE
FT                   TYKKVIKRK"
FT   gene            229270..229932
FT                   /gene="rpe"
FT                   /locus_tag="MGAS10750_Spy0219"
FT   CDS_pept        229270..229932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="MGAS10750_Spy0219"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37169"
FT                   /db_xref="GOA:Q1J8J2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J2"
FT                   /protein_id="ABF37169.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALNV"
FT   gene            229925..230557
FT                   /locus_tag="MGAS10750_Spy0220"
FT   CDS_pept        229925..230557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0220"
FT                   /product="Thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37170"
FT                   /db_xref="GOA:Q1J8J1"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J1"
FT                   /protein_id="ABF37170.1"
FT                   /translation="MSKVALFAGGDLSYISRDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSVPQKAFTDIKEKAELFITAHPEKNDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMLTYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            230559..231830
FT                   /locus_tag="MGAS10750_Spy0221"
FT   CDS_pept        230559..231830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0221"
FT                   /product="RmuC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37171"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8J0"
FT                   /protein_id="ABF37171.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEEINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLNASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            231820..232758
FT                   /gene="cbf"
FT                   /locus_tag="MGAS10750_Spy0222"
FT   CDS_pept        231820..232758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbf"
FT                   /locus_tag="MGAS10750_Spy0222"
FT                   /product="CMP-binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37172"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I9"
FT                   /protein_id="ABF37172.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVEEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            233025..233864
FT                   /gene="purR"
FT                   /locus_tag="MGAS10750_Spy0223"
FT   CDS_pept        233025..233864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="MGAS10750_Spy0223"
FT                   /product="Pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37173"
FT                   /db_xref="GOA:Q1J8I8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I8"
FT                   /protein_id="ABF37173.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEGNIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            233837..236476
FT                   /gene="prgA"
FT                   /locus_tag="MGAS10750_Spy0224"
FT   CDS_pept        233837..236476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prgA"
FT                   /locus_tag="MGAS10750_Spy0224"
FT                   /product="Surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37174"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I7"
FT                   /protein_id="ABF37174.1"
FT                   /translation="MEKGERMDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDR
FT                   ASGETKASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTKLATALTKTTAEINHL
FT                   KEQQDNEQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQADQHSKET
FT                   ALSEQKASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSS
FT                   ELEKAKADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMK
FT                   APQGYPLEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFV
FT                   DPDNLTPEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRP
FT                   SFVYGQPGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGI
FT                   YDSIKYMLFTDHLHGNTYGHAINFLRVDKRNPNAPVYLGFSTSNVGSLNEHFVMFPESN
FT                   IANHQRFNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQ
FT                   AKVSQLQGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKL
FT                   ASLKAALHQTEALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLA
FT                   KTTSSLLNAQETLAALQAKQSGLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDL
FT                   QVAPPLTGVKPLSYSKIDTTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEM
FT                   VASNAIVSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTG
FT                   FRFRKESK"
FT   gene            236684..237097
FT                   /gene="rpsL"
FT                   /locus_tag="MGAS10750_Spy0225"
FT   CDS_pept        236684..237097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="MGAS10750_Spy0225"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37175"
FT                   /db_xref="GOA:Q1J8I6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8I6"
FT                   /protein_id="ABF37175.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            237118..237588
FT                   /gene="rpsG"
FT                   /locus_tag="MGAS10750_Spy0226"
FT   CDS_pept        237118..237588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="MGAS10750_Spy0226"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37176"
FT                   /db_xref="GOA:Q1J8I5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8I5"
FT                   /protein_id="ABF37176.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            238072..240150
FT                   /gene="fus"
FT                   /locus_tag="MGAS10750_Spy0227"
FT   CDS_pept        238072..240150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="MGAS10750_Spy0227"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37177"
FT                   /db_xref="GOA:Q1J8I4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8I4"
FT                   /protein_id="ABF37177.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            240464..241501
FT                   /gene="plr"
FT                   /locus_tag="MGAS10750_Spy0228"
FT   CDS_pept        240464..241501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /locus_tag="MGAS10750_Spy0228"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37178"
FT                   /db_xref="GOA:Q1J8I3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I3"
FT                   /protein_id="ABF37178.1"
FT                   /translation="MIFIRMKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLT
FT                   DPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLE
FT                   ATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTT
FT                   NCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTG
FT                   AAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFG
FT                   YTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYF
FT                   AKIAK"
FT   gene            complement(241727..241843)
FT                   /locus_tag="MGAS10750_Spy0229"
FT   CDS_pept        complement(241727..241843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I2"
FT                   /protein_id="ABF37179.1"
FT                   /translation="MAEKTDLSSAYRRLKSPNIKTRKRALKIIHEYKRYGKK"
FT   gene            complement(241985..242794)
FT                   /locus_tag="MGAS10750_Spy0230"
FT   CDS_pept        complement(241985..242794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0230"
FT                   /product="Amino acid transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37180"
FT                   /db_xref="GOA:Q1J8I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I1"
FT                   /protein_id="ABF37180.1"
FT                   /translation="MNAVSMPILTPLEQTKCRLRRSQMSNSIIEIKNLKKSYGSNEVLK
FT                   DISLSVNKGEVISIIGSSGSGKSTLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYRE
FT                   KLGMVFQSFNLFENLNVLENAIVAQTTVLKRDRPQAEQIAKENLNAVGMTEQYWQAKPK
FT                   QLSGGQKQRVAIARALSVNPEAMLFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTH
FT                   EMEFARDVSDRIIFMDKGLIAEEGSPQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(242718..244304)
FT                   /locus_tag="MGAS10750_Spy0231"
FT   CDS_pept        complement(242718..244304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0231"
FT                   /product="ABC transporter amino acid-binding protein /
FT                   Amino acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37181"
FT                   /db_xref="GOA:Q1J8I0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8I0"
FT                   /protein_id="ABF37181.1"
FT                   /translation="MKQETYMKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPF
FT                   NWTQDDASNGAVPIEGTSQYANGYDVQVAKKVAKAMNKELLVVKTSWTGLIPALTSGKI
FT                   DMIAAGMSSTKERRNEISFSNSYYTSQPVLVVTANGKYADATSLKDFSGAKVTAQQGVW
FT                   HVNLLTQLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKK
FT                   GFAVAESDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKA
FT                   SFLGQMWAILKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALG
FT                   QKLFGWLLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSE
FT                   IVRGGIFAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLN
FT                   VISVVELYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRHIERRFDADTYTTGA
FT                   NQMQIAEVSNV"
FT   gene            244484..244801
FT                   /locus_tag="MGAS10750_Spy0232"
FT   CDS_pept        244484..244801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0232"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H9"
FT                   /protein_id="ABF37182.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRAGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLEMAI
FT                   V"
FT   gene            244888..246066
FT                   /locus_tag="MGAS10750_Spy0233"
FT   CDS_pept        244888..246066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0233"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37183"
FT                   /db_xref="GOA:Q1J8H8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H8"
FT                   /protein_id="ABF37183.1"
FT                   /translation="MAELNWTPISDWDKTLEKVSLTVTTPTDIQDSNLWAHRGYYQKKP
FT                   QVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGEEPVDVSTSKKNKIVALETKISRRR
FT                   ALLQLLFGKVIPLVEVGFLLWQLIQFTRLKKQFNRYHLANHTDHSYEVPEDLSPLVLTQ
FT                   AIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQKVLLLTKEEGKAYLEIS
FT                   QLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQLKKTYKGKKLEQEVRQSS
FT                   EQVIKAMKKASATITNNVLETIKKLNLPDTYRQMTPAEKRKSHSVQGLGCLLVVLNSSL
FT                   LIYLTMKGSGLALIYLALMVLTMCLGFYISLKLDQYKKLGIETPEGGVRLHQ"
FT   gene            246082..246408
FT                   /locus_tag="MGAS10750_Spy0234"
FT   CDS_pept        246082..246408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0234"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37184"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H7"
FT                   /protein_id="ABF37184.1"
FT                   /translation="MIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHRIA
FT                   LPEVYQAVRPGELSMVMYATTLTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGGGG
FT                   GGAF"
FT   gene            246474..247313
FT                   /gene="bacA"
FT                   /locus_tag="MGAS10750_Spy0235"
FT   CDS_pept        246474..247313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="MGAS10750_Spy0235"
FT                   /product="Bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="Putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37185"
FT                   /db_xref="GOA:Q1J8H6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8H6"
FT                   /protein_id="ABF37185.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTDLARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            247453..248220
FT                   /gene="mecA"
FT                   /locus_tag="MGAS10750_Spy0236"
FT   CDS_pept        247453..248220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="MGAS10750_Spy0236"
FT                   /product="Negative regulator of genetic competence mecA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37186"
FT                   /db_xref="GOA:Q1J8H5"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H5"
FT                   /protein_id="ABF37186.1"
FT                   /translation="MIMEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYS
FT                   VMDELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPED
FT                   FFKSLEQSMREKGDVKAHEKLEKIEEIMEDVVEATLANQSEAADPSTNHDSEPLDYIHY
FT                   VLDFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEH
FT                   ANPGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   gene            248227..249396
FT                   /locus_tag="MGAS10750_Spy0237"
FT   CDS_pept        248227..249396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0237"
FT                   /product="Undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37187"
FT                   /db_xref="GOA:Q1J8H4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H4"
FT                   /protein_id="ABF37187.1"
FT                   /translation="MFSFTIDYVLVLIGALLMSLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFMSFLVASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAVIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQKDFFLTLTILVLIAAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLILGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            249366..249491
FT                   /gene="rgpG"
FT                   /locus_tag="MGAS10750_Spy0238"
FT   CDS_pept        249366..249491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="MGAS10750_Spy0238"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H3"
FT                   /protein_id="ABF37188.1"
FT                   /translation="MERKEGFETLKKPSKAFFAIIDAVTIIKKAVQMTLSFLEMV"
FT   gene            249518..250288
FT                   /locus_tag="MGAS10750_Spy0239"
FT   CDS_pept        249518..250288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0239"
FT                   /product="ATP-dependent transporter sufC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37189"
FT                   /db_xref="GOA:Q1J8H2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H2"
FT                   /protein_id="ABF37189.1"
FT                   /translation="MSILEINNLYVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAVIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            250383..251645
FT                   /locus_tag="MGAS10750_Spy0240"
FT   CDS_pept        250383..251645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0240"
FT                   /product="SufD protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37190"
FT                   /db_xref="GOA:Q1J8H1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H1"
FT                   /protein_id="ABF37190.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPNLELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKTSANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDANIDWTLAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRVLMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   gene            251676..252902
FT                   /gene="nifS3"
FT                   /locus_tag="MGAS10750_Spy0241"
FT   CDS_pept        251676..252902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS3"
FT                   /locus_tag="MGAS10750_Spy0241"
FT                   /product="Cysteine desulfurase / Selenocysteine lyase"
FT                   /EC_number="2.8.1.7"
FT                   /EC_number="4.4.1.16"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37191"
FT                   /db_xref="GOA:Q1J8H0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8H0"
FT                   /protein_id="ABF37191.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQHVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLTNKLTTKTR
FT                   FVSLVHVSSVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQSSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            252889..253368
FT                   /gene="nifU"
FT                   /locus_tag="MGAS10750_Spy0242"
FT   CDS_pept        252889..253368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="MGAS10750_Spy0242"
FT                   /product="IscU protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37192"
FT                   /db_xref="GOA:Q1J8G9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G9"
FT                   /protein_id="ABF37192.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVRLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   gene            253361..254779
FT                   /locus_tag="MGAS10750_Spy0243"
FT   CDS_pept        253361..254779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0243"
FT                   /product="ABC transporter-associated protein sufB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37193"
FT                   /db_xref="GOA:Q1J8G8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G8"
FT                   /protein_id="ABF37193.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(254931..256112)
FT                   /locus_tag="MGAS10750_Spy0244"
FT   CDS_pept        complement(254931..256112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0244"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37194"
FT                   /db_xref="GOA:Q1J8G7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G7"
FT                   /protein_id="ABF37194.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHADDVMDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIVAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNYNHTFLLICLAIFIITILLLSLVVFAMGRQ"
FT   gene            complement(256280..257512)
FT                   /gene="dacA2"
FT                   /locus_tag="MGAS10750_Spy0245"
FT   CDS_pept        complement(256280..257512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA2"
FT                   /locus_tag="MGAS10750_Spy0245"
FT                   /product="D-alanyl-D-alanine serine-type carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37195"
FT                   /db_xref="GOA:Q1J8G6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G6"
FT                   /protein_id="ABF37195.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVALESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFAGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSSEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            257834..259822
FT                   /gene="oppA"
FT                   /locus_tag="MGAS10750_Spy0246"
FT   CDS_pept        257834..259822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="MGAS10750_Spy0246"
FT                   /product="Oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37196"
FT                   /db_xref="GOA:Q1J8G5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G5"
FT                   /protein_id="ABF37196.1"
FT                   /translation="MTFMKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVF
FT                   VNDPKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLR
FT                   DGVSWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEV
FT                   GVKALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAY
FT                   FLSAFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYP
FT                   NDPTYKSAKKNYADNITYGMLTGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDF
FT                   RQAIQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTVGESDFGSEVEKEMAKLGDEW
FT                   KDVNLADAQDGFYNPEKAKVEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFK
FT                   QSVEASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDI
FT                   MSPVGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAY
FT                   LTDSAVDIPVVALGGTPRVTKAVPFSGAFAWAGAKGPASVYYYKGMKLQDKPVTAKQFE
FT                   KAKEKWMKAKAKSNAKYAEKLADHVEK"
FT   gene            259875..261389
FT                   /gene="oppB"
FT                   /locus_tag="MGAS10750_Spy0247"
FT   CDS_pept        259875..261389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="MGAS10750_Spy0247"
FT                   /product="Oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37197"
FT                   /db_xref="GOA:Q1J8G4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G4"
FT                   /protein_id="ABF37197.1"
FT                   /translation="MRITMKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDP
FT                   NYNKMTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEK
FT                   YIDSLGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARY
FT                   IRLEKDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVIS
FT                   QGQGRTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVD
FT                   PSMIHNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYV
FT                   VRFLGGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRF
FT                   ARSKGLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSI
FT                   KSANNSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            261389..262315
FT                   /gene="oppC"
FT                   /locus_tag="MGAS10750_Spy0248"
FT   CDS_pept        261389..262315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="MGAS10750_Spy0248"
FT                   /product="Oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37198"
FT                   /db_xref="GOA:Q1J8G3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G3"
FT                   /protein_id="ABF37198.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            262324..263394
FT                   /gene="oppD"
FT                   /locus_tag="MGAS10750_Spy0249"
FT   CDS_pept        262324..263394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="MGAS10750_Spy0249"
FT                   /product="Oligopeptide transport ATP-binding protein oppD"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37199"
FT                   /db_xref="GOA:Q1J8G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G2"
FT                   /protein_id="ABF37199.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            263387..264310
FT                   /gene="oppF"
FT                   /locus_tag="MGAS10750_Spy0250"
FT   CDS_pept        263387..264310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="MGAS10750_Spy0250"
FT                   /product="Oligopeptide transport ATP-binding protein oppF"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37200"
FT                   /db_xref="GOA:Q1J8G1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G1"
FT                   /protein_id="ABF37200.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   gene            complement(264551..264697)
FT                   /locus_tag="MGAS10750_Spy0251"
FT   CDS_pept        complement(264551..264697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0251"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37201"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8G0"
FT                   /protein_id="ABF37201.1"
FT                   /translation="MRKQEQDHHKQDVNQKKPEEMTKLERLQEENEYLRTEVAYLKKPR
FT                   NSV"
FT   gene            complement(265072..265206)
FT                   /locus_tag="MGAS10750_Spy0252"
FT   CDS_pept        complement(265072..265206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37202"
FT                   /db_xref="GOA:Q1J4W2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J4W2"
FT                   /protein_id="ABF37202.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            265314..267142
FT                   /locus_tag="MGAS10750_SpyR02272"
FT   rRNA            265314..267142
FT                   /locus_tag="MGAS10750_SpyR02272"
FT                   /product="16S small subunit ribosomal RNA"
FT                   /note="ssuRNA"
FT   gene            267267..270169
FT                   /locus_tag="MGAS10750_SpyR02273"
FT   rRNA            267267..270169
FT                   /locus_tag="MGAS10750_SpyR02273"
FT                   /product="23S large subunit ribosomal RNA"
FT                   /note="lsuRNA"
FT   gene            270254..270370
FT                   /locus_tag="MGAS10750_SpyR02274"
FT   rRNA            270254..270370
FT                   /locus_tag="MGAS10750_SpyR02274"
FT                   /product="5S RNA"
FT   gene            270376..270449
FT                   /locus_tag="MGAS10750_SpyR02275"
FT   tRNA            270376..270449
FT                   /locus_tag="MGAS10750_SpyR02275"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            270529..270602
FT                   /locus_tag="MGAS10750_SpyR02276"
FT   tRNA            270529..270602
FT                   /locus_tag="MGAS10750_SpyR02276"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            270694..271179
FT                   /locus_tag="MGAS10750_Spy0253"
FT   CDS_pept        270694..271179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0253"
FT                   /product="Competence-specific sigma factor ComX"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37203"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J4W3"
FT                   /protein_id="ABF37203.1"
FT                   /translation="MSIETRAAFEKVKPIILKLKRHYYIQLWDRDDWLQEGHIILLQLL
FT                   ERYPELIEEEERLYRYFKTKFSSYLKDLLRRQESQKRQFHKLAYEEIGEVAHAIPSRGL
FT                   WLDDYVAYQEVIASLENQLNSQERMQFQALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   gene            271681..272265
FT                   /locus_tag="MGAS10750_Spy0254"
FT   CDS_pept        271681..272265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0254"
FT                   /product="Putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37204"
FT                   /db_xref="GOA:Q1J8F7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F7"
FT                   /protein_id="ABF37204.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   gene            272265..273383
FT                   /locus_tag="MGAS10750_Spy0255"
FT   CDS_pept        272265..273383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0255"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37205"
FT                   /db_xref="GOA:Q1J8F6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F6"
FT                   /protein_id="ABF37205.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIERINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNSEQTLFLGGLSRFDFINGERQGFTAF
FT                   FDNQLELHRTKLDGADAFYDKHVGTLLTPPGKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            273408..273716
FT                   /locus_tag="MGAS10750_Spy0256"
FT   CDS_pept        273408..273716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0256"
FT                   /product="hypothetical RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37206"
FT                   /db_xref="GOA:Q1J8F5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F5"
FT                   /protein_id="ABF37206.1"
FT                   /translation="MLTSKQRAFLKSEAHSLKPIVQIGKNGLNDHIKTSIRQALDAREL
FT                   IKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSAKKENRKLSPKVKAI"
FT   gene            273785..274417
FT                   /gene="nadD"
FT                   /locus_tag="MGAS10750_Spy0257"
FT   CDS_pept        273785..274417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="MGAS10750_Spy0257"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37207"
FT                   /db_xref="GOA:Q1J8F4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F4"
FT                   /protein_id="ABF37207.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   gene            274414..275007
FT                   /locus_tag="MGAS10750_Spy0258"
FT   CDS_pept        274414..275007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0258"
FT                   /product="Hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37208"
FT                   /db_xref="GOA:Q1J8F3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F3"
FT                   /protein_id="ABF37208.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECSDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LQDKEILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAQLDLDKAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEK"
FT   gene            274983..275243
FT                   /locus_tag="MGAS10750_Spy0259"
FT   CDS_pept        274983..275243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0259"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37209"
FT                   /db_xref="GOA:Q1J8F2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F2"
FT                   /protein_id="ABF37209.1"
FT                   /translation="MQLFKGEVIEKGIDNLVMIGMLTNYCMDMTVRVAFELGYEVSVIE
FT                   HGSTTFDDEDIQASLLIDYHESLWDGNFARVEPLDVILNEE"
FT   gene            275233..275598
FT                   /locus_tag="MGAS10750_Spy0260"
FT   CDS_pept        275233..275598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0260"
FT                   /product="iojap protein family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37210"
FT                   /db_xref="GOA:Q1J8F1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F1"
FT                   /protein_id="ABF37210.1"
FT                   /translation="MRNKMKKEELLEIVVKAADEKRAEDMLALDLEGLTSLTDYFVIAS
FT                   ATNSRQLEAIADNIREKVKEAGGDASHIEGDSQAGWVLLDLTDVVVHIFSEDERYHYNL
FT                   EKLWHEAPAVALDAYLA"
FT   gene            275634..276389
FT                   /locus_tag="MGAS10750_Spy0261"
FT   CDS_pept        275634..276389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0261"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37211"
FT                   /db_xref="GOA:Q1J8F0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8F0"
FT                   /protein_id="ABF37211.1"
FT                   /translation="MRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSLRHLPKSKGRNRL
FT                   LELACGTGIQSVRFAQAGFDVTGLDLSQDMLTIAEKRAQSAKKKIDFIQGNMLDLSQVG
FT                   QFDFVTCYSDSICYMQDEPEVGDVFKEVYDVLADDGIFIFDVHSTYQTDECFPGYSYHE
FT                   NADDFAMVWDTYADEAPHSVVHELTFFIQEDDGRFSRFDEVHEERTYELLTYDILLEQA
FT                   GFKSFKVYADFEDKEPTETSKRWFFVAYK"
FT   gene            276643..277749
FT                   /locus_tag="MGAS10750_Spy0262"
FT   CDS_pept        276643..277749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0262"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37212"
FT                   /db_xref="GOA:Q1J8E9"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8E9"
FT                   /protein_id="ABF37212.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTENVIDYQ
FT                   KLIKVYEKKSKQMTAYLSTLEDTLSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILIYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKKERLN"
FT   gene            278101..278241
FT                   /locus_tag="MGAS10750_Spy0263"
FT   CDS_pept        278101..278241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37213"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E8"
FT                   /protein_id="ABF37213.1"
FT                   /translation="MLKTILYFYFTKAFQSAIIRELESILVTLMLTIFNKILLKGDKNG
FT                   T"
FT   gene            278231..278947
FT                   /locus_tag="MGAS10750_Spy0264"
FT   CDS_pept        278231..278947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0264"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37214"
FT                   /db_xref="GOA:Q1J8E7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8E7"
FT                   /protein_id="ABF37214.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKIYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   gene            279150..279992
FT                   /locus_tag="MGAS10750_Spy0265"
FT   CDS_pept        279150..279992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0265"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37215"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E6"
FT                   /protein_id="ABF37215.1"
FT                   /translation="MIKKQYLGRATIALASTLVLAACGSSKTAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLTKEHLGGDYVPSDKELKLPTAN"
FT   gene            280319..281164
FT                   /locus_tag="MGAS10750_Spy0266"
FT   CDS_pept        280319..281164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0266"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37216"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E5"
FT                   /protein_id="ABF37216.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGNAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            281414..282478
FT                   /locus_tag="MGAS10750_Spy0267"
FT   CDS_pept        281414..282478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0267"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37217"
FT                   /db_xref="GOA:Q1J8E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8E4"
FT                   /protein_id="ABF37217.1"
FT                   /translation="MNEAIIQLDHIDITFHQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFDQGKIQLSAEALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEQKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGPVLDIFSNPKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            282479..283171
FT                   /locus_tag="MGAS10750_Spy0268"
FT   CDS_pept        282479..283171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0268"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37218"
FT                   /db_xref="GOA:Q1J8E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E3"
FT                   /protein_id="ABF37218.1"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(283416..284594)
FT                   /gene="braB"
FT                   /locus_tag="MGAS10750_Spy0269"
FT   CDS_pept        complement(283416..284594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braB"
FT                   /locus_tag="MGAS10750_Spy0269"
FT                   /product="Branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37219"
FT                   /db_xref="GOA:Q1J8E2"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E2"
FT                   /protein_id="ABF37219.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAIFYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNTTNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDAFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFIDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKCLIMILLSIELQLA"
FT   gene            284828..286042
FT                   /locus_tag="MGAS10750_Spy0270"
FT   CDS_pept        284828..286042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0270"
FT                   /product="Serine/threonine sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37220"
FT                   /db_xref="GOA:Q1J8E1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8E1"
FT                   /protein_id="ABF37220.1"
FT                   /translation="MKKIYDLWVRVSLIKKIGIGVVIGVMLGILAPDLTGFSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGRQTNMTLIIFLYLFGTFASALVAVLTAYLFPLTL
FT                   VLNTPVNTELSPPQGVAEVFQSLLLKLVDNPINALATANYIGVLSWAIIFGLALKAASQ
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFTTISENGVGILSDYAFLILVLVGTMV
FT                   FVALVVNPLIAVLITRQNPYPLVLRCLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIPIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKKA"
FT   gene            complement(286097..286771)
FT                   /locus_tag="MGAS10750_Spy0271"
FT   CDS_pept        complement(286097..286771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0271"
FT                   /product="Potassium uptake protein ktrA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37221"
FT                   /db_xref="GOA:Q1J8E0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8E0"
FT                   /protein_id="ABF37221.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFIIPKSWEGQ
FT                   SLSELDVRRKYELNIIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(286781..288172)
FT                   /locus_tag="MGAS10750_Spy0272"
FT   CDS_pept        complement(286781..288172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0272"
FT                   /product="Potassium uptake protein ktrB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37222"
FT                   /db_xref="GOA:Q1J8D9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D9"
FT                   /protein_id="ABF37222.1"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSLEAFAALVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSTAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(288241..288954)
FT                   /gene="gidB"
FT                   /locus_tag="MGAS10750_Spy0273"
FT   CDS_pept        complement(288241..288954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="MGAS10750_Spy0273"
FT                   /product="Methyltransferase gidB"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37223"
FT                   /db_xref="GOA:Q1J8D8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8D8"
FT                   /protein_id="ABF37223.1"
FT                   /translation="MTPQDFYRTLEEDGFSLASKQKEQFDTYFKLLVEWNTKINLTAIT
FT                   EKNEVYLKHFYDSIAPILQGFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDVVTARAVARMQVLSELTIPF
FT                   LKIGGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            289104..289661
FT                   /gene="lemA"
FT                   /locus_tag="MGAS10750_Spy0274"
FT   CDS_pept        289104..289661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="MGAS10750_Spy0274"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37224"
FT                   /db_xref="GOA:Q1J8D7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D7"
FT                   /protein_id="ABF37224.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            289708..290604
FT                   /locus_tag="MGAS10750_Spy0275"
FT   CDS_pept        289708..290604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0275"
FT                   /product="Endopeptidase htpX"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37225"
FT                   /db_xref="GOA:Q1J8D6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8D6"
FT                   /protein_id="ABF37225.1"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            290835..291371
FT                   /locus_tag="MGAS10750_Spy0276"
FT   CDS_pept        290835..291371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0276"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37226"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D5"
FT                   /protein_id="ABF37226.1"
FT                   /translation="MMLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGN
FT                   VRYDKGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLV
FT                   LVLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQ
FT                   KENNPFACLQGLFDE"
FT   gene            291638..292324
FT                   /gene="covR"
FT                   /locus_tag="MGAS10750_Spy0277"
FT   CDS_pept        291638..292324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covR"
FT                   /locus_tag="MGAS10750_Spy0277"
FT                   /product="Response regulator CsrR"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37227"
FT                   /db_xref="GOA:Q1J8D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D4"
FT                   /protein_id="ABF37227.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEK
FT                   EFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   NILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   gene            292330..293832
FT                   /gene="covS"
FT                   /locus_tag="MGAS10750_Spy0278"
FT   CDS_pept        292330..293832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covS"
FT                   /locus_tag="MGAS10750_Spy0278"
FT                   /product="Transmembrane histidine kinase CsrS"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37228"
FT                   /db_xref="GOA:Q1J8D3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D3"
FT                   /protein_id="ABF37228.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVGNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAGL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSNES"
FT   gene            294047..294541
FT                   /locus_tag="MGAS10750_Spy0279"
FT   CDS_pept        294047..294541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0279"
FT                   /product="Putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37229"
FT                   /db_xref="GOA:Q1J8D2"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8D2"
FT                   /protein_id="ABF37229.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            294525..295700
FT                   /gene="dnaB"
FT                   /locus_tag="MGAS10750_Spy0280"
FT   CDS_pept        294525..295700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="MGAS10750_Spy0280"
FT                   /product="Replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37230"
FT                   /db_xref="GOA:Q1J8D1"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D1"
FT                   /protein_id="ABF37230.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAVSIYQYFIHF
FT                   FDDGLQRHKFSDILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGDLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKATAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKTSQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            295701..296603
FT                   /gene="dnaI"
FT                   /locus_tag="MGAS10750_Spy0281"
FT   CDS_pept        295701..296603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="MGAS10750_Spy0281"
FT                   /product="Primosomal protein dnaI"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37231"
FT                   /db_xref="GOA:Q1J8D0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8D0"
FT                   /protein_id="ABF37231.1"
FT                   /translation="MEKIGETMAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYRFADLERKWATIKGSDETWQAKRV
FT                   MERVRYLAREFHLEGANRR"
FT   gene            296666..297976
FT                   /gene="pgdA"
FT                   /locus_tag="MGAS10750_Spy0282"
FT   CDS_pept        296666..297976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgdA"
FT                   /locus_tag="MGAS10750_Spy0282"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37232"
FT                   /db_xref="GOA:Q1J8C9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8C9"
FT                   /protein_id="ABF37232.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTLDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            298183..301281
FT                   /gene="snf"
FT                   /locus_tag="MGAS10750_Spy0283"
FT   CDS_pept        298183..301281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="MGAS10750_Spy0283"
FT                   /product="SWF/SNF family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37233"
FT                   /db_xref="GOA:Q1J8C8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C8"
FT                   /protein_id="ABF37233.1"
FT                   /translation="MMARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYG
FT                   ADDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKMTSFG
FT                   SLFLDSLAMNEDDSVKYRLSALGSRSHFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLI
FT                   KKEGFYQIGKNYFEQLSWLQFDPSSQDLIEFLWRLASDTDKGDNENIFPNHARHLRLPS
FT                   GFFEEGIHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVHRKSIELQIAEKN
FT                   VQYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSD
FT                   FKQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASH
FT                   LKKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQ
FT                   VKEMPKIAIKRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQ
FT                   KVSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFS
FT                   IKPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKV
FT                   LILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQTRDQIIEEGHQITITSYSSFRQDFET
FT                   YQAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVL
FT                   PGLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIETNYSNEMTDEQKAIYL
FT                   AQLRQMQDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMNYQGKSGKLDSLRILL
FT                   TQIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKD
FT                   AFLISLKAGGVGINLTGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGT
FT                   IEEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   gene            301523..302125
FT                   /locus_tag="MGAS10750_Spy0284"
FT   CDS_pept        301523..302125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0284"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37234"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C7"
FT                   /protein_id="ABF37234.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IAGNEELTAKATSRQAPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMAYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            302165..303493
FT                   /gene="murC"
FT                   /locus_tag="MGAS10750_Spy0285"
FT   CDS_pept        302165..303493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="MGAS10750_Spy0285"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37235"
FT                   /db_xref="GOA:Q1J8C6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8C6"
FT                   /protein_id="ABF37235.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIINDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            303539..304021
FT                   /locus_tag="MGAS10750_Spy0286"
FT   CDS_pept        303539..304021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0286"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37236"
FT                   /db_xref="GOA:Q1J8C5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C5"
FT                   /protein_id="ABF37236.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEERIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            304133..305707
FT                   /locus_tag="MGAS10750_Spy0287"
FT   CDS_pept        304133..305707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0287"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37237"
FT                   /db_xref="GOA:Q1J8C4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C4"
FT                   /protein_id="ABF37237.1"
FT                   /translation="MALTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKEL
FT                   EAKEAARRTAQLYAEYKRQDTFQKESIAHNNKTAKHFQAIKDAVMTSEAIKPTLLSEKE
FT                   NSSLKTTSKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLI
FT                   SSIIITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNS
FT                   TVFSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTI
FT                   KQIAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIY
FT                   RLEGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVE
FT                   KEGSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPY
FT                   NIYTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEK
FT                   YVNSQIQ"
FT   gene            305732..306262
FT                   /gene="greA"
FT                   /locus_tag="MGAS10750_Spy0288"
FT   CDS_pept        305732..306262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="MGAS10750_Spy0288"
FT                   /product="Transcription elongation factor greA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37238"
FT                   /db_xref="GOA:Q1J8C3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C3"
FT                   /protein_id="ABF37238.1"
FT                   /translation="MFVFLIRLKKKREKTIMAEKTYPMTLTEKEQLEKELEELKLVRRP
FT                   EIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVA
FT                   IGKTVIVHEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAA
FT                   TYDVEIISVEKTS"
FT   gene            complement(306477..306620)
FT                   /locus_tag="MGAS10750_Spy0289"
FT   CDS_pept        complement(306477..306620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0289"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37239"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C2"
FT                   /protein_id="ABF37239.1"
FT                   /translation="MESIVLRKETYQTYSFKIKQEIINKVLQNGQSLVSVSLDYTLPIL
FT                   KI"
FT   gene            complement(306886..307809)
FT                   /locus_tag="MGAS10750_Spy0290"
FT   CDS_pept        complement(306886..307809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0290"
FT                   /product="60 kDa inner membrane protein YIDC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37240"
FT                   /db_xref="GOA:Q1J8C1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C1"
FT                   /protein_id="ABF37240.1"
FT                   /translation="MRLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPIN
FT                   KRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(307891..308202)
FT                   /locus_tag="MGAS10750_Spy0291"
FT   CDS_pept        complement(307891..308202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0291"
FT                   /product="Acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37241"
FT                   /db_xref="GOA:Q1J8C0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8C0"
FT                   /protein_id="ABF37241.1"
FT                   /translation="MCYNKSKEALLMQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGR
FT                   VWNNNDGTVEILAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGN"
FT   gene            308430..309167
FT                   /locus_tag="MGAS10750_Spy0292"
FT   CDS_pept        308430..309167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0292"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37242"
FT                   /db_xref="GOA:Q1J8B9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B9"
FT                   /protein_id="ABF37242.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMVERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFDGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYKTPILATTLSKKSVDYKSLTHHERLALVLGNEGQGISAEMAALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            309206..309706
FT                   /locus_tag="MGAS10750_Spy0293"
FT   CDS_pept        309206..309706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0293"
FT                   /product="Hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37243"
FT                   /db_xref="GOA:Q1J8B8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B8"
FT                   /protein_id="ABF37243.1"
FT                   /translation="MHYTEDKEYMEHVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLRRKTLQS
FT                   HNR"
FT   gene            309721..310410
FT                   /locus_tag="MGAS10750_Spy0294"
FT   CDS_pept        309721..310410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0294"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37244"
FT                   /db_xref="GOA:Q1J8B7"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B7"
FT                   /protein_id="ABF37244.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFIASGAARKNTPAALPIFLIYSALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            310588..310830
FT                   /locus_tag="MGAS10750_Spy0295"
FT   CDS_pept        310588..310830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0295"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37245"
FT                   /db_xref="GOA:Q1J8B6"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8B6"
FT                   /protein_id="ABF37245.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            complement(310888..310983)
FT                   /locus_tag="MGAS10750_Spy0296"
FT   CDS_pept        complement(310888..310983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37246"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B5"
FT                   /protein_id="ABF37246.1"
FT                   /translation="MKNSVGNSQLSFFLNPEQLTNLTDKTSATEH"
FT   gene            311008..311802
FT                   /gene="glr"
FT                   /locus_tag="MGAS10750_Spy0297"
FT   CDS_pept        311008..311802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /locus_tag="MGAS10750_Spy0297"
FT                   /product="Glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37247"
FT                   /db_xref="GOA:Q1J8B4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8B4"
FT                   /protein_id="ABF37247.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSVQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVEHRFFTTANSEIFQEIASIWLKQKINVEHVTL"
FT   gene            311760..312785
FT                   /locus_tag="MGAS10750_Spy0298"
FT   CDS_pept        311760..312785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0298"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37248"
FT                   /db_xref="GOA:Q1J8B3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B3"
FT                   /protein_id="ABF37248.1"
FT                   /translation="MAETKNKCGACHLMSEKIYEYKDENNWFIGKMTGHNLISGWGVKH
FT                   TTIKKIDDLLDGIAATLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETQRKIKVTPH
FT                   AGTILLMENAKLLAVYLPEGGVSTATFFATSEQGFGDIILIATRNEGKTKEFRNLFGQL
FT                   GYRVENLNDYPELPEVAETGTTFEENARLKAETISRLTGKMVLADDSGLKVDALGGLPG
FT                   VWSARFSGPDATDAKNNAKLLHELAMVFDQKKRSAQFHTTLVVAAPNKDSLVVEAEWPG
FT                   YIATQPKGENGFGYDPVFIVGETGRHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQ
FT                   S"
FT   gene            312764..313285
FT                   /locus_tag="MGAS10750_Spy0299"
FT   CDS_pept        312764..313285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0299"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37249"
FT                   /db_xref="GOA:Q1J8B2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B2"
FT                   /protein_id="ABF37249.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAAD
FT                   ICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            313282..313743
FT                   /locus_tag="MGAS10750_Spy0300"
FT   CDS_pept        313282..313743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0300"
FT                   /product="CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37250"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8B1"
FT                   /protein_id="ABF37250.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDYPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            313740..314486
FT                   /locus_tag="MGAS10750_Spy0301"
FT   CDS_pept        313740..314486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0301"
FT                   /product="DNA integration/recombination/inversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37251"
FT                   /db_xref="GOA:Q1J8B0"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8B0"
FT                   /protein_id="ABF37251.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLVGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLNFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLIGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPVTLEKYYKS"
FT   gene            314486..315190
FT                   /locus_tag="MGAS10750_Spy0302"
FT   CDS_pept        314486..315190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0302"
FT                   /product="Segregation and condensation protein ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37252"
FT                   /db_xref="GOA:Q1J8A9"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8A9"
FT                   /protein_id="ABF37252.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEEDLEQDLLEKIEEYSRFKAVSQA
FT                   LAKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKNNHTVIER
FT                   DDYKIEDMMASIKQRLEKENVISLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQLS
FT                   NFGAIILRKEKK"
FT   gene            315187..315738
FT                   /locus_tag="MGAS10750_Spy0303"
FT   CDS_pept        315187..315738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0303"
FT                   /product="Segregation and condensation protein ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37253"
FT                   /db_xref="GOA:Q1J8A8"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8A8"
FT                   /protein_id="ABF37253.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            315835..316581
FT                   /locus_tag="MGAS10750_Spy0304"
FT   CDS_pept        315835..316581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0304"
FT                   /product="Ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37254"
FT                   /db_xref="GOA:Q1J8A7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A7"
FT                   /protein_id="ABF37254.1"
FT                   /translation="MLKRKKNIMRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDL
FT                   ATTVKSGDVVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYP
FT                   VGRLDWDTSGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDG
FT                   KKTKPARYNIVRVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLK
FT                   GLRPGEARRLNKKEISQLHNLANTKK"
FT   gene            316578..316841
FT                   /locus_tag="MGAS10750_Spy0305"
FT   CDS_pept        316578..316841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0305"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37255"
FT                   /db_xref="GOA:Q1J8A6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J8A6"
FT                   /protein_id="ABF37255.1"
FT                   /translation="MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTK
FT                   GILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNAEKA"
FT   gene            316983..317567
FT                   /locus_tag="MGAS10750_Spy0306"
FT   CDS_pept        316983..317567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0306"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37256"
FT                   /db_xref="GOA:Q1J8A5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A5"
FT                   /protein_id="ABF37256.1"
FT                   /translation="MWFFKLKRVNEIMTTKELINKNDKVKKARNHIVLFQPQIPQNTGN
FT                   IARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHL
FT                   ISKFAVNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVS
FT                   NTVCMVIYEALRQQGFQGLELKHTYEHDKLK"
FT   gene            317878..318441
FT                   /locus_tag="MGAS10750_Spy0307"
FT   CDS_pept        317878..318441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0307"
FT                   /product="Riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37257"
FT                   /db_xref="GOA:Q1J8A4"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A4"
FT                   /protein_id="ABF37257.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            318443..319096
FT                   /locus_tag="MGAS10750_Spy0308"
FT   CDS_pept        318443..319096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0308"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37258"
FT                   /db_xref="GOA:Q1J8A3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A3"
FT                   /protein_id="ABF37258.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQILLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILVIGLSRIYLGVHYPSDILAGFVLGFGILQFIYPFYKQKRFEWRFLLKQD"
FT   gene            319371..320309
FT                   /locus_tag="MGAS10750_Spy0309"
FT   CDS_pept        319371..320309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0309"
FT                   /product="Radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37259"
FT                   /db_xref="GOA:Q1J8A2"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A2"
FT                   /protein_id="ABF37259.1"
FT                   /translation="MCYNRNMKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVA
FT                   HGGCTFCTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVD
FT                   VIRDRYEQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSR
FT                   LINRAHSYDLYKDTVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIK
FT                   LHLLHLMTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLI
FT                   GPMWSLNKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            320321..320902
FT                   /locus_tag="MGAS10750_Spy0310"
FT   CDS_pept        320321..320902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0310"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37260"
FT                   /db_xref="GOA:Q1J8A1"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A1"
FT                   /protein_id="ABF37260.1"
FT                   /translation="MTDLDRRKVMLKRPIHLSHDFLAEVVDKSSVVVDPTMGNGNDTAF
FT                   LAQLAKKVYAFDVQDQAIRKTSERLAQLGLLNAELILAGHEAVDQYVTEPVRAAIFNLG
FT                   YLPSADKSIITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLD
FT                   QRKVSAMLYQPLNQVNTPPFLIMLEKLADV"
FT   gene            320996..322369
FT                   /gene="hlyX"
FT                   /locus_tag="MGAS10750_Spy0311"
FT   CDS_pept        320996..322369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyX"
FT                   /locus_tag="MGAS10750_Spy0311"
FT                   /product="Magnesium and cobalt efflux protein corC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37261"
FT                   /db_xref="GOA:Q1J8A0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J8A0"
FT                   /protein_id="ABF37261.1"
FT                   /translation="MKSLYYFFRSYINMEDPVSQPLVIQFLLLVVLTLLNAFFSASEMA
FT                   LVSLNRSRVEQKAADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKV
FT                   ISGWLGNSATARTAGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGR
FT                   LVSPFVWLLSASTNLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVF
FT                   SLDEMMAREVMVPRTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKR
FT                   LLESGFRQGFDQINMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLV
FT                   TLEDLLEEIVGEIDDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTI
FT                   AGFYLTGIGTIPSQEQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            322375..323238
FT                   /gene="pflC"
FT                   /locus_tag="MGAS10750_Spy0312"
FT   CDS_pept        322375..323238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflC"
FT                   /locus_tag="MGAS10750_Spy0312"
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37262"
FT                   /db_xref="GOA:Q1J899"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J899"
FT                   /protein_id="ABF37262.1"
FT                   /translation="MPSLFDEKCYNENVKTFTSNEGDAMTEKDYGQVTGMVHSTESFGS
FT                   VDGPGIRFIIFLQGCKLRCQYCHNPDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGG
FT                   ITVSGGEAMLQIDFITALFIEAKKLGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLIL
FT                   LDLKEIDEKQHKIVTRQPNKNILQFARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEF
FT                   VKTLKNVDKFEVLPYHTMGEFKWRELGIPYQLEGVKPPSKERVQNAKNLMQTESYTEYM
FT                   NRIHQS"
FT   gene            323363..324304
FT                   /gene="ppaC"
FT                   /locus_tag="MGAS10750_Spy0313"
FT   CDS_pept        323363..324304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="MGAS10750_Spy0313"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37263"
FT                   /db_xref="GOA:Q1J898"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J898"
FT                   /protein_id="ABF37263.1"
FT                   /translation="MIMSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTP
FT                   NEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRV
FT                   ANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTH
FT                   VSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQ
FT                   VNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAA
FT                   FNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            324380..325033
FT                   /locus_tag="MGAS10750_Spy0314"
FT   CDS_pept        324380..325033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0314"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37264"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J897"
FT                   /protein_id="ABF37264.1"
FT                   /translation="MITIFHSDKLTRQPFFQDLINYLDQHDHVILREIKKAFPNVTGID
FT                   KAIESYVQAGYICRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYENILAVVFETHL
FT                   TNQTNHVMIKEKTNITRDDLTLANYFYRLKRGEKPSAEQMDLYDLLGDVNQEYALKYMT
FT                   TFLLKFTRKDLVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMTLDKESLTFIAP"
FT   gene            complement(325078..326115)
FT                   /gene="fhuG"
FT                   /locus_tag="MGAS10750_Spy0315"
FT   CDS_pept        complement(325078..326115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="MGAS10750_Spy0315"
FT                   /product="Ferrichrome transport system permease protein
FT                   fhuG"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37265"
FT                   /db_xref="GOA:Q1J896"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J896"
FT                   /protein_id="ABF37265.1"
FT                   /translation="MLFMVNKKRRPLLKSQRHLLRLYTSLILLLVSLMGLALSLGESHL
FT                   SFLDFVHVFLGKSSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGV
FT                   LGITIGAGISLAIVVSFSFFEQAHISHYLPLFAMLGAVVTTFSVYWLSLTKQGQIDPTR
FT                   LILTGVAVTTMLSSLMVALVGHINHYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWL
FT                   LTYSQAHFLNIMGLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAG
FT                   HFSTYLVGSNHKLTIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYL
FT                   MAKTK"
FT   gene            complement(326076..327128)
FT                   /gene="fhuB"
FT                   /locus_tag="MGAS10750_Spy0316"
FT   CDS_pept        complement(326076..327128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="MGAS10750_Spy0316"
FT                   /product="Ferrichrome transport system permease protein
FT                   fhuB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37266"
FT                   /db_xref="GOA:Q1J895"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J895"
FT                   /protein_id="ABF37266.1"
FT                   /translation="MKTKHPFLCLERFCLKKTQIITKSHIFWLVFVLLSFSLCVAIYCH
FT                   LRFGAVALSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITR
FT                   NPIAEPGLLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKG
FT                   YHQLRLVLAGAMVSILLSALGQGITNYYHLANAVIGWQAGGLVGVNWQMIGYIAPLIIL
FT                   SLCLAQLLSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGL
FT                   VIPHLMKHFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCF
FT                   LWLIRRGGRY"
FT   gene            complement(327118..328050)
FT                   /gene="fhuD"
FT                   /locus_tag="MGAS10750_Spy0317"
FT   CDS_pept        complement(327118..328050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="MGAS10750_Spy0317"
FT                   /product="Ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37267"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J894"
FT                   /protein_id="ABF37267.1"
FT                   /translation="MKKLTLLLTLCLTTTTLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVAATDLE
FT                   AITTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVLSDFGHIFNKEGKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEVIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVVAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLETLREAILSSEN"
FT   gene            complement(328076..328858)
FT                   /gene="fhuA"
FT                   /locus_tag="MGAS10750_Spy0318"
FT   CDS_pept        complement(328076..328858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="MGAS10750_Spy0318"
FT                   /product="Ferrichrome transport ATP-binding protein fhuC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37268"
FT                   /db_xref="GOA:Q1J893"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J893"
FT                   /protein_id="ABF37268.1"
FT                   /translation="MTTISAEDLTIAYGQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGIVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKAIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIVMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFLIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(328951..329286)
FT                   /locus_tag="MGAS10750_Spy0319"
FT   CDS_pept        complement(328951..329286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0319"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37269"
FT                   /db_xref="GOA:Q1J892"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J892"
FT                   /protein_id="ABF37269.1"
FT                   /translation="MKELYQHRKETIERLFGTAKEYHNLRYTREKGKSKMEDKVGLTLA
FT                   CLNLKKLVKRMAGEPFYFVQMRWFKHGNSHFYLKTLKKTSTKSMFVFNLGFVKPFFYAI
FT                   IVKILRK"
FT   gene            complement(329332..330447)
FT                   /locus_tag="MGAS10750_Spy0320"
FT   CDS_pept        complement(329332..330447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0320"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37270"
FT                   /db_xref="GOA:Q1J891"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J891"
FT                   /protein_id="ABF37270.1"
FT                   /translation="MLHKEKPDYNRNQYGFYTLDQLVPDEHFLRQVEAVIDFDFIYDLV
FT                   EDTYSSDNGRPSLDPVMLVKIPLIQCFYGIRSMRQTIKDIEVNTAYRWFLGLTLDDKVP
FT                   HFTTYGKNYSRRFQEKGLIESIFTHILGLCINTGLIDPTEIFIDGTHIKAAANNRKFIN
FT                   REVEKQAKFMSEQLEIEINRDREKHGKKPLGPAKELEPVAKKISTTDPESGWFHKGDHK
FT                   EVFAYSAQVACDKYGWALAYSVEAGNIHDSQAFPALFAKLEPLKPQFIIADSGYNIPSI
FT                   AKFLIDKEITPVLPYTRPRGKKDLLRPNEFIYDEHFDCVICPEHQALTYRTTTREGYRE
FT                   YKSDPAICANCPLLSVCTTSKNHQKVVTRHI"
FT   gene            complement(330649..332094)
FT                   /gene="murE"
FT                   /locus_tag="MGAS10750_Spy0321"
FT   CDS_pept        complement(330649..332094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="MGAS10750_Spy0321"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37271"
FT                   /db_xref="GOA:Q1J890"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J890"
FT                   /protein_id="ABF37271.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDSDGYHYHYQGLSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFSFLADQVADQEHVFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISQEIASHIARPVEIISDREQAIQKAMSLCQEAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIATHYL"
FT   gene            332182..333816
FT                   /locus_tag="MGAS10750_Spy0322"
FT   CDS_pept        332182..333816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0322"
FT                   /product="Export protein for polysaccharides and teichoic
FT                   acids"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37272"
FT                   /db_xref="GOA:Q1J889"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J889"
FT                   /protein_id="ABF37272.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSAIMYLGSPLFASLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAMSQIAEQLIRVIWMLLTTFFIMKLGSKDYLSAVTQSTLAAFVGMIASMAVLGYYLWK
FT                   LGLLKAICRKPNHHIDSDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEDRAIHLFVAVLFQTLLMALYTLFSPMLQ
FT                   ALFENRKAIYYFVYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGVGMTAYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            333984..334613
FT                   /gene="upp"
FT                   /locus_tag="MGAS10750_Spy0323"
FT   CDS_pept        333984..334613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="MGAS10750_Spy0323"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37273"
FT                   /db_xref="GOA:Q1J888"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J888"
FT                   /protein_id="ABF37273.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            334837..335427
FT                   /gene="clpP"
FT                   /locus_tag="MGAS10750_Spy0324"
FT   CDS_pept        334837..335427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="MGAS10750_Spy0324"
FT                   /product="ATP-dependent endopeptidase clp proteolytic
FT                   subunit clpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37274"
FT                   /db_xref="GOA:Q1J887"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J887"
FT                   /protein_id="ABF37274.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            335922..336215
FT                   /locus_tag="MGAS10750_Spy0325"
FT   CDS_pept        335922..336215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0325"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37275"
FT                   /db_xref="GOA:Q1J886"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J886"
FT                   /protein_id="ABF37275.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKGYQPPSY"
FT   gene            336320..337081
FT                   /gene="tmk"
FT                   /locus_tag="MGAS10750_Spy0326"
FT   CDS_pept        336320..337081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="MGAS10750_Spy0326"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37276"
FT                   /db_xref="GOA:Q1J885"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J885"
FT                   /protein_id="ABF37276.1"
FT                   /translation="MTVTSLIRTDRIGPKIEHCKDMPVLFSSFFDKIELLKSEGNKMIT
FT                   GKLITVEGPDGAGKTTVLEQLIPLLKQKVAQEILTTREPGGVAISEYIRELILDINHTT
FT                   MDPKTELLLYIAARRQHLVEKVLPALEAGRLVFIDRFIDSSVAYQGAGRGLIKADIQWL
FT                   NEFATDGLEPDLTLYFDVPSEIGLARINANQQREVNRLDLETIEIHQRVRKGYLALAKE
FT                   HPKRIVTIDATKPLKEVVSVALEHVLALLLA"
FT   gene            337099..337974
FT                   /gene="dnaX"
FT                   /locus_tag="MGAS10750_Spy0327"
FT   CDS_pept        337099..337974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="MGAS10750_Spy0327"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37277"
FT                   /db_xref="GOA:Q1J884"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J884"
FT                   /protein_id="ABF37277.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYENK
FT                   RQVFIIKDCDKMHTNAANSLLKYIEEPQGEAYMFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLYQLAQEKGLLNHQAKLVAKLATNTSHLERLLQTSKLLELITQAERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMSE"
FT   gene            337975..338232
FT                   /locus_tag="MGAS10750_Spy0328"
FT   CDS_pept        337975..338232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0328"
FT                   /product="Tpl protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37278"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J883"
FT                   /protein_id="ABF37278.1"
FT                   /translation="MQLEFVMGKRSLSKDLPVATKVAAHRGKKAFEENTAFATDLMKEV
FT                   SRLITQNKLEMTFINSVFLLDQHVVLIPFSAEEHMDFYNC"
FT   gene            338321..338482
FT                   /locus_tag="MGAS10750_Spy0329"
FT   CDS_pept        338321..338482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0329"
FT                   /product="Signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J882"
FT                   /protein_id="ABF37279.1"
FT                   /translation="MWQTTVLLSFLGKFLTISIKILKNQRLSLTLGKATSPYGRLLCCL
FT                   YDEGGFYQ"
FT   gene            338636..338959
FT                   /locus_tag="MGAS10750_Spy0330"
FT   CDS_pept        338636..338959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0330"
FT                   /product="Initiation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37280"
FT                   /db_xref="GOA:Q1J881"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J881"
FT                   /protein_id="ABF37280.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETVAKNPSKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            338964..339245
FT                   /locus_tag="MGAS10750_Spy0331"
FT   CDS_pept        338964..339245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0331"
FT                   /product="Tetrapyrrole (Corrin/Porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37281"
FT                   /db_xref="GOA:Q1J880"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J880"
FT                   /protein_id="ABF37281.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNAYEKIPDLIDLLISGRCTSSGI"
FT   gene            339253..339828
FT                   /locus_tag="MGAS10750_Spy0332"
FT   CDS_pept        339253..339828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0332"
FT                   /product="Tetrapyrrole (Corrin/Porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37282"
FT                   /db_xref="GOA:Q1J879"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J879"
FT                   /protein_id="ABF37282.1"
FT                   /translation="MPSISDPGHDLVKAAIDSDIAVVALPGASAGITALIASGLAPQPH
FT                   VFYGFLPRKAGQQKAFFEDKHHYPETQMFYESPYRIKDTLTNMLACYGDRQVVLVRELT
FT                   KLFEEYQRGSILEILSYLEETPLKGECLLIVAGAQVDSEVELTADVDLVSLVQKEIQAG
FT                   AKPNQAIKTIAKAYQVNRQELYQQFHDL"
FT   gene            339855..340247
FT                   /locus_tag="MGAS10750_Spy0333"
FT   CDS_pept        339855..340247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0333"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37283"
FT                   /db_xref="GOA:Q1J878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J878"
FT                   /protein_id="ABF37283.1"
FT                   /translation="MTEDQATILILGVYGIILAVFLLSALLCLIANWRLFKRAGYKGWY
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(340294..340923)
FT                   /gene="cutC"
FT                   /locus_tag="MGAS10750_Spy0334"
FT   CDS_pept        complement(340294..340923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="MGAS10750_Spy0334"
FT                   /product="Copper homeostasis protein cutC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37284"
FT                   /db_xref="GOA:Q1J877"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J877"
FT                   /protein_id="ABF37284.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDRIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGVTAENCQSLSQLTGTAIVHGTKII"
FT   gene            complement(341093..341263)
FT                   /locus_tag="MGAS10750_Spy0336"
FT   CDS_pept        complement(341093..341263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37285"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J876"
FT                   /protein_id="ABF37285.1"
FT                   /translation="MAGATFWVLVNRNHLFSFRVTVLGVRRLFLVIISQKKGGFFKMLS
FT                   FAFLFFLRVRW"
FT   gene            341222..341578
FT                   /locus_tag="MGAS10750_Spy0335"
FT   CDS_pept        341222..341578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0335"
FT                   /product="Arsenate reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37286"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J875"
FT                   /protein_id="ABF37286.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLVSDFEAIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGKVL
FT                   QVGYRKPYQELDLG"
FT   gene            complement(341652..342563)
FT                   /gene="exoA"
FT                   /locus_tag="MGAS10750_Spy0337"
FT   CDS_pept        complement(341652..342563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="MGAS10750_Spy0337"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37287"
FT                   /db_xref="GOA:Q1J874"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J874"
FT                   /protein_id="ABF37287.1"
FT                   /translation="MGARCPKSLIVSFFVTITTRLSVRKRYQMKLISWNIDSLNAALTG
FT                   ESPRALLSRAVLDTLVAQDADIIAIQETKLSAKGPTKKHIETLLSYFPNYLHVWRSSVE
FT                   PARKGYAGTMFLYKNTLNPVITFPEIGAPTTMDAEGRIITLEFEDFFVTQVYTPNAGDG
FT                   LRRLDDRQIWDHKYADYLTELDTQKPVLATGDYNVAHKEIDLANPSSNRRSPGFTDEER
FT                   QGFTNLLARGFTDTFRHLHGDIPHVYTWWAQRSKTSKINNTGWRIDYWLASNRIVDKIK
FT                   RSEMISSGERQDHTPILLDIDL"
FT   gene            342707..343894
FT                   /gene="lctO"
FT                   /locus_tag="MGAS10750_Spy0338"
FT   CDS_pept        342707..343894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="MGAS10750_Spy0338"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.13.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37288"
FT                   /db_xref="GOA:Q1J873"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J873"
FT                   /protein_id="ABF37288.1"
FT                   /translation="MSMAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVI
FT                   PKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDHLTSPLILA
FT                   PVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGETPHWFQFYYSKDD
FT                   GINRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTM
FT                   DYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQL
FT                   DGGPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGLAMG
FT                   GSIGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            344160..346895
FT                   /locus_tag="MGAS10750_Spy0339"
FT   CDS_pept        344160..346895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0339"
FT                   /product="Endopeptidase lactocepin"
FT                   /EC_number="3.4.21.96"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37289"
FT                   /db_xref="GOA:Q1J872"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J872"
FT                   /protein_id="ABF37289.1"
FT                   /translation="MEKKQRFSLRKYKSGTFSVLIGSVFLMMMTTTTVAADELTTTSEP
FT                   TITNHAQQQAQHLTNTELSSAESQSPDTSQITPKTNREKEQPQGLVSEPTTTELADTDA
FT                   ASMANTGPDATQKSASLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSM
FT                   RISDVSTAKVKSKEDMLARQKAAGINYGSWINDKVVFAHNYVENSDNIKENQFGDFDED
FT                   WENFEFDAEPKAIKKNKIYRPQSTQAPKETVIKTEETDGSHDIDWTQTDDDTKYESHGM
FT                   HVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVFANDVMGSAESLFIKAIEDAVALGA
FT                   DVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYGSDHDDPLATNPDY
FT                   GLVGSPSTGRTPTSVAAINSKWVIQRLMTAKELENRADLNHGKAIYSESVDFKNIKDSL
FT                   GYDKSHQFAYVKESTDAGYKAQDVKDKIALIERDPNKTYDEMIALAKKHGALGVLIFNN
FT                   KPGQSNRSMRLTANGMGIPSAFISHEFGKAMSQLNGNGTGSLEFDSVVSKAPSQKGNEM
FT                   NHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTSMASPQIAGASLLVKQYLE
FT                   KTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVTG
FT                   KDNYGSISLGNITDTMTFDVTVHNLSNKDKTLRYDTELLTDHVDPQKGRFTLTSRSLKT
FT                   YQGGEVTVPANGKVTVRVTMDVSQFTKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNIP
FT                   FVGFKGQFENLAVAEESIYRLKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVS
FT                   TKTISDNGLHTLGTFKNADGKFMLEKNAQGNPVLAISPKW"
FT   gene            346933..349104
FT                   /gene="spyCEP"
FT                   /locus_tag="MGAS10750_Spy0340"
FT   CDS_pept        346933..349104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spyCEP"
FT                   /locus_tag="MGAS10750_Spy0340"
FT                   /product="interleukin-8 protease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37290"
FT                   /db_xref="GOA:Q1J871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J871"
FT                   /protein_id="ABF37290.1"
FT                   /translation="MRKYQGLKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKS
FT                   TTLLGTAFSGKSLTGAELPDGYYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATF
FT                   DPETNRFKPEPLKDRGLAGVRKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQ
FT                   ADGSFILPLDKAKLGDFYYMVEDFAGNVAIAKLGDHLPQTLGKTPIKLKLTDGNYQTKE
FT                   TLKDNLEMTQSDTGLVTNQAQLAVVHRNQPQSQLTKMNQDFFISPNEDGNKDFVAFKGL
FT                   KNNVYNDLTVNVYAKDDHQKQTPIWSSQAGASASAIESTAWYGITARGSKVMPGDYQYV
FT                   VTYRDEHGKEHQKQYTISVNDKKPMITQGRFDTINGVDHFTPDKTKALGSSGIVREEVF
FT                   YLAKKNGRKFDVTEGKDGITVSDNKVYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGN
FT                   VSFATLRDLKAVGKDKAVVNFGLDLPVPEDKQIVNFTYLVRDADGKPIENLEYYNNSGN
FT                   SLILPYGKYTVELLTYDTNAAKLESDKIVSFTLSADNNFQQVTFKMTMLATSQITAHFD
FT                   HLLPEGSRVSLKTAQGQLIPLEQSLYVPKAYGKTVQEDTYEVVVSLPKGYRIEGNTKVN
FT                   ALPNEVHELSLRLVKVGDASDSTGDHKVMSKNNSQALTVSATPTKTTTSATAKALPSAG
FT                   EKMGLKLRIVGLVLLGLTCVFSRKKSTKD"
FT   gene            complement(349426..349554)
FT                   /locus_tag="MGAS10750_Spy0341"
FT   CDS_pept        complement(349426..349554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J870"
FT                   /protein_id="ABF37291.1"
FT                   /translation="MLNDKAKASFFDTCSGSDKPVCFITLITAEASGCSYSSGVFG"
FT   gene            349594..349773
FT                   /locus_tag="MGAS10750_Spy0342"
FT   CDS_pept        349594..349773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J869"
FT                   /protein_id="ABF37292.1"
FT                   /translation="MYSKSINSSADATSDFYVRSEPNQLLFAMVKVAPIGIFEILGSKI
FT                   RHRIPKEVAAVSTT"
FT   gene            349876..350583
FT                   /locus_tag="MGAS10750_Spy0343"
FT   CDS_pept        349876..350583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0343"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37293"
FT                   /db_xref="GOA:Q1J868"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J868"
FT                   /protein_id="ABF37293.1"
FT                   /translation="MSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQGKRFAGVQT
FT                   GNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWATKKRLHWYLLSSVMLTG
FT                   LAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKNAAYLLTKG
FT                   LYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYVNYLLAQEF
FT                   YHIQTKIKPIKRT"
FT   gene            350726..350926
FT                   /locus_tag="MGAS10750_Spy0344"
FT   CDS_pept        350726..350926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0344"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J540"
FT                   /protein_id="ABF37294.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETWKEMEDFIEMNDCLRPTLI"
FT   gene            351011..351799
FT                   /locus_tag="MGAS10750_Spy0345"
FT   CDS_pept        351011..351799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0345"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37295"
FT                   /db_xref="GOA:Q1J866"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J866"
FT                   /protein_id="ABF37295.1"
FT                   /translation="MSNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   QENAQYYQTVEKSRGQIEVREYWVSSDIKWLCQNRPKWHKLRGIGMTRNTIDKDGQLSQ
FT                   ENRYFIFSFKPDVLTFANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKM
FT                   CLYFLKVMVFPKKGLSYRRKQRYISVHLEDYLVQLFGERG"
FT   gene            351804..351944
FT                   /locus_tag="MGAS10750_Spy0346"
FT   CDS_pept        351804..351944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J865"
FT                   /protein_id="ABF37296.1"
FT                   /translation="MIDLKRNLFKIDVRAQKDEEKVFMRTACPPLIDWFCCPLKYDIID
FT                   H"
FT   gene            352079..354079
FT                   /gene="metS"
FT                   /locus_tag="MGAS10750_Spy0347"
FT   CDS_pept        352079..354079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="MGAS10750_Spy0347"
FT                   /product="Methionyl-tRNA synthetase / Protein secretion
FT                   chaperonin CsaA"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37297"
FT                   /db_xref="GOA:Q1J864"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J864"
FT                   /protein_id="ABF37297.1"
FT                   /translation="MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVF
FT                   YLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEV
FT                   VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVE
FT                   WVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLS
FT                   QLIDAQLADYHKHMEAVDYPRALEAIWTIIARTNKYIDETAPWVLAKEDGDKAQLASVM
FT                   AHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIF
FT                   PRLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKE
FT                   VSKVEGSEKLLRFRVDAGDGQDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKQY
FT                   ISQGMILSAEHGDQLTVLTVDPSVPNGSIIG"
FT   gene            354410..354577
FT                   /locus_tag="MGAS10750_Spy0348"
FT   CDS_pept        354410..354577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J863"
FT                   /protein_id="ABF37298.1"
FT                   /translation="MLKSKRDIPSNHCCLAGLFVLLKKTVPVCLASSDDLGLALLDFCL
FT                   KNTSSLEGDK"
FT   gene            354574..355587
FT                   /gene="nrdF1"
FT                   /locus_tag="MGAS10750_Spy0349"
FT   CDS_pept        354574..355587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF1"
FT                   /locus_tag="MGAS10750_Spy0349"
FT                   /product="Ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37299"
FT                   /db_xref="GOA:Q1J862"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J862"
FT                   /protein_id="ABF37299.1"
FT                   /translation="MTQYYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYESPFTEEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            355591..356025
FT                   /gene="nrdI"
FT                   /locus_tag="MGAS10750_Spy0350"
FT   CDS_pept        355591..356025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="MGAS10750_Spy0350"
FT                   /product="NrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37300"
FT                   /db_xref="GOA:Q1J861"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J861"
FT                   /protein_id="ABF37300.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQNKPTT"
FT   gene            356045..358225
FT                   /gene="nrdE1"
FT                   /locus_tag="MGAS10750_Spy0351"
FT   CDS_pept        356045..358225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE1"
FT                   /locus_tag="MGAS10750_Spy0351"
FT                   /product="Ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37301"
FT                   /db_xref="GOA:Q1J860"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J860"
FT                   /protein_id="ABF37301.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKHYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRLSDLNCAPSVETGNAA
FT                   NHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKGAFAGF
FT                   SLSTYADGTYFAKYLQEDAKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECHSCMI"
FT   gene            358245..358415
FT                   /locus_tag="MGAS10750_Spy0352"
FT   CDS_pept        358245..358415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37302"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J859"
FT                   /protein_id="ABF37302.1"
FT                   /translation="MSPTTCIGSVRSTFQDKQASALACLFLASKPVSLLLCEAFFEHQN
FT                   LKKKDMESFLG"
FT   gene            complement(358431..359198)
FT                   /gene="spyA"
FT                   /locus_tag="MGAS10750_Spy0353"
FT   CDS_pept        complement(358431..359198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spyA"
FT                   /locus_tag="MGAS10750_Spy0353"
FT                   /product="C3 family ADP-ribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37303"
FT                   /db_xref="GOA:Q1J858"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR016678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J858"
FT                   /protein_id="ABF37303.1"
FT                   /translation="MSGGTMLKKRYQLAMILLLSCFSLIWQTEGLVELFICEHYERAVC
FT                   EGTPAYFTFSDQKGAATLIKKRWGKGLVYPRTEQEAMAAYTCQQASLINTSLDKTKGEL
FT                   SQLTPELKDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNHQFDP
FT                   HILCKIKLGTRYTKHSFMSTTALKNGAMTHRPVEVRICVKKGAKAAFVEPYSAVPSEVE
FT                   LLFPRGCQLEVVGAYVSQDHKKLHIEACFKGSL"
FT   gene            359624..360136
FT                   /locus_tag="MGAS10750_Spy0354"
FT   CDS_pept        359624..360136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J857"
FT                   /protein_id="ABF37304.1"
FT                   /translation="MKWGDFMKTKKSKRFLNLATLCLALLGTTLLMGRPVKAEGSVVSD
FT                   NSSGSTSSLVDDSERDKIGRQYEAGDLTLPYNKGRYDGYIDGYEDGKKQGALHPDPTGD
FT                   HLNKLPKTIPYKFNDRSQKMNYEGGYSDSYPAGYYNGWADNNKIQATLEWLWGEISNWF
FT                   SSIFTTE"
FT   gene            360374..360811
FT                   /locus_tag="MGAS10750_Spy0355"
FT   CDS_pept        360374..360811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0355"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37305"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J856"
FT                   /protein_id="ABF37305.1"
FT                   /translation="MRTKSNYFLNLATLCLALFGAILLMAQPANAEEVSPNIGVEGTSQ
FT                   YYGEMQGEYDEEAELSSKDREFGRQNGQKDGKEGKNGFGPTINRDDIQVPEKVKHQDEY
FT                   QDGYEQGYREGWQQEHPLLGVVFDVFDLIWGAVGGFFSLAN"
FT   gene            361044..361295
FT                   /locus_tag="MGAS10750_Spy0356"
FT   CDS_pept        361044..361295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0356"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37306"
FT                   /db_xref="GOA:Q1J855"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J855"
FT                   /protein_id="ABF37306.1"
FT                   /translation="MSEKKVLPVLSMVVSFVCLLDHIFFFATYSYLYLPLVASSLALIG
FT                   LVQNKGRQKVWSLAGLVLAALAVAVVAYAYYDPTVIPY"
FT   gene            complement(361389..362096)
FT                   /locus_tag="MGAS10750_Spy0357"
FT   CDS_pept        complement(361389..362096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37307"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J854"
FT                   /protein_id="ABF37307.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDEIKWELDPDTSPAIHVTISPE
FT                   NGTNKLHFTLPKGWSVSFKKKDSSANKSYSPVKINDKSLSEYCKPQHNNGTQGTKNTSP
FT                   KVITSDSETNHCKLSFIYNDNHGDGGLPITVTVDKPNEGDELTLLYRADDGFFGGFTKL
FT                   KDSQTLKKEKEKKERQLAEEKQIEEERKHVEQKQLEESMLKQIREEDHKPWHQRLSESI
FT                   QQDQWWNFKGLFQ"
FT   gene            complement(362610..362777)
FT                   /locus_tag="MGAS10750_Spy0358"
FT   CDS_pept        complement(362610..362777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37308"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J853"
FT                   /protein_id="ABF37308.1"
FT                   /translation="MIDFYNIKSETKFSYCHLIGSTQTYTYSQQFVEFIVNEIKKDPQN
FT                   FVESLKKSNK"
FT   gene            complement(363107..363577)
FT                   /locus_tag="MGAS10750_Spy0359"
FT   CDS_pept        complement(363107..363577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37309"
FT                   /db_xref="InterPro:IPR022104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J852"
FT                   /protein_id="ABF37309.1"
FT                   /translation="MENLSERLVLKSIEAFIMGLEIYNKPTIKYRIEGFSFFICNAWEL
FT                   MLKAEMLNRGFSIYYSDNPERTLSLEYVLKKIYSDENTRIRLNLEKIIELRNISTHFIT
FT                   EDYEIKYAPLFQACVLNLASEMKRFHNKDITESIAHNFLTISASYEPLSNEE"
FT   gene            364151..364513
FT                   /locus_tag="MGAS10750_Spy0360"
FT   CDS_pept        364151..364513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37310"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J851"
FT                   /protein_id="ABF37310.1"
FT                   /translation="MMLSINPLITPFSNRKQIYYPTRVRINWRKNEKIRYTKKENNMTF
FT                   EEILPGLKAKKKYVRTGWGGAENYVQLFDTLEVDGKVLQATPYFLIHVTGAGEGFSMWA
FT                   PTPCDVLAEDWIEVND"
FT   gene            364506..365204
FT                   /locus_tag="MGAS10750_Spy0361"
FT   CDS_pept        364506..365204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0361"
FT                   /product="Short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37311"
FT                   /db_xref="GOA:Q1J850"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J850"
FT                   /protein_id="ABF37311.1"
FT                   /translation="MTKVVLVTGCASGIGYAQARYFLSQGYHVYGVDKSDKPDLNGNFH
FT                   FIKLDLSSELSPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRHMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTASDFEPGGLADWVARETPIGRWTEPSEVAELTGFLASGKTRSMQGEI
FT                   VKIDGGWTLK"
FT   gene            365247..366239
FT                   /locus_tag="MGAS10750_Spy0362"
FT   CDS_pept        365247..366239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0362"
FT                   /product="NAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37312"
FT                   /db_xref="GOA:Q1J849"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J849"
FT                   /protein_id="ABF37312.1"
FT                   /translation="MMSQTVKGDEQMKLAVLGTGMIVKEVLPVLQKIDGIDLVAILSTV
FT                   RSLKTAKDLAKAYKMPLATSKYEAILGNEEIDTVYIGLPNHLHFAYAKEALLAGKHVIC
FT                   EKPFTMTAGELDELVVIAKKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQ
FT                   YSSRYDAFKRGDIAPAFNPKMGGGALRDLNIYNIHFVVGLFGRPKTVQYLANVEKGIDT
FT                   SGMLVMDYEQFKVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNSLPQVQLSLHGHEPQV
FT                   INHNKYEHRMYEEFVAFKDMIDQKDFEKVNQALEHSRAVMAVLERAVHS"
FT   gene            366566..367909
FT                   /locus_tag="MGAS10750_Spy0363"
FT   CDS_pept        366566..367909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0363"
FT                   /product="Phosphoglycerate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37313"
FT                   /db_xref="GOA:Q1J848"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J848"
FT                   /protein_id="ABF37313.1"
FT                   /translation="MFMEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKL
FT                   MSNTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICI
FT                   LIGFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSA
FT                   LLPLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTM
FT                   YGDAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYL
FT                   SQVANMSEAHIHFAISILEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYE
FT                   RLTATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIG
FT                   NMGANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            368082..369464
FT                   /gene="gcaD"
FT                   /locus_tag="MGAS10750_Spy0364"
FT   CDS_pept        368082..369464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="MGAS10750_Spy0364"
FT                   /product="Glucosamine-1-phosphate acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.-"
FT                   /EC_number="2.7.7.23"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37314"
FT                   /db_xref="GOA:Q1J847"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J847"
FT                   /protein_id="ABF37314.1"
FT                   /translation="MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAINP
FT                   EKAVTVIGHKSEMVRAVLADQSAFVHQTEQLGTGHAVMMAETQLEGLEGHTLVIAGDTP
FT                   LITGESLKSLIDFHVNHKNVATILTATAQDPFGYGRIVRNKDGEVIKIVEQKDANEYEQ
FT                   QLKEINTGTYVFDNKRLFEALKCITTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNE
FT                   SLGVNDRVALATAETVMRQRITQKHMVNGVTFQNPETVYIESDVEIAPDVLIEGNVTLK
FT                   GRTHIGSGTVLTNGTYIVDSEIGDNCVVTNSMIESSVLAAGVTVGPYAHLRPGTTLDRE
FT                   VHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDGQNKYETVIGDH
FT                   AFIGSNSTLIAPLEVGDNALTAAGSTISKTVPADSIVIGGSRQVTKEGYAKRLAHHPSG
FT                   SK"
FT   gene            369495..370049
FT                   /locus_tag="MGAS10750_Spy0365"
FT   CDS_pept        369495..370049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0365"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37315"
FT                   /db_xref="GOA:Q1J846"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J846"
FT                   /protein_id="ABF37315.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPERKIVLVKQYRKAIESVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLTQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFGGEQ"
FT   gene            370046..370300
FT                   /locus_tag="MGAS10750_Spy0366"
FT   CDS_pept        370046..370300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0366"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37316"
FT                   /db_xref="GOA:Q1J845"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J845"
FT                   /protein_id="ABF37316.1"
FT                   /translation="MMGRPLLTDDIIEKARRMETFEPDDAVDFDTKVMTLPEKDEKARI
FT                   YKSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            370320..371015
FT                   /gene="pfs"
FT                   /locus_tag="MGAS10750_Spy0367"
FT   CDS_pept        370320..371015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="MGAS10750_Spy0367"
FT                   /product="5'-methylthioadenosine nucleosidase /
FT                   S-adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37317"
FT                   /db_xref="GOA:Q1J844"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J844"
FT                   /protein_id="ABF37317.1"
FT                   /translation="MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELVL
FT                   VQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDVTA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQNKIDQIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQIL
FT                   MTFLENLPV"
FT   gene            371166..371507
FT                   /locus_tag="MGAS10750_Spy0368"
FT   CDS_pept        371166..371507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J843"
FT                   /protein_id="ABF37318.1"
FT                   /translation="MTIKKHYYLLSLLALVTVGAAFNTSQSVSAQVYSNGGYRQGLTDE
FT                   KSHLQYSKDNAQLQLRNILNGYQDDLGRNYSSYYYYNLRTVMGLSKEQKIEEHYEKLKD
FT                   ELYRMYNHY"
FT   gene            complement(371604..372251)
FT                   /gene="scaR"
FT                   /locus_tag="MGAS10750_Spy0369"
FT   CDS_pept        complement(371604..372251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scaR"
FT                   /locus_tag="MGAS10750_Spy0369"
FT                   /product="Iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37319"
FT                   /db_xref="GOA:Q1J842"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J842"
FT                   /protein_id="ABF37319.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQEPKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNTQEVHQEAEVLEHT
FT                   VSDTFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLETHHLNINAELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            372394..373329
FT                   /gene="mtsA"
FT                   /locus_tag="MGAS10750_Spy0370"
FT   CDS_pept        372394..373329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="MGAS10750_Spy0370"
FT                   /product="Manganese-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37320"
FT                   /db_xref="GOA:Q1J841"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J841"
FT                   /protein_id="ABF37320.1"
FT                   /translation="MMGKRMSLILGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIA
FT                   DMTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDVEKTSNADVIFYNGINLEDGGQAWFTK
FT                   LVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAK
FT                   DPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSA
FT                   YIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFT
FT                   DSIAKKGKPGDSYYAMMKWNLDKISEGLAK"
FT   gene            373366..374118
FT                   /gene="mtsB"
FT                   /locus_tag="MGAS10750_Spy0371"
FT   CDS_pept        373366..374118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="MGAS10750_Spy0371"
FT                   /product="Manganese transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37321"
FT                   /db_xref="GOA:Q1J840"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J840"
FT                   /protein_id="ABF37321.1"
FT                   /translation="MFYLCKGDKMITTNNLCVTYDGNSNALEAINVTIDGPSIVGIIGP
FT                   NGAGKSTFMKAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVAL
FT                   GTYSKLGLFRRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESD
FT                   YIFLDEPFVGIDSVSEKIIVDLLKELKMAGKTILIVHHDLSKVEHYFDKLMILNKHLVA
FT                   YGNVCEVFTVDTLSKAYGNHLILGKEMV"
FT   gene            374119..374973
FT                   /gene="mtsC"
FT                   /locus_tag="MGAS10750_Spy0372"
FT   CDS_pept        374119..374973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="MGAS10750_Spy0372"
FT                   /product="Manganese transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37322"
FT                   /db_xref="GOA:Q1J839"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J839"
FT                   /protein_id="ABF37322.1"
FT                   /translation="MSMKFFEGLMSHHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGVNFFIGAIIFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFD
FT                   PILAKSMGVKVNAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(375121..375927)
FT                   /locus_tag="MGAS10750_Spy0373"
FT   CDS_pept        complement(375121..375927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0373"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37323"
FT                   /db_xref="GOA:Q1J838"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J838"
FT                   /protein_id="ABF37323.1"
FT                   /translation="MKKLLSLSLVAISLLSLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTSQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPEQDITITSIDIVKDYRFKN"
FT   gene            376144..378549
FT                   /gene="ftsK"
FT                   /locus_tag="MGAS10750_Spy0374"
FT   CDS_pept        376144..378549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="MGAS10750_Spy0374"
FT                   /product="Cell division protein ftsK"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37324"
FT                   /db_xref="GOA:Q1J837"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J837"
FT                   /protein_id="ABF37324.1"
FT                   /translation="MVKRNQRRKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAML
FT                   RLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEW
FT                   HAFLFAMPRMLDQDIFLGTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSY
FT                   FIGFLFILLGLFLMTPWDIYDVSHLVKEAVDKLAVAYQENKEKRFIKREEHRLQAEKEA
FT                   LEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDEAS
FT                   LFDQEDLAYAHEEIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPD
FT                   KPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISN
FT                   LADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPL
FT                   GKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFMMIDPKMV
FT                   ELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGYNTKVEEFN
FT                   ASSEQKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVD
FT                   VISGLIKANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSF
FT                   ISDDDVERIVNFIKDQAEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLE
FT                   TQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN"
FT   gene            complement(378619..378972)
FT                   /locus_tag="MGAS10750_Spy0375"
FT   CDS_pept        complement(378619..378972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0375"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37325"
FT                   /db_xref="GOA:Q1J836"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J836"
FT                   /protein_id="ABF37325.1"
FT                   /translation="MMIYKLTALAFLIVTPLFAMIVTSLFKLNKKGFNFPDVALLLFAI
FT                   EIVLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVI
FT                   FYLILVIFIFTLA"
FT   gene            379144..379641
FT                   /gene="rplK"
FT                   /locus_tag="MGAS10750_Spy0376"
FT   CDS_pept        379144..379641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="MGAS10750_Spy0376"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37326"
FT                   /db_xref="GOA:Q1J835"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J835"
FT                   /protein_id="ABF37326.1"
FT                   /translation="MQYCISVGGKNLNYRQNHNRRIFKMAKKVEKLVKLQIPAGKATPA
FT                   PPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLK
FT                   KAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTV
FT                   TD"
FT   gene            379747..380436
FT                   /gene="rplA"
FT                   /locus_tag="MGAS10750_Spy0377"
FT   CDS_pept        379747..380436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="MGAS10750_Spy0377"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37327"
FT                   /db_xref="GOA:Q1J834"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J834"
FT                   /protein_id="ABF37327.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            380758..381486
FT                   /gene="pyrH"
FT                   /locus_tag="MGAS10750_Spy0378"
FT   CDS_pept        380758..381486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="MGAS10750_Spy0378"
FT                   /product="Uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37328"
FT                   /db_xref="GOA:Q1J833"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J833"
FT                   /protein_id="ABF37328.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            381515..382072
FT                   /gene="rrf"
FT                   /locus_tag="MGAS10750_Spy0379"
FT   CDS_pept        381515..382072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="MGAS10750_Spy0379"
FT                   /product="Ribosome Recycling Factor (RRF)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37329"
FT                   /db_xref="GOA:Q1J832"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J832"
FT                   /protein_id="ABF37329.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   gene            382181..383038
FT                   /locus_tag="MGAS10750_Spy0380"
FT   CDS_pept        382181..383038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0380"
FT                   /product="S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37330"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J831"
FT                   /protein_id="ABF37330.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIQKEGFTFTLSKAEGERQVGDMV
FT                   TGFAYIDIKQKARLTTKEIRSTRTSYGWGEVTEIRRDLGVFVDTGIPNKEIVVSLDVLP
FT                   EMKELWPKKGDKLYIRLDVDKKDRIWGLPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEEIKAIFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   gene            383149..383619
FT                   /gene="msrA2"
FT                   /locus_tag="MGAS10750_Spy0381"
FT   CDS_pept        383149..383619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA2"
FT                   /locus_tag="MGAS10750_Spy0381"
FT                   /product="Peptide methionine sulfoxide reductase msrA"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37331"
FT                   /db_xref="GOA:Q1J830"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J830"
FT                   /protein_id="ABF37331.1"
FT                   /translation="MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEII
FT                   FDPEEISYKELVELYWAHTDPTDAFGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQA
FT                   SGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQFLEENWS"
FT   gene            383616..383831
FT                   /locus_tag="MGAS10750_Spy0382"
FT   CDS_pept        383616..383831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0382"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37332"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J829"
FT                   /protein_id="ABF37332.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELIS
FT                   RYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            383987..385168
FT                   /locus_tag="MGAS10750_Spy0383"
FT   CDS_pept        383987..385168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0383"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37333"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J828"
FT                   /protein_id="ABF37333.1"
FT                   /translation="MIITKKSLFVTSVALSLAPLATAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATTLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQSTVPMAPSATPSDVPTTPFASAKPDSSVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVPQEAVPTPKAAETTEVEPKTDISEDSTSANRPVPNE
FT                   SASEEVSSAAPAQAPAEKEETSQMLTAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNA
FT                   GLQPQTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPENSALGDQVAQYAID
FT                   HMAERGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            385409..387256
FT                   /locus_tag="MGAS10750_Spy0384"
FT   CDS_pept        385409..387256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0384"
FT                   /product="Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37334"
FT                   /db_xref="GOA:Q1J827"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J827"
FT                   /protein_id="ABF37334.1"
FT                   /translation="MTTEQSALTFGVMISLCLTIQGGLEMYYTSGNYEAFATPRKPEGV
FT                   DQKSAYIVGTGLAGLAAAVFLIRDGHMAGERIRLFEELPLAGGSLDGIEKPHLGFVTRG
FT                   GREMENHFECMWDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDG
FT                   QYTLGKQSKELIHLIMKTEESLGDQTIEEFFSEDFFKSNFWIYWATMFAFEKWHSAVEM
FT                   RRYAMRFIHHIDGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQ
FT                   TAGKKVAKTIHMTVSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKALGGSW
FT                   NLWENLAAQSDDFGHPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHDGKVN
FT                   TGGIITITDSNWMMSFAIHRQPHFKEQKDNETTVWIYGLYSNSEGNYVHKKIEECTGQE
FT                   ITEEWLYHLGVPVDKIKDLASQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLA
FT                   FIGNFAESPSRDTVFTTEYSIRTAMEAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLN
FT                   DKKAIKDMDLPIPALIEKIGHKKIKDTFIEELLKDANLM"
FT   gene            387415..388467
FT                   /gene="phoH"
FT                   /locus_tag="MGAS10750_Spy0385"
FT   CDS_pept        387415..388467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="MGAS10750_Spy0385"
FT                   /product="PhoH protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37335"
FT                   /db_xref="GOA:Q1J826"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J826"
FT                   /protein_id="ABF37335.1"
FT                   /translation="MQEYSIDITLTHPDDVLALFGSNERHLKLIEAHLGVIVHARTERV
FT                   QVIGDDEEAVELARLTIKALLVLVGRGMVVNTSDVVTALSMAESHQIDQFMALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEEMKDLLKPKASDVEADYQPGL
FT                   TKYPVIGQEH"
FT   gene            388513..389088
FT                   /locus_tag="MGAS10750_Spy0386"
FT   CDS_pept        388513..389088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0386"
FT                   /product="Uracil DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37336"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J825"
FT                   /protein_id="ABF37336.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFEDYLPDYFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            389196..389744
FT                   /locus_tag="MGAS10750_Spy0387"
FT   CDS_pept        389196..389744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0387"
FT                   /product="hypothetical metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37337"
FT                   /db_xref="GOA:Q1J824"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J824"
FT                   /protein_id="ABF37337.1"
FT                   /translation="MPNIPNEVGSPSLTINLMYIEMIDETGQVSQEIMEQTLDLLNFAA
FT                   QKTGKEEKEMSVTFVTNERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPS
FT                   LAEMMAEFDAYIGELFISIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEE
FT                   KEMFTLQEEILTAYGLTRQ"
FT   gene            389725..390132
FT                   /gene="dgk"
FT                   /locus_tag="MGAS10750_Spy0388"
FT   CDS_pept        389725..390132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="MGAS10750_Spy0388"
FT                   /product="Diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37338"
FT                   /db_xref="GOA:Q1J823"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J823"
FT                   /protein_id="ABF37338.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLLS
FT                   ACLACVAGLFFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            390252..391148
FT                   /gene="era"
FT                   /locus_tag="MGAS10750_Spy0389"
FT   CDS_pept        390252..391148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="MGAS10750_Spy0389"
FT                   /product="GTP-binding protein era"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37339"
FT                   /db_xref="GOA:Q1J822"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J822"
FT                   /protein_id="ABF37339.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLAQIDDFRSQMEFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMIREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            391123..391644
FT                   /locus_tag="MGAS10750_Spy0390"
FT   CDS_pept        391123..391644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0390"
FT                   /product="Phosphohydrolase"
FT                   /note="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37340"
FT                   /db_xref="GOA:Q1J821"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J821"
FT                   /protein_id="ABF37340.1"
FT                   /translation="MAIMRKNTNIVKRDHMPQDYISYIRSKVGHDKIILNFAGGILTDD
FT                   DGKVLMQLRGDKKTWAIPGGTMELGESSLETCKREFLEETGIEVEAVRLLNVYTHFEEV
FT                   YPNGDAVQTIVFIYELTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEE
FT                   YFSDSFAMGH"
FT   gene            complement(391949..392203)
FT                   /locus_tag="MGAS10750_Spy0391"
FT   CDS_pept        complement(391949..392203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J820"
FT                   /protein_id="ABF37341.1"
FT                   /translation="MSGLFYHKSYFFKSKQVYDLLNEIRMRYPHAHIILIGNHINYEEI
FT                   FKNHYRVFGVIDTTSHKSLRSIRDQIQLYLDELYNSNNG"
FT   gene            392504..392722
FT                   /locus_tag="MGAS10750_Spy0392"
FT   CDS_pept        392504..392722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0392"
FT                   /product="Response regulator FasA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37342"
FT                   /db_xref="GOA:Q1J819"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J819"
FT                   /protein_id="ABF37342.1"
FT                   /translation="MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQR
FT                   LERKIYLKKRFILSSIKAKSYCSKRSS"
FT   gene            complement(392805..393251)
FT                   /locus_tag="MGAS10750_Spy0393"
FT   CDS_pept        complement(392805..393251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0393"
FT                   /product="Bacteriocin processing peptidase / Bacteriocin
FT                   export ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37343"
FT                   /db_xref="GOA:Q1J818"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J818"
FT                   /protein_id="ABF37343.1"
FT                   /translation="MSYKYGFGRDTLSDISLTIKEGEKVSIVGISGSGKTILAKMIVNF
FT                   FEPYKGQISINHQNLKMIDKKVLRQHINYLPQQAHIFSGSILENLTLGANHSTSQEDIL
FT                   INIRNDIHILKFDTYFQTGQNIKKEKRIKRKIFHSYFIYIYFSM"
FT   gene            complement(393474..394184)
FT                   /locus_tag="MGAS10750_Spy0394"
FT   CDS_pept        complement(393474..394184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0394"
FT                   /product="Bacteriocin processing peptidase / Bacteriocin
FT                   export ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37344"
FT                   /db_xref="GOA:Q1J817"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J817"
FT                   /protein_id="ABF37344.1"
FT                   /translation="MSFLPLIFKQESLIFYIVLASLLVTLINIGGSYYLQGIWDEYIPN
FT                   QMKPTLGIISIGLIVTYILQQMMSFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFV
FT                   TRRTGEIISRFTDANAIIDTLASTILSLFLDVSILSIVGGVLLVQNTNLFLLSLISIPI
FT                   YIIIIFTFMKPFEKMNNNVMQSNSMASSAIIEDINGIETIKSLTSEEIRYQKIDSEFVD
FT                   YLDKSFKLSKYSTK"
FT   gene            complement(394289..394525)
FT                   /locus_tag="MGAS10750_Spy0395"
FT   CDS_pept        complement(394289..394525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0395"
FT                   /product="Bacteriocin processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37345"
FT                   /db_xref="GOA:Q1J816"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J816"
FT                   /protein_id="ABF37345.1"
FT                   /translation="MTSCKRTFVPQIDARDCGIAALASIAKFYGSDYSLTHLRELAKTN
FT                   KEGTTTLGIVKAAKEMGFEKNISSLEIQIPPLK"
FT   gene            394706..395047
FT                   /locus_tag="MGAS10750_Spy0396"
FT   CDS_pept        394706..395047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37346"
FT                   /db_xref="GOA:Q1J815"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J815"
FT                   /protein_id="ABF37346.1"
FT                   /translation="MMKKEHLKILRGTDFLRCYTEHVKVATRHNKKLYKEIFVMNTTIK
FT                   QFEIMDEAMLTGIEGGCSWHGLAQAAVFTGAGNGFRLGVKTRTWQGAAAGAAGGLVIGG
FT                   VGYGATCWW"
FT   gene            395025..395201
FT                   /locus_tag="MGAS10750_Spy0397"
FT   CDS_pept        395025..395201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J814"
FT                   /protein_id="ABF37347.1"
FT                   /translation="MGRLVGGNNHGYQKFFAWFSYWFTLPNFRQYIIEYPEKLEKPIED
FT                   TKMGLYSVYIGDL"
FT   gene            396414..396644
FT                   /locus_tag="MGAS10750_Spy0398"
FT   CDS_pept        396414..396644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37348"
FT                   /db_xref="GOA:Q1J813"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J813"
FT                   /protein_id="ABF37348.1"
FT                   /translation="MMNTKTMEQFEVMNSEMLAGVEGGWGGWGEAIAGLLGGFAPSPTL
FT                   DQLNGKWPIRKPSKPCSPYGTGGTPNTCNGL"
FT   gene            396681..397010
FT                   /locus_tag="MGAS10750_Spy0399"
FT   CDS_pept        396681..397010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J812"
FT                   /protein_id="ABF37349.1"
FT                   /translation="MEVDMLTLYKRQIAEVWEIGRETPQPEWVRDAFRKNYICWLDEHV
FT                   RILMTGLNPSLTTNLKISATGTVGGGFAGYGMYVLGYPGDFLDVTNHRVISAKKFHKEY
FT                   QIIDG"
FT   gene            397076..397357
FT                   /locus_tag="MGAS10750_Spy0400"
FT   CDS_pept        397076..397357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0400"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37350"
FT                   /db_xref="GOA:Q1J811"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J811"
FT                   /protein_id="ABF37350.1"
FT                   /translation="MEDCRKYFLCRFSFIHHLFGTKIISSTLKIHPNSLYRWIQEYEKY
FT                   GESAFPGHGSALRHAQFETKKLEKEHKLLQEELALLKKFQVFLKPNWK"
FT   gene            397390..397686
FT                   /locus_tag="MGAS10750_Spy0401"
FT   CDS_pept        397390..397686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0401"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37351"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J810"
FT                   /protein_id="ABF37351.1"
FT                   /translation="MNSHHACQTLQVSRSGFYAYLKRRPSSRHVENEALKEMIKAIFYE
FT                   HKERYGSVRITQELCRRGIHVNHKRVGRLLHQLGLYAKGSRYQYKYYNRRRSS"
FT   gene            397789..398103
FT                   /locus_tag="MGAS10750_Spy0402"
FT   CDS_pept        397789..398103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0402"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37352"
FT                   /db_xref="GOA:Q1J809"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J809"
FT                   /protein_id="ABF37352.1"
FT                   /translation="MSVFIDVYSRKIVGWAMGRRMQDKLVTEAFNQAYNREKPKEGVIV
FT                   HTDQGSQYTGARFQDLLRRKKCKSSMSRKGNPYDNALMESFYKTLKRELVNDAHFATIK
FT                   "
FT   gene            398592..399341
FT                   /locus_tag="MGAS10750_Spy0403"
FT   CDS_pept        398592..399341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0403"
FT                   /product="Response regulator FasA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37353"
FT                   /db_xref="GOA:Q1J808"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J808"
FT                   /protein_id="ABF37353.1"
FT                   /translation="MNIFVLEDDFLHQTRIGKIIYKILTDNKLEVNHLEVYGKPNQLLE
FT                   DISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNRDPHAVIVFVTTHSEFMPVSFQYQVS
FT                   ALDFIDKELPEELFSHRIEKAITYVQDNQGKTLAEDSFVFINVKSQIQVPFSDLLYIET
FT                   SLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLK
FT                   GGLSCIVSRLKIRSLIKVVEELHTKEK"
FT   gene            399342..400676
FT                   /locus_tag="MGAS10750_Spy0404"
FT   CDS_pept        399342..400676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0404"
FT                   /product="Sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37354"
FT                   /db_xref="GOA:Q1J807"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J807"
FT                   /protein_id="ABF37354.1"
FT                   /translation="MIYLINMIVITLNVVVLLLIHARIFGYRMDTKKSLLGILTFYICS
FT                   LLSTSLSNLLSVGFLGGLLLYPLFFLLYTRYIARRKVNGSLLLFYSLFPIAFWDVIHSF
FT                   IVYFIVFYISFLKNNYHSNIIIMIFSIVAGTMVLLLIQAFNYDFSHLRKKKLNQRTRKI
FT                   ISIANFSMILYFITIPMIDFIEEVENINFTHYQEMITAIYFLLFICFVNLLDRNLRQEL
FT                   QKQVVLQKELQLQNMARYSKQIEGLYQNIRSFRHDYANILTSLKIGIDCKDIEMISSIY
FT                   HKVLKDSGKVLRGEKFNLARLRNINDLPLKSLLFVKLSEAQRLSIPVSIEIGEPISIKN
FT                   IELIDFLTLVSILIDNAIEGAAESGIVLCFFEQFGKQILIVQNDTFEKQINLSTIFERG
FT                   VSSKGNNRGVGLSNVREILESYPTVTLKTVSNHFVFKQILEIEIL"
FT   gene            complement(400824..400949)
FT                   /locus_tag="MGAS10750_Spy0405"
FT   CDS_pept        complement(400824..400949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37355"
FT                   /db_xref="GOA:Q1J806"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J806"
FT                   /protein_id="ABF37355.1"
FT                   /translation="MNNKKTKNNFSTLSESELLKVIGGDIFKLVIDHISMKARKK"
FT   gene            complement(401026..401643)
FT                   /locus_tag="MGAS10750_Spy0406"
FT   CDS_pept        complement(401026..401643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0406"
FT                   /product="Bacteriocin export accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37356"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J805"
FT                   /protein_id="ABF37356.1"
FT                   /translation="MANLSIQRASTGNLSLPDTSHRIKIDILKTQFLQNASQQLTTVEN
FT                   QITELKDQIEQANIQLKNNIIIAPETGTIHLNSEFEGKSLIPNGSEVAQIYPDIQKIKE
FT                   VFITYYVTSEHVSLLKEKQGVRLSLEKVGNQTLTINGTIQTIDKSATKTDQGNLFKVTA
FT                   LSKLSNKDSDVVQYGLQGRVTSVITRKSYFNYYKDKILNSFN"
FT   gene            complement(401950..402408)
FT                   /locus_tag="MGAS10750_Spy0407"
FT   CDS_pept        complement(401950..402408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0407"
FT                   /product="Bacteriocin export accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37357"
FT                   /db_xref="GOA:Q1J804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J804"
FT                   /protein_id="ABF37357.1"
FT                   /translation="MVKENNMNPNLFKSAEFYHRRHHNFATFLILPSVLLVSFLVLFSL
FT                   FAKKEITITSQGEMTPTKVIASVQSTSDHTIVVNNLKNNKFIKKGDVIIQYSKTMENSQ
FT                   KKALEKQLATLNKQKNGLQILKTSLEQETNLFKGEDEFGYSDTFNHFF"
FT   gene            complement(402401..404554)
FT                   /locus_tag="MGAS10750_Spy0408"
FT   CDS_pept        complement(402401..404554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0408"
FT                   /product="Bacteriocin processing peptidase / Bacteriocin
FT                   export ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37358"
FT                   /db_xref="GOA:Q1J803"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J803"
FT                   /protein_id="ABF37358.1"
FT                   /translation="MISYRKTFVAQIDARDCGVAALASIAKYYGSDYSLAHLRELAKTN
FT                   KEGTTALGIVKAAKLMGFETRAIQADMTLFDIEDVPYPFIVHVNKEGKFQHYYVVYQNK
FT                   KNYLIIGDPDPTVKVTKMTKERFTSEWTGVAIFLAPEPSYKPHKDKKNGLINFLPLIFK
FT                   QRSLIFYIILASLLVTLINIVGSYYLQGILDDYIPNQLKSTLGIISIGLIITYILQQMM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANAIIDALAS
FT                   TILSLFLDVSILTIVGTVLLVQNTNLFLLSLVSVPLYIVIIFIFMHPFEKMNNDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQKIDSEFVDYLDKSFKLSKYSILQSSLKQGAQ
FT                   LILNVIVLWFGAKLVMGGKISVGQLITFNTLLSYFTNPLENIINLQTKLQSAKVANNRL
FT                   NEVYLVDSEFQEAGTLVNQELLHGNIQFEELSYKYGFGRDTLSNINLTIKQGDKVSLVG
FT                   ISGSGKTTLAKMIVNFFEPYNGRITINHNDLKMIDKKSLRQHINYLPQQAYIFNGSILE
FT                   NLTLGANDCTSHEDILRACEVAEIRQDIEQMPMGYQTELSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKRVIDNLLAMTDKTIIFVAHRLSISARTNQVIVLDEGK
FT                   IIETGSHQELMTKQGFYHHLFSG"
FT   gene            404793..405065
FT                   /locus_tag="MGAS10750_Spy0409"
FT   CDS_pept        404793..405065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0409"
FT                   /product="Bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37359"
FT                   /db_xref="GOA:Q1J802"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J802"
FT                   /protein_id="ABF37359.1"
FT                   /translation="MQRDKFKNYEKELFDMEIKKLETFHQMTIEKLAKVEGGKNNWQAN
FT                   VSGVIAAGSAGAAIGFPVCGVACGYIGAKTAITLWAGVTGATGGF"
FT   gene            405078..405275
FT                   /locus_tag="MGAS10750_Spy0410"
FT   CDS_pept        405078..405275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0410"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37360"
FT                   /db_xref="GOA:Q1J801"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J801"
FT                   /protein_id="ABF37360.1"
FT                   /translation="MTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLPHPVL
FT                   AGGCVVGFTVGGAYLGYTAN"
FT   gene            405636..405764
FT                   /gene="silD"
FT                   /locus_tag="MGAS10750_Spy0411"
FT   CDS_pept        405636..405764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silD"
FT                   /locus_tag="MGAS10750_Spy0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J800"
FT                   /protein_id="ABF37361.1"
FT                   /translation="MTGMAGAAQGVTVCAQTGVFIPWQGYILCGAAGAATNIIWPH"
FT   gene            405814..406095
FT                   /locus_tag="MGAS10750_Spy0412"
FT   CDS_pept        405814..406095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37362"
FT                   /db_xref="GOA:Q1J7Z9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z9"
FT                   /protein_id="ABF37362.1"
FT                   /translation="MKILDIIFNLYDRKMIFLENVEKLGGYIVPFTLIILSVAYNFRHP
FT                   YPIWAAVLGGISLIVIFIYFILIVYLYLRYRYLVWKKIPEIKINSTEL"
FT   gene            406289..406699
FT                   /locus_tag="MGAS10750_Spy0413"
FT   CDS_pept        406289..406699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37363"
FT                   /db_xref="GOA:Q1J7Z8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z8"
FT                   /protein_id="ABF37363.1"
FT                   /translation="MRNILRFLGIVIISAVILFSIGSFYDLPLMKNIQLICWSFILDLF
FT                   VFVYKQRQTTEVLTWYQVVKQFWLFIKCTILIPTLIAFIIIIGCLTSISEVSIYFYLHL
FT                   TVVCYTIGMILSLGRLISPNHSIFNKLKKRNE"
FT   gene            complement(406729..406845)
FT                   /locus_tag="MGAS10750_Spy0414"
FT   CDS_pept        complement(406729..406845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37364"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z7"
FT                   /protein_id="ABF37364.1"
FT                   /translation="MTSFGKDEYSRMENRLFLKLQRYLLVTNYSLIESVTLN"
FT   gene            406941..408011
FT                   /locus_tag="MGAS10750_Spy0415"
FT   CDS_pept        406941..408011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z6"
FT                   /protein_id="ABF37365.1"
FT                   /translation="MMMLRDVKVKMSSLLVGCTATLLVSLSSTVAADSVHSSDRRFGVG
FT                   YKEETTSQFSSDQPSQVVLYRGEANTVRFTYTNQMYLMKDIRIALDGSGKSLTAQTVPG
FT                   MGHVYEGFQTSARGIFTMSGVPESTVPVANPNVQTKYTRYFKVIDDMYNTMYKGTVFLV
FT                   QPQAWKYTMKSVDQLPVDDLNHIGVAGIERMTTLIKNAGALLTTGGSGAFPDNIKVSIN
FT                   PKGRQATITYGDGSTDIIPPAVLWKKGSVKEPTETDQSVGTPTPGIPGKFKRDQSLNEH
FT                   EAMVNVEPLSHVVKDNIKVIDEKSTGRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPA
FT                   TALPSVEMSAEDRLKS"
FT   gene            408104..408502
FT                   /locus_tag="MGAS10750_Spy0416"
FT   CDS_pept        408104..408502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z5"
FT                   /protein_id="ABF37366.1"
FT                   /translation="MHRLLNRLIPEEDNNKLSRAAKEVVTEPRLNNPFLLPKKVLSLED
FT                   DAAILNHLEEDRNVNKLFLEPVAAEAKREINFHPSDQQVTAKVKESSDFHQKQHQTGIT
FT                   YGDDTLADLTHHLLHSDGILPSLNDKSA"
FT   gene            complement(408850..409119)
FT                   /locus_tag="MGAS10750_Spy0417"
FT   CDS_pept        complement(408850..409119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37367"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z4"
FT                   /protein_id="ABF37367.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPIPKHTIERKRTAMTIGHSK
FT                   QNPHKKEALKHKKNKNKTLFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            409320..409427
FT                   /locus_tag="MGAS10750_Spy0418"
FT   CDS_pept        409320..409427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37368"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z3"
FT                   /protein_id="ABF37368.1"
FT                   /translation="MNGNDVSSMVLIQSFFITYQADKPAASAISLNMTA"
FT   gene            complement(409543..409692)
FT                   /locus_tag="MGAS10750_Spy0419"
FT   CDS_pept        complement(409543..409692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37369"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z2"
FT                   /protein_id="ABF37369.1"
FT                   /translation="MVNSDITVTYTLKDNLVALHKEYKTFVKKILQINRSPVTTTRLRL
FT                   FITI"
FT   gene            410175..411056
FT                   /gene="mutR"
FT                   /locus_tag="MGAS10750_Spy0420"
FT   CDS_pept        410175..411056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="MGAS10750_Spy0420"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37370"
FT                   /db_xref="GOA:Q1J7Z1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z1"
FT                   /protein_id="ABF37370.1"
FT                   /translation="MKVGKMEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGE
FT                   SEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDY
FT                   AHKDYERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYN
FT                   TLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRD
FT                   ELNFYEKTVFLYVHGYYKLKQKEISGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLG
FT                   GKGDEDWSEADL"
FT   gene            411228..412055
FT                   /gene="fpg"
FT                   /locus_tag="MGAS10750_Spy0421"
FT   CDS_pept        411228..412055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="MGAS10750_Spy0421"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37371"
FT                   /db_xref="GOA:Q1J7Z0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Z0"
FT                   /protein_id="ABF37371.1"
FT                   /translation="MPELPEVETVRRGLEALVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFETALLSSQKPIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP"
FT   gene            412025..412645
FT                   /locus_tag="MGAS10750_Spy0422"
FT   CDS_pept        412025..412645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0422"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37372"
FT                   /db_xref="GOA:Q1J7Y9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y9"
FT                   /protein_id="ABF37372.1"
FT                   /translation="MSKMPEKKTMIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHD
FT                   LQEKGGRLYEALREAFGNQILKADGELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELA
FT                   AKRDHLAQSQAIFFMDIPLLMELGYQDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQ
FT                   RIASQLPIEEKKPYASLVIDNNGDMETLIKQVQSALLSLANPR"
FT   gene            412835..414337
FT                   /locus_tag="MGAS10750_Spy0423"
FT   CDS_pept        412835..414337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0423"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y8"
FT                   /protein_id="ABF37373.1"
FT                   /translation="MTTMTIAKGNQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRMWDVFGQNGQ
FT                   PLRTTISEMGPMMLSRLLNLNDTQTGILNIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNIAKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGYGAINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQSPLDLPETVLAQLGNRIQHALRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSEIESQQLVQ
FT                   SSPFASKYSQSIDRESAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQAATKKAN
FT                   RRSVGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            414459..415652
FT                   /locus_tag="MGAS10750_Spy0424"
FT   CDS_pept        414459..415652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0424"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37374"
FT                   /db_xref="GOA:Q1J7Y7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y7"
FT                   /protein_id="ABF37374.1"
FT                   /translation="MNWRQNLKVAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYY
FT                   AGLAVAVTALASALFAPVWGKLADRYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILR
FT                   LLTGVFAGYVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQ
FT                   VFLLVGVILFLCSLMTAVYVKEEFKPIRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQ
FT                   ISAQSVAPILSLYIRHLGQTHNLMFTSGLVVSAMGFSSLFSSSYLGKLGDRFGNHRLLL
FT                   AALCYSFIMYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAY
FT                   NQMSSNLGQVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            415649..415795
FT                   /locus_tag="MGAS10750_Spy0425"
FT   CDS_pept        415649..415795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0425"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37375"
FT                   /db_xref="GOA:Q1J7Y6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7Y6"
FT                   /protein_id="ABF37375.1"
FT                   /translation="MRVKINLECSECGSNNYLTSKNKSSHPEKIKVPKYCPKERKVTLH
FT                   VET"
FT   gene            415841..416077
FT                   /gene="secG"
FT                   /locus_tag="MGAS10750_Spy0426"
FT   CDS_pept        415841..416077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="MGAS10750_Spy0426"
FT                   /product="Protein translocase subunit secG"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37376"
FT                   /db_xref="GOA:Q1J7Y5"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y5"
FT                   /protein_id="ABF37376.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            416171..418504
FT                   /locus_tag="MGAS10750_Spy0427"
FT   CDS_pept        416171..418504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0427"
FT                   /product="Exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37377"
FT                   /db_xref="GOA:Q1J7Y4"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y4"
FT                   /protein_id="ABF37377.1"
FT                   /translation="MMKERIMTYLKEHGKSNVNDLAAALEMAGAKHFPSLIKTISKMES
FT                   QSLLRFSDDGSLALRKEREKKKEPTVQGVFRANKAGFGFLHVDENEDDMFIGRNDVGYA
FT                   IDGDTVEVVVKKPADRLKGTAAEAKVVAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQ
FT                   KIQQKIYIKKEPVVLKGTEIIKVDIDKYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLE
FT                   SMDIVSEFPAEVLAEANAISEAPTAKDLIGRVDLRQETTITIDGADAKDLDDAIHIKLL
FT                   DNGNYELGVHIADVSYYVTEGSALDKEAIARGTSVYVTDRVVPMLPERLSNGICSLNPN
FT                   VDRLTQSALMEINSQGHVVNYQICQSVIKTTYRMTYSTVNDMIAGDEEALQEFASIADD
FT                   VTLMVTLHRILEAMRSKRGALNFDTQEAKIIVNDKGMPVDVVLRQRGIAERMIESFMLA
FT                   ANECVAEHFAKAKLPFIYRIHEEPKVEKLQQFIDYASTFGIHIQGTANKISQEALQAFM
FT                   AKVEGQPGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMV
FT                   REYNQPSQEKRDHFAQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGI
FT                   VASVVKFGFFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLV
FT                   KADKETGDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGTKKKEPKEVAKAKTK
FT                   GKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            418507..418974
FT                   /locus_tag="MGAS10750_Spy0428"
FT   CDS_pept        418507..418974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0428"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37378"
FT                   /db_xref="GOA:Q1J7Y3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7Y3"
FT                   /protein_id="ABF37378.1"
FT                   /translation="MAKGEGHILAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLANELKGTGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHDYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            418989..419699
FT                   /locus_tag="MGAS10750_Spy0429"
FT   CDS_pept        418989..419699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0429"
FT                   /product="Glutaminyl-peptide cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37379"
FT                   /db_xref="GOA:Q1J7Y2"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y2"
FT                   /protein_id="ABF37379.1"
FT                   /translation="MITKGQVRLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFSKVG
FT                   VYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKTTCNCLGAYPFEG
FT                   DGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVDGYL
FT                   YANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQRFLI
FT                   TGKLYPLMLEVVLD"
FT   gene            complement(419814..420461)
FT                   /gene="pcp"
FT                   /locus_tag="MGAS10750_Spy0430"
FT   CDS_pept        complement(419814..420461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="MGAS10750_Spy0430"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37380"
FT                   /db_xref="GOA:Q1J7Y1"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7Y1"
FT                   /protein_id="ABF37380.1"
FT                   /translation="MKILITGFDPFGGEAINPALEAIKKLPATIHGAEIKCIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRA
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(420511..421437)
FT                   /locus_tag="MGAS10750_Spy0431"
FT   CDS_pept        complement(420511..421437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0431"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37381"
FT                   /db_xref="GOA:Q1J7Y0"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Y0"
FT                   /protein_id="ABF37381.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPVFNERKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGDVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIISHIALMYLLAYY"
FT   gene            complement(421437..422177)
FT                   /locus_tag="MGAS10750_Spy0432"
FT   CDS_pept        complement(421437..422177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0432"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37382"
FT                   /db_xref="GOA:Q1J7X9"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X9"
FT                   /protein_id="ABF37382.1"
FT                   /translation="MQILATNVIIVILLKKEFFMEWIKLIGIVIIVLGFILKFDAIATV
FT                   VVAGLVTALVSGISFIDFLDILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQ
FT                   RVQALTVGRLLTLYLIIRELAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDAE
FT                   KDDIKAMAAANENFGNFFAQNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIIS
FT                   IIIVAIYNYLFEKKMERQHQKGDN"
FT   gene            complement(422331..423317)
FT                   /locus_tag="MGAS10750_Spy0433"
FT   CDS_pept        complement(422331..423317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0433"
FT                   /product="Bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37383"
FT                   /db_xref="GOA:Q1J7X8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X8"
FT                   /protein_id="ABF37383.1"
FT                   /translation="MKYLSFCVTIALKFHLKEKSMTLLSIIVPCFNEEANILPYFEEMH
FT                   QLETSMSNQLAFEYIFIDDGSKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLK
FT                   EAKGNYITVMDVDLQDPPELLPVMYAKLKEGYDIVGTRRQNRQGEPLIRSMCSNLFYGL
FT                   IKHLSDTEMVNGVRDYRLMTRQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRK
FT                   YGKSRWHFWELLRYSLDGFINFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPV
FT                   SGWASTVSIILFMGGIQLFCMGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(423402..423779)
FT                   /gene="gloA"
FT                   /locus_tag="MGAS10750_Spy0434"
FT   CDS_pept        complement(423402..423779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="MGAS10750_Spy0434"
FT                   /product="Lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37384"
FT                   /db_xref="GOA:Q1J7X7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X7"
FT                   /protein_id="ABF37384.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(423790..424455)
FT                   /locus_tag="MGAS10750_Spy0435"
FT   CDS_pept        complement(423790..424455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0435"
FT                   /product="NAD(P)H-dependent quinone reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37385"
FT                   /db_xref="GOA:Q1J7X6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X6"
FT                   /protein_id="ABF37385.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   VGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(424504..425589)
FT                   /gene="pepQ"
FT                   /locus_tag="MGAS10750_Spy0436"
FT   CDS_pept        complement(424504..425589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="MGAS10750_Spy0436"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37386"
FT                   /db_xref="GOA:Q1J7X5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X5"
FT                   /protein_id="ABF37386.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTPYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTYTPKELLYFEG"
FT   gene            425763..426764
FT                   /gene="ccpA"
FT                   /locus_tag="MGAS10750_Spy0437"
FT   CDS_pept        425763..426764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="MGAS10750_Spy0437"
FT                   /product="Catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37387"
FT                   /db_xref="GOA:Q1J7X4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X4"
FT                   /protein_id="ABF37387.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            426895..427893
FT                   /locus_tag="MGAS10750_Spy0438"
FT   CDS_pept        426895..427893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0438"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37388"
FT                   /db_xref="GOA:Q1J7X3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X3"
FT                   /protein_id="ABF37388.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRETYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADPKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            427895..429229
FT                   /locus_tag="MGAS10750_Spy0439"
FT   CDS_pept        427895..429229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0439"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37389"
FT                   /db_xref="GOA:Q1J7X2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X2"
FT                   /protein_id="ABF37389.1"
FT                   /translation="MRVGLFTDTYFPQVSGVATSIRTLKEELEKEGHEIYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGDGPYLQDLKHLAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   IIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLSLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            429651..431594
FT                   /gene="thrS"
FT                   /locus_tag="MGAS10750_Spy0440"
FT   CDS_pept        429651..431594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="MGAS10750_Spy0440"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37390"
FT                   /db_xref="GOA:Q1J7X1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7X1"
FT                   /protein_id="ABF37390.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESISKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNAEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFRR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEDKSVNVRRYGSKATHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            431735..432448
FT                   /gene="drrA"
FT                   /locus_tag="MGAS10750_Spy0441"
FT   CDS_pept        431735..432448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drrA"
FT                   /locus_tag="MGAS10750_Spy0441"
FT                   /product="Daunorubicin resistance ATP-binding protein drrA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37391"
FT                   /db_xref="GOA:Q1J7X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7X0"
FT                   /protein_id="ABF37391.1"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYAVLKEIYDVPEKDFRKRMDFLNEVLELNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIL"
FT   gene            432423..432728
FT                   /locus_tag="MGAS10750_Spy0442"
FT   CDS_pept        432423..432728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0442"
FT                   /product="Daunorubicin resistance ATP-binding protein drrA"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37392"
FT                   /db_xref="GOA:Q1J7W9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W9"
FT                   /protein_id="ABF37392.1"
FT                   /translation="MIRAKKFFDGTVTQLKQTFGKMKSLSFELEAGQEEVVSQFLGLPD
FT                   ITVERHELTLEIQYDSSRYQTADVIQRTMADFVVRDLKMTDADIEDIIRRFYRKEL"
FT   gene            432730..433548
FT                   /locus_tag="MGAS10750_Spy0443"
FT   CDS_pept        432730..433548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0443"
FT                   /product="Daunorubicin resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37393"
FT                   /db_xref="GOA:Q1J7W8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W8"
FT                   /protein_id="ABF37393.1"
FT                   /translation="MQSFWKRYKPFISAGIQELMTYRVNFFLYRLGDVMGAFVAFYLWK
FT                   AVFDSSKQSLINGFTLSDMTFYIIMSFVTALLTKSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGFRWIVLISVGFPFLVVIFGIKLMAGMSFWQLLATVFLYLLSLLLAFLI
FT                   NFYFNICFGFSAFVFKNLWGSNLLKNALVAFMSGSLIPLAFFPKVVSIVLSFLPFSSLV
FT                   YTPVMIVIGKYSLSQIMVALSLQIFWLLVMVVLSQVIWKKVQYHLTIQGG"
FT   gene            433550..434335
FT                   /locus_tag="MGAS10750_Spy0444"
FT   CDS_pept        433550..434335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0444"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37394"
FT                   /db_xref="GOA:Q1J7W7"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W7"
FT                   /protein_id="ABF37394.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFVIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLGAYESAGS"
FT   gene            complement(434439..435488)
FT                   /locus_tag="MGAS10750_Spy0445"
FT   CDS_pept        complement(434439..435488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0445"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37395"
FT                   /db_xref="GOA:Q1J7W6"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W6"
FT                   /protein_id="ABF37395.1"
FT                   /translation="MSYLSQAAYLNQHSLNEENVMVTILNQTQTLISQYIASVLAAHPH
FT                   LAQLQDLPIIYNRHLDDQLIPILSGGGSGHEPAHSGFVGDGMLSAAIYGDIFTPPTATD
FT                   ILEALRFLDKGKGVFVIIKNFEADIREFSQAIHLARQEGRNIKYIISHDDISVEPKKQF
FT                   QMRHRGLAGTILLHKILGAAAQSGASLDDLEHLAFDLATEIATIGFATKSASLPNAALP
FT                   LFDLPDHQISYGIGIHGEEGYRTVPFMSSEHLAVEIVNKLQIKFHWQEDEHFILLVNNL
FT                   GTATDLEQGIFLNDIHQLLDLEGLHLPFIKNGKFMTSLDMTGISVTLCRLKDRQWLDYL
FT                   QAPTNAYAW"
FT   gene            complement(435443..435979)
FT                   /locus_tag="MGAS10750_Spy0446"
FT   CDS_pept        complement(435443..435979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0446"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37396"
FT                   /db_xref="GOA:Q1J7W5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W5"
FT                   /protein_id="ABF37396.1"
FT                   /translation="MATSLITKKKIAKAFKKQLAVKSFDKISVVDIMDQAQIRRQTFYN
FT                   HFLDKYELLDWIFETELQEQVTHNLNYISGFQLLDELLFYFERNKTFYAQLFDIKGQND
FT                   FYSYFVDYCQVLMAKIISEYQSQEMSQSDAADYLAFLTHYHARALADMIKGYVSQSEPK
FT                   PCLTYLKQLILTSIH"
FT   gene            436131..437120
FT                   /locus_tag="MGAS10750_Spy0447"
FT   CDS_pept        436131..437120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0447"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37397"
FT                   /db_xref="GOA:Q1J7W4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W4"
FT                   /protein_id="ABF37397.1"
FT                   /translation="MKKIMNDATQIVDDMLQGLAYMHDDLVERLDGYDVIVRKAEKTGK
FT                   VALISGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQILEAIKAADEGAGVFMVIK
FT                   NYSGDIMNFEMAQELAEMEGIDVASVVVDDDIAVENSLYTQGRRGVAGTILVHKILGHA
FT                   AREGKSLADIKALADELVLNIKTIGLALSGATVPEVGKPGFVLEDDEFEYGVGIHGEPG
FT                   YKKEKLQSSSVLAQELVTKLADSFDMSAGPHYGVLVNGLGATPLMEQYVFANDVAKLLA
FT                   EKDVTVSFKKIGDYMTSIDMAGLSLTLIKLDKDEWTEALQSDVITPAW"
FT   gene            437062..437706
FT                   /locus_tag="MGAS10750_Spy0448"
FT   CDS_pept        437062..437706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0448"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37398"
FT                   /db_xref="GOA:Q1J7W3"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W3"
FT                   /protein_id="ABF37398.1"
FT                   /translation="MTRMNGQKLFNQMLSHQLGKEEIMQAQDAIKWMTLFNDKIQVNKD
FT                   YLSQLDTPIGDGDHGGNMARGMSAVMENLDGKEFASAADVFKVVAMQLLGKVGGASGPL
FT                   YGSAFMGLSKASEDSSLADALQAGLDMIQKRGKAEKGEKTMVDVWIPVIEALKNDGLTK
FT                   DVVEEAVLATKDIQATKGRASYVGERSVGHIDPGSFSSGLLFEAMLEAEVV"
FT   gene            437706..438080
FT                   /locus_tag="MGAS10750_Spy0449"
FT   CDS_pept        437706..438080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0449"
FT                   /product="Dihydroxyacetone kinase phosphotransfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37399"
FT                   /db_xref="GOA:Q1J7W2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W2"
FT                   /protein_id="ABF37399.1"
FT                   /translation="MSNLGIIIVSHSKNIAQGVVDLISEVATDVAITYVGGTEDGGIGT
FT                   SFDQVQAIVDANPKDDLLAFFDLGSARMNIEMVSDFSDKIITLNVVPIVEGAYTAAALI
FT                   QAGADKDAILSQLEELAINK"
FT   gene            438098..438808
FT                   /locus_tag="MGAS10750_Spy0450"
FT   CDS_pept        438098..438808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0450"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37400"
FT                   /db_xref="GOA:Q1J7W1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W1"
FT                   /protein_id="ABF37400.1"
FT                   /translation="MNFIGELLGTFILVLLGDGVVSACILNKTKAQNSGWIAIVLGWGI
FT                   AVTVAVYISGFMSGAHLNPAVTLAMAAIGSLPWSQVVTYLVAQFLGAMLGALVLYLHYY
FT                   PHWKETKDAGTILACFSTGPAIRHAWSNLLGEALGTAVLVITVMAIGPNKVAAGFGPII
FT                   VGFVVMAVGFSLGATTGYAINPARDLGPRIMHALLPIPNKGDSDWSYAWIPVLGPILGG
FT                   VVGALIYQVILNMM"
FT   gene            438931..439512
FT                   /locus_tag="MGAS10750_Spy0451"
FT   CDS_pept        438931..439512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7W0"
FT                   /protein_id="ABF37401.1"
FT                   /translation="MRVTMRRLLSTMIKCNQDLPKNSLVVDMTLEKAVQLYENQVLTDT
FT                   QRFRKIRLSESGLTLEVRFLKKQPVQWLSESTNSNQLEEKANKFLANDDQTINISQAAL
FT                   AHFLEDTGDQKPIHREVPYVLPGAFLLEQVSDKLAIDYRQLHLRFYAPVVLDSSIQLMM
FT                   KGRAIGLFQAGKLVAKGDYDHDGCLYCCRP"
FT   gene            439475..440569
FT                   /locus_tag="MGAS10750_Spy0452"
FT   CDS_pept        439475..440569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0452"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37402"
FT                   /db_xref="GOA:Q1J7V9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V9"
FT                   /protein_id="ABF37402.1"
FT                   /translation="MTMTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPV
FT                   PIDQVICGNAVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGAAFALGYAKIKAGMA
FT                   SNLLVGGIESSSLQPESVYASADWRQGPYKVAQFSPDTNSPFAMVEGAERVAREHGFTK
FT                   EYLNHWTLKSHQKASYCQEQTLLVDLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHV
FT                   ISAANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGM
FT                   ADMTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALE
FT                   IKNGRYGIAAIAAAGGQGFAVLLK"
FT   gene            440587..441834
FT                   /locus_tag="MGAS10750_Spy0453"
FT   CDS_pept        440587..441834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0453"
FT                   /product="Long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37403"
FT                   /db_xref="GOA:Q1J7V8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V8"
FT                   /protein_id="ABF37403.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTYQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLRGLKEGSCPIILHPNISGTFQQQIKHVDSELLKKADFAVLSS
FT                   GTTGKAKLFWRCLSTWTRLFDYQNKVFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLSLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELAHQAPNVKE
FT                   AHALKIGKGENETLILVLVLTKKDCLAPIKDFLALYLNSGQLPKYYLVIDCLPLKDNGK
FT                   INQEVLLNKIPKQWLS"
FT   gene            441890..442924
FT                   /locus_tag="MGAS10750_Spy0454"
FT   CDS_pept        441890..442924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0454"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37404"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V7"
FT                   /protein_id="ABF37404.1"
FT                   /translation="MCYNMVKKDEEKAMKQAILDRYQALKCYQNAGLSNQAFRAIAKEP
FT                   IIDNRLGSPTFWVIWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSL
FT                   LPDHIFWKELASLVDQAFPGKTLSQAGDLEKRLHQFRYVISSQQAQSIRNHYKMIEMTD
FT                   AQALALFLRSKKGPCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWF
FT                   HTEFILDSTGFFLNEVDAEIVTEKGIVNGASFNYGTDGPRHWDLDVDPISRHDPQFRRD
FT                   TLKGFRTPKRVFRQWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPI
FT                   KGWF"
FT   gene            443086..443796
FT                   /gene="vicR"
FT                   /locus_tag="MGAS10750_Spy0455"
FT   CDS_pept        443086..443796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="MGAS10750_Spy0455"
FT                   /product="Two-component response regulator VicR"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37405"
FT                   /db_xref="GOA:Q1J7V6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V6"
FT                   /protein_id="ABF37405.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            443789..445141
FT                   /gene="vicK"
FT                   /locus_tag="MGAS10750_Spy0456"
FT   CDS_pept        443789..445141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="MGAS10750_Spy0456"
FT                   /product="Two-component sensor histidine kinase VicK"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37406"
FT                   /db_xref="GOA:Q1J7V5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V5"
FT                   /protein_id="ABF37406.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            445145..445954
FT                   /gene="vicX"
FT                   /locus_tag="MGAS10750_Spy0457"
FT   CDS_pept        445145..445954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="MGAS10750_Spy0457"
FT                   /product="Zn-dependent hydrolase"
FT                   /note="beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37407"
FT                   /db_xref="GOA:Q1J7V4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V4"
FT                   /protein_id="ABF37407.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            446397..447089
FT                   /gene="acpA"
FT                   /locus_tag="MGAS10750_Spy0458"
FT   CDS_pept        446397..447089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="MGAS10750_Spy0458"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37408"
FT                   /db_xref="GOA:Q1J7V3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7V3"
FT                   /protein_id="ABF37408.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            447090..450629
FT                   /gene="smc"
FT                   /locus_tag="MGAS10750_Spy0459"
FT   CDS_pept        447090..450629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="MGAS10750_Spy0459"
FT                   /product="Chromosome partition protein smc"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37409"
FT                   /db_xref="GOA:Q1J7V2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V2"
FT                   /protein_id="ABF37409.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAALQQDLASYYAKRQSMEEDYQKFKQKKQVLSQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QRTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQEG
FT                   DKRVQELERDYQLNQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEIALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLATCEGYLGTAESLVRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKTLLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKNVLTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEARLEETAEKIAKESEKNDIFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLADAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAITQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQEMTN"
FT   gene            complement(450882..451754)
FT                   /locus_tag="MGAS10750_Spy0460"
FT   CDS_pept        complement(450882..451754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0460"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37410"
FT                   /db_xref="GOA:Q1J7V1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V1"
FT                   /protein_id="ABF37410.1"
FT                   /translation="MLGKWENMKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFER
FT                   GESEISCIRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIAC
FT                   LLSDTSDYTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGN
FT                   CVRTINYNSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLID
FT                   EIKTLLDNELNFYEQTVFLYATGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYAD
FT                   HFDKLVNKD"
FT   gene            451953..452879
FT                   /gene="aroE2"
FT                   /locus_tag="MGAS10750_Spy0461"
FT   CDS_pept        451953..452879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE2"
FT                   /locus_tag="MGAS10750_Spy0461"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37411"
FT                   /db_xref="GOA:Q1J7V0"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7V0"
FT                   /protein_id="ABF37411.1"
FT                   /translation="MLVLYVSSKLIKRRRMKFMYSALLGNPVEHSISDELFEYLNHNIG
FT                   VLDEYKHKKILVDSVCLEDKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGS
FT                   VNNIYKSGNIITGTNTDWKGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISP
FT                   TVVYREPISENTRSLIKSFPDLKYITYKELADQQILNDIEIIINTTPVGMINYEESLPI
FT                   NFDHLDNVNYKDKYFMDVVFNPLHTKLHEYFGKKGAKIIDGLWVLIFQGIEAFSLWSDK
FT                   INDGKYFFSKDDVVLIHTFLEGKIKGK"
FT   gene            452876..453712
FT                   /locus_tag="MGAS10750_Spy0462"
FT   CDS_pept        452876..453712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0462"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37412"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U9"
FT                   /protein_id="ABF37412.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            453690..454448
FT                   /locus_tag="MGAS10750_Spy0463"
FT   CDS_pept        453690..454448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37413"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U8"
FT                   /protein_id="ABF37413.1"
FT                   /translation="MSILMEAKMNLSIFGLKNIPYLKEGDSIEKLIEESIKTSEFFIED
FT                   NDVLCIASKVVSVAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRL
FT                   DIKKNYIGCRLENGLKLTSGGIDRKSVDEVFLLPNNPDASAKRISEYLKKSLGKNVAVV
FT                   ITDSDGREDKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMG
FT                   QRGTGIPAVLIKGLDYKWFENTSIKEALNE"
FT   gene            454441..455427
FT                   /locus_tag="MGAS10750_Spy0464"
FT   CDS_pept        454441..455427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37414"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U7"
FT                   /protein_id="ABF37414.1"
FT                   /translation="MSRNQDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYSYISIEKPLCNRLEDLEEM
FT                   KSLVGSHPHLAKKMFASEQYFFSKILEKLLQVDCFSLDKIKEITVNFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            455437..456636
FT                   /gene="metK1"
FT                   /locus_tag="MGAS10750_Spy0465"
FT   CDS_pept        455437..456636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK1"
FT                   /locus_tag="MGAS10750_Spy0465"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37415"
FT                   /db_xref="GOA:Q1J7U6"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U6"
FT                   /protein_id="ABF37415.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSPIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            456620..457588
FT                   /locus_tag="MGAS10750_Spy0466"
FT   CDS_pept        456620..457588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0466"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U5"
FT                   /protein_id="ABF37416.1"
FT                   /translation="MFMMDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINIL
FT                   GSVKFINSNQQFIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEYSDTLLIHA
FT                   AAVYNPLSGHSILLLGDKGAGKTTVAMRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTS
FT                   FFKIRRTAVLSDNLLFKLFSKFFNCSLQFNKASWDDKISIFPKELGIRTCNFSTEISKI
FT                   YYIKTDKKEKQIYHSIWSDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEK
FT                   NNRVREQIVKGIFAKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            457643..458632
FT                   /locus_tag="MGAS10750_Spy0467"
FT   CDS_pept        457643..458632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0467"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37417"
FT                   /db_xref="GOA:Q1J7U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U4"
FT                   /protein_id="ABF37417.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKFFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLQEEKQ
FT                   YPHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            459035..459301
FT                   /locus_tag="MGAS10750_Spy0468"
FT   CDS_pept        459035..459301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U3"
FT                   /protein_id="ABF37418.1"
FT                   /translation="MIYYRPGFIFNEFYPNISGWRQELKTKLTSISLISLNFIGVVDEQ
FT                   KKGEYLGSFSDTSEFLSRHPKIYIISFRYKNQFYILSNKKIDL"
FT   gene            459325..460482
FT                   /gene="hasB"
FT                   /locus_tag="MGAS10750_Spy0469"
FT   CDS_pept        459325..460482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasB"
FT                   /locus_tag="MGAS10750_Spy0469"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37419"
FT                   /db_xref="GOA:Q1J7U2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U2"
FT                   /protein_id="ABF37419.1"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSSL
FT                   KEAAINKLLCKAKNINATSSEELAYKDATFIILSLPTNLKVNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNRFHYNDIIFSPEFLREGSTIHDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSPSLLVGSSEAEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKMILNSSAKTIGIYRINSKKDSDNCRESSTIDVAKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            460567..461775
FT                   /gene="mefE"
FT                   /locus_tag="MGAS10750_Spy0470"
FT   CDS_pept        460567..461775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mefE"
FT                   /locus_tag="MGAS10750_Spy0470"
FT                   /product="Macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37420"
FT                   /db_xref="GOA:Q1J7U1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U1"
FT                   /protein_id="ABF37420.1"
FT                   /translation="MNNRKKNIQYLVYSKVIYRIGDVMFDFANNTFLAGLNPASLSLVA
FT                   VYQSLESVIGVLFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVL
FT                   TNVILAFMSAFSSPSYKAFTKEIVKKDSISQLNSLLETTSTVIKVTVPMVAIFLYKLLG
FT                   IHGVLLLDGLSFLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGFKYVYSHKSIFI
FT                   ITVLSALVNFFLAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKEL
FT                   SSMRLILFLSLSGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVD
FT                   NDFLGRVFGIIFTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITILSLVFRILFKKY
FT                   NIR"
FT   gene            complement(461877..462086)
FT                   /locus_tag="MGAS10750_Spy0471"
FT   CDS_pept        complement(461877..462086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0471"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37421"
FT                   /db_xref="GOA:Q1J7U0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7U0"
FT                   /protein_id="ABF37421.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENITTD
FT                   ILLEICIALDCKIEDIVEIVDNNI"
FT   gene            complement(462076..462921)
FT                   /locus_tag="MGAS10750_Spy0472"
FT   CDS_pept        complement(462076..462921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0472"
FT                   /product="Chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37422"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T9"
FT                   /protein_id="ABF37422.1"
FT                   /translation="MDISIEFGLYPTESDLTELQQYFPDTNLKKLYEVEAYHKKLETIL
FT                   DSEFSTERESLIAEIDELESQLTTLNQELQELGNIPNLSSEYLESYSKLTATINALKEQ
FT                   NEAYLKESGLPKEKSGADADLKRSTEDILLDLEVKINSKMREFNNILYPDIRKAPQINL
FT                   NAHNSYSFYTPDDDGTGTKFKGMIVFDLVMLYLTNLPALAHDSLLLSNVSYQATEALLK
FT                   LYDQSRSLNKQVFLAFDKASSYSPDANQLLSENTVLRLSSNGNELYGISWNKGENSDEI
FT                   "
FT   gene            complement(463006..463734)
FT                   /locus_tag="MGAS10750_Spy0473"
FT   CDS_pept        complement(463006..463734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0473"
FT                   /product="Chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T8"
FT                   /protein_id="ABF37423.1"
FT                   /translation="MLIEMWSPVFKKHGEIREPICFHHGLNVIMGMDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSRDTANPDIILVCDKSYSPTG
FT                   ETMDLGIFLNRLKKRYHLDSPELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARKYIFISNLVGGKKQFEANVSEIKRL
FT                   EYDLAHLQDTQQDKIDSDDI"
FT   gene            complement(463725..463949)
FT                   /locus_tag="MGAS10750_Spy0474"
FT   CDS_pept        complement(463725..463949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T7"
FT                   /protein_id="ABF37424.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEVKLCL"
FT   gene            complement(463949..465049)
FT                   /locus_tag="MGAS10750_Spy0476"
FT   CDS_pept        complement(463949..465049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T6"
FT                   /protein_id="ABF37425.1"
FT                   /translation="MELIQLKTQYPSLIIDASFITLAANATVKPQDKTYNTVNLLNRFF
FT                   LIWLDVACRGLSHHHVLSHPFKDWMTNMLDFPYHHEFIEFLGRWTHILITLPKRHHGQV
FT                   DTAIPRYLLVTIREKTGIVKLTTVQNTAFTTQSNQLKKQYGQFLLTESNNCCVCPGCDR
FT                   PLILTSGNLAAENYEVSAIEKDKDAEALNLIVLCPDCFLTYQADSRKKIVTALKNVKKI
FT                   LVSAHNSQQAISDMKLDSGIVSVLTSLNKLKCDEYDISYDSKQLTDKISPENNRTLYQL
FT                   VKNPVIDNYLTIQKIIVNLDKQGKIDYEEIQYQTRSMYKKLKAAKHNNLAIFNTISEKL
FT                   HMATLQDIYFCQMIVSYFIQKCEVLE"
FT   gene            465035..465391
FT                   /locus_tag="MGAS10750_Spy0475"
FT   CDS_pept        465035..465391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0475"
FT                   /product="Plasmid stabilization system antitoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37426"
FT                   /db_xref="GOA:Q1J7T5"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T5"
FT                   /protein_id="ABF37426.1"
FT                   /translation="MNQLQKCDTMSLQIRRITMAKTGTLNLRVDDSVKSAADDILKRLG
FT                   IPMSTAIDMFLNQIILTGGIPFDVSLPEAPQRVNVDYMSQEKFYDKLITSFEDAKTGNR
FT                   QDVREFLFQLKENA"
FT   gene            465391..465696
FT                   /locus_tag="MGAS10750_Spy0477"
FT   CDS_pept        465391..465696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0477"
FT                   /product="Plasmid stabilization system toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37427"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T4"
FT                   /protein_id="ABF37427.1"
FT                   /translation="MKEYQVTMSDDAKADLLSIYHYVRDELCAPQAADNLLERLSQGML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            465715..465846
FT                   /locus_tag="MGAS10750_Spy0478"
FT   CDS_pept        465715..465846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0478"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37428"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T3"
FT                   /protein_id="ABF37428.1"
FT                   /translation="MELVKTIQIGDDIYPPIPDLFGIQENQEFNLYKSTDGTLVMSR"
FT   gene            466149..466490
FT                   /locus_tag="MGAS10750_Spy0479"
FT   CDS_pept        466149..466490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0479"
FT                   /product="Portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37429"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T2"
FT                   /protein_id="ABF37429.1"
FT                   /translation="MDEFKTMHTTAVYACVRILAEAVASFPIHIYERTENGKEKKLDHP
FT                   LYFLLHDEPNPEMSSFIFREAIMSHLLIWGNAYVQIIRDKSGMVSLLLKQKASVLIRKL
FT                   LLIIWQRMP"
FT   gene            466555..466863
FT                   /locus_tag="MGAS10750_Spy0480"
FT   CDS_pept        466555..466863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T1"
FT                   /protein_id="ABF37430.1"
FT                   /translation="MTRLISQQILSEYVKSLEVEADKVVIPGQNTPVFSWDRDGNLSID
FT                   TPLLKVRGESLATQADLTTISLTPGPKGELWQTSVERLDIKVDKHISLTFKNGVRID"
FT   gene            467265..467606
FT                   /locus_tag="MGAS10750_Spy0481"
FT   CDS_pept        467265..467606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0481"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37431"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7T0"
FT                   /protein_id="ABF37431.1"
FT                   /translation="MMKSPFTVTNTMLNKVVEISKIIGNLELQVQKDLKLRKENRIQSI
FT                   HSSLAIEQNSLTVEQITAIIDGKRVLGNPREIREVKNAYEAYEEILTLTPYDESHFLKM
FT                   KEFQQYIYR"
FT   gene            467630..468454
FT                   /locus_tag="MGAS10750_Spy0482"
FT   CDS_pept        467630..468454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37432"
FT                   /db_xref="GOA:Q1J7S9"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S9"
FT                   /protein_id="ABF37432.1"
FT                   /translation="MGLGSDSLPVKISLFDVDTYLADSMQFHLEYILRLFPKSGVHYLM
FT                   PTFRGEAVDHRHLSQFYHSECEIEGDLHDVMNLVDRYIKFLVSEILRECRDSIFAITKD
FT                   VSHLESFIDRKIPIITFEEACTILENEIDSLEYNDEHHFYVLTDVGEKKLMEHFEGVVW
FT                   VKNYPCKSVPFYQRFSTDHLFAYNADLLLGIGETVGCGERCETYEEVVENMNYLQVDAS
FT                   EYSWYLEMKKTRPMKSSGFGLGVERLIAWILKCDDVRKVQLISRENGIDYLP"
FT   gene            468432..469043
FT                   /locus_tag="MGAS10750_Spy0483"
FT   CDS_pept        468432..469043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37433"
FT                   /db_xref="GOA:Q1J7S8"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S8"
FT                   /protein_id="ABF37433.1"
FT                   /translation="MGLIIYHKGGRKMKKNILIVGGGPEITICYDLINNSTEYNFFSVS
FT                   EIPTMYPELFVETIETSFRNFGKTIEQIKELKYSIDAVACWDEALTHIADDISKELGLN
FT                   PILSLDSQSFRFKDRMRMVCEAGGLKMPKYKIINQFSDTNKIINWKYPLIVKPTSFLAS
FT                   IGVKKVYNFSELQQAVSQMLNVKFPVYIASGVYELGNYII"
FT   gene            469147..469365
FT                   /locus_tag="MGAS10750_Spy0484"
FT   CDS_pept        469147..469365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0484"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37434"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S7"
FT                   /protein_id="ABF37434.1"
FT                   /translation="MDEKLFMDEIGHIFPSNLNKEEKSRVYSWAEKLHQILQLNHITTH
FT                   TEFRIGRNGDIILIEIGARIGGDCIQT"
FT   gene            469637..470656
FT                   /gene="mccF"
FT                   /locus_tag="MGAS10750_Spy0485"
FT   CDS_pept        469637..470656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccF"
FT                   /locus_tag="MGAS10750_Spy0485"
FT                   /product="Microcin C7 self-immunity protein mccF"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37435"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S6"
FT                   /protein_id="ABF37435.1"
FT                   /translation="MFGKQGIRCARKGDERNIKIIVNRVNSERNIKSIGICSPSYPGTF
FT                   HYQKRYKRGVEFLQNKGFTIVEGNLTGKEGYRGEISGGVQDRAEELNQLIPRVDVIMTS
FT                   IGGYNSNSILKYIDYDLFKQKSPIFIGYSDTTALALALYNKTGCITYLSQSVISNFGEF
FT                   EPFNELNYFYFDFMLQSKCETLMVQIPDVWTDEWINWETYEKTKKTNKNEWIIFNKGEF
FT                   NGTLIGGNLDTIVGIIGTEYMPKITEDTILLLEDVYTDLGRLYRNFTTLALHGIFDKIG
FT                   GLIISKFETIGENSDVINDIINEFVGHRKIPILLNFDCGHTHPSCLMPIGGKITLSLS"
FT   gene            470669..470869
FT                   /locus_tag="MGAS10750_Spy0486"
FT   CDS_pept        470669..470869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S5"
FT                   /protein_id="ABF37436.1"
FT                   /translation="MNNRESKLTGFYDVFEEEVEKINHIHNVFVEESEKFGFQQMKIAM
FT                   VEHRKKYLDATDVHYTKYKNI"
FT   gene            470989..471474
FT                   /locus_tag="MGAS10750_Spy0487"
FT   CDS_pept        470989..471474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S4"
FT                   /protein_id="ABF37437.1"
FT                   /translation="MLFRDRIPTYKGYRRQFNQILLGAWGIESAYVDAEIIVATWRGLQ
FT                   RFKGIKVEFIQLSNKNIFDVLEKDLSKKLRFEDISIEAILGKYLCNNDIEIIKCLYEKD
FT                   KINMELLISLISKISNKLVKQEFIKVLVLYEYVKTFYQQIAFTFHYLIYMEQDIIQV"
FT   gene            471471..471887
FT                   /locus_tag="MGAS10750_Spy0488"
FT   CDS_pept        471471..471887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S3"
FT                   /protein_id="ABF37438.1"
FT                   /translation="MNYKIFIRTKSGDIFDIADGGRIDDMVSKFNKVNVLGVCMGIGTT
FT                   VLSQEIEYEIEDRIMILVEKIDVKIYKNCLELANKLSGYHCSIFEFPYKKIKKFFKHEL
FT                   YSRHHYIIVRLDGSMEYRFSSVALKNKIKSILDS"
FT   gene            complement(472261..472830)
FT                   /locus_tag="MGAS10750_Spy0489"
FT   CDS_pept        complement(472261..472830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0489"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37439"
FT                   /db_xref="GOA:Q1J7S2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S2"
FT                   /protein_id="ABF37439.1"
FT                   /translation="MATVKPKTALKRTQKTYPQNLLNQKFNPDKPNQVWSTDFTYISIG
FT                   YKKYVYLCAILDLYSRKCIAWKLSHHMDAKLACDTLELALNKRKIEGTLLFHSDQGSQF
FT                   KARELRKIIDDNTIMHSFSKPGYPYDNAVTEAFFKYLKHRQINRKKYQNIKQVQLDCFE
FT                   YIENFYNNYNPHTANLGLTPNQKEEN"
FT   gene            complement(473111..473431)
FT                   /locus_tag="MGAS10750_Spy0490"
FT   CDS_pept        complement(473111..473431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0490"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37440"
FT                   /db_xref="GOA:Q1J7S1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S1"
FT                   /protein_id="ABF37440.1"
FT                   /translation="MLQSVLKDTKTKGQPMSTVKRYDEEFKQSLVNLYQTGKTQSELCK
FT                   DYGVSASALAKWIKQYSQVKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASAIFMQN
FT                   LK"
FT   gene            complement(473514..473687)
FT                   /locus_tag="MGAS10750_Spy0491"
FT   CDS_pept        complement(473514..473687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7S0"
FT                   /protein_id="ABF37441.1"
FT                   /translation="MSPFFTLGGCKRHLGCALFNDLNKPHHFCILFNFSYYIIKSSFHS
FT                   IRKKQPDYISIT"
FT   gene            473691..474488
FT                   /locus_tag="MGAS10750_Spy0492"
FT   CDS_pept        473691..474488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0492"
FT                   /product="Hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37442"
FT                   /db_xref="GOA:Q1J7R9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R9"
FT                   /protein_id="ABF37442.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYRGEILFADMMTKEQYTEVAKKILANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            474492..475316
FT                   /locus_tag="MGAS10750_Spy0493"
FT   CDS_pept        474492..475316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0493"
FT                   /product="Hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37443"
FT                   /db_xref="GOA:Q1J7R8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R8"
FT                   /protein_id="ABF37443.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAVREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQVCQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVAELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            475316..476866
FT                   /gene="ftsY"
FT                   /locus_tag="MGAS10750_Spy0494"
FT   CDS_pept        475316..476866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="MGAS10750_Spy0494"
FT                   /product="Cell division protein ftsY"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37444"
FT                   /db_xref="GOA:Q1J7R7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R7"
FT                   /protein_id="ABF37444.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQDKI
FT                   EAVQQEDVSSEGAGSVENGPEAASVNAPVEEETGDNSNHPSEDTNKFAADKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSANEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATYDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKGVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(476920..478287)
FT                   /locus_tag="MGAS10750_Spy0495"
FT   CDS_pept        complement(476920..478287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0495"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37445"
FT                   /db_xref="GOA:Q1J7R6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R6"
FT                   /protein_id="ABF37445.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFSWQWIFICILPVPLIAGILAYYYLEDSPVTEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENGSVNLYYLELFILSFVLFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTSLGALLAPAFGKLYDQKGARLSLYLGNSLFSL
FT                   SLIIMTLQTRHFMLLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTAMASLIANSQPEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            478615..479457
FT                   /gene="licT"
FT                   /locus_tag="MGAS10750_Spy0496"
FT   CDS_pept        478615..479457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="MGAS10750_Spy0496"
FT                   /product="Transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37446"
FT                   /db_xref="GOA:Q1J7R5"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R5"
FT                   /protein_id="ABF37446.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNSFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLWVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSEMSYD
FT                   DDDAELLLVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            479459..481321
FT                   /locus_tag="MGAS10750_Spy0497"
FT   CDS_pept        479459..481321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0497"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37447"
FT                   /db_xref="GOA:Q1J7R4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R4"
FT                   /protein_id="ABF37447.1"
FT                   /translation="MTYQETAKAILAAVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KAISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLTMLGLASADSQTVAFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPILAATIAGILLHPAFVAMVAEGKPLALFGAPVTPASYGSSVIPILMMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSNTMLAIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFTNALIAGAATIVLAFSLTWFMGIDEESPEQVSVA
FT                   VDMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGVVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDT
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   gene            481340..482764
FT                   /gene="bglA"
FT                   /locus_tag="MGAS10750_Spy0498"
FT   CDS_pept        481340..482764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="MGAS10750_Spy0498"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37448"
FT                   /db_xref="GOA:Q1J7R3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R3"
FT                   /protein_id="ABF37448.1"
FT                   /translation="MGIFSKDFLWGGAVAANQVEGAFEADEKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(482863..483702)
FT                   /locus_tag="MGAS10750_Spy0499"
FT   CDS_pept        complement(482863..483702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0499"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37449"
FT                   /db_xref="GOA:Q1J7R2"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R2"
FT                   /protein_id="ABF37449.1"
FT                   /translation="MFTCGGALMIRFLILSGYFELTMYLQLSGKLDQYINVRYSYLAYI
FT                   SMVLSFILALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTV
FT                   SAKGYTFPLAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVT
FT                   ITTENYMEVMELIYLYPDEFLDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYG
FT                   LLTTGNQTSYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(483678..484580)
FT                   /locus_tag="MGAS10750_Spy0500"
FT   CDS_pept        complement(483678..484580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0500"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37450"
FT                   /db_xref="GOA:Q1J7R1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R1"
FT                   /protein_id="ABF37450.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            484714..484911
FT                   /locus_tag="MGAS10750_Spy0501"
FT   CDS_pept        484714..484911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0501"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37451"
FT                   /db_xref="GOA:Q1J7R0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7R0"
FT                   /protein_id="ABF37451.1"
FT                   /translation="MRQTSYGLLGFVCSVVFSLVASLPSVLTSKGLSKLGIDAKPASIF
FT                   SSSSFFLWVIAISMTFFHSR"
FT   gene            485096..487249
FT                   /locus_tag="MGAS10750_Spy0502"
FT   CDS_pept        485096..487249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0502"
FT                   /product="transcription accessory protein"
FT                   /note="S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37452"
FT                   /db_xref="GOA:Q1J7Q9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q9"
FT                   /protein_id="ABF37452.1"
FT                   /translation="MCYNSNIMENNNNHNIAEALSVSLHQIEQVLALTAQGNTIPFIAR
FT                   YRKEVTGNLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLA
FT                   DLEELYLPYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPQEALA
FT                   GAVDILVEAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQ
FT                   GYRTLALNRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAME
FT                   RRVRSELSDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKL
FT                   LTTQVIYPVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFP
FT                   NTSYVIVNESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGV
FT                   GQYQHDVSQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREE
FT                   NGALTSRADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLGI
FT                   QDLDDAAKATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILD
FT                   LKDLEIGQKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTV
FT                   WVSKIDLDRHKVNLSLLPPRDTH"
FT   gene            487236..487673
FT                   /locus_tag="MGAS10750_Spy0503"
FT   CDS_pept        487236..487673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0503"
FT                   /product="Metallopeptidase, SprT family"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37453"
FT                   /db_xref="GOA:Q1J7Q8"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7Q8"
FT                   /protein_id="ABF37453.1"
FT                   /translation="MTLTNYVQEVSLADFGKPFHHKAYWNKRLKTTGGRFFPKDGHLDF
FT                   NPRMLEEHGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTSSKS
FT                   KTNHHYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS"
FT   gene            487737..488009
FT                   /locus_tag="MGAS10750_Spy0504"
FT   CDS_pept        487737..488009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0504"
FT                   /product="Stress-responsive transcriptional regulator PspC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37454"
FT                   /db_xref="GOA:Q1J7Q7"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q7"
FT                   /protein_id="ABF37454.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            488281..489306
FT                   /gene="ptsK"
FT                   /locus_tag="MGAS10750_Spy0505"
FT   CDS_pept        488281..489306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="MGAS10750_Spy0505"
FT                   /product="HPR(SER) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="3.1.3.-"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37455"
FT                   /db_xref="GOA:Q1J7Q6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q6"
FT                   /protein_id="ABF37455.1"
FT                   /translation="MVSLLSFSSEKMSICKGLTVDLCYNIEKGEIMTVTVKMLVQKVKL
FT                   DVVYATDNLLSKEITTSDISRPGLEMTGYFDYYAPERLQLFGMKEWSYLTQMTSHNRYS
FT                   VLKEMFKKDTPAVVVSRNLAIPKEMVQAAKEEGISLLSSRVSTSRLAGEMSYFLDASLA
FT                   ERTSVHGVLMDIYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWG
FT                   EPAEILRHLLEIRGVGIIDVMSLYGASAVKDSSQVQLAIYLENFEAGKVFDRLGNGNEE
FT                   ITFSGVRIPRIRIPVKTGRNVSVVIEAAAMNHRAKEMGFDATKTFEDRLTQLITKNEVS
FT                   Q"
FT   gene            489303..490082
FT                   /gene="lgt"
FT                   /locus_tag="MGAS10750_Spy0506"
FT   CDS_pept        489303..490082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MGAS10750_Spy0506"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37456"
FT                   /db_xref="GOA:Q1J7Q5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7Q5"
FT                   /protein_id="ABF37456.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESFWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            490104..490511
FT                   /locus_tag="MGAS10750_Spy0507"
FT   CDS_pept        490104..490511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37457"
FT                   /db_xref="GOA:Q1J7Q4"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q4"
FT                   /protein_id="ABF37457.1"
FT                   /translation="MDLVGISLMIIALAFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANILVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            490483..490932
FT                   /locus_tag="MGAS10750_Spy0508"
FT   CDS_pept        490483..490932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0508"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37458"
FT                   /db_xref="GOA:Q1J7Q3"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q3"
FT                   /protein_id="ABF37458.1"
FT                   /translation="MEKKEKSMNKSFKNLVIGAASGVAAAYFLSTEKGKALKNRAEKAY
FT                   QAYKESPDDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQ
FT                   KTKETFAEVEAKEKQDDVIIDLNEEDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(491093..491377)
FT                   /locus_tag="MGAS10750_Spy0509"
FT   CDS_pept        complement(491093..491377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37459"
FT                   /db_xref="GOA:Q1J7Q2"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q2"
FT                   /protein_id="ABF37459.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLLAKVIKSLLM"
FT   gene            491576..492502
FT                   /locus_tag="MGAS10750_Spy0510"
FT   CDS_pept        491576..492502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0510"
FT                   /product="Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37460"
FT                   /db_xref="GOA:Q1J7Q1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q1"
FT                   /protein_id="ABF37460.1"
FT                   /translation="MEKIIITATAESIEQVKALLVAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCPGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            492604..493890
FT                   /locus_tag="MGAS10750_Spy0511"
FT   CDS_pept        492604..493890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0511"
FT                   /product="Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37461"
FT                   /db_xref="GOA:Q1J7Q0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7Q0"
FT                   /protein_id="ABF37461.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERRSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESLE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRA"
FT   gene            494095..494307
FT                   /locus_tag="MGAS10750_Spy0512"
FT   CDS_pept        494095..494307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0512"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37462"
FT                   /db_xref="GOA:Q1J7P9"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P9"
FT                   /protein_id="ABF37462.1"
FT                   /translation="MAEFTFKIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(494404..494544)
FT                   /locus_tag="MGAS10750_Spy0513"
FT   CDS_pept        complement(494404..494544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37463"
FT                   /db_xref="GOA:Q1J7P8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P8"
FT                   /protein_id="ABF37463.1"
FT                   /translation="MTKEYISYISAAIFLLYGLLAAKWIFLGLGLILVLVGLADRLNSK
FT                   K"
FT   gene            complement(494680..496185)
FT                   /gene="lysS"
FT                   /locus_tag="MGAS10750_Spy0514"
FT   CDS_pept        complement(494680..496185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="MGAS10750_Spy0514"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37464"
FT                   /db_xref="GOA:Q1J7P7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P7"
FT                   /protein_id="ABF37464.1"
FT                   /translation="MEENMSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFDRTANS
FT                   AELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVG
FT                   EDNYEIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIET
FT                   IYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFV
FT                   THHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQA
FT                   YADYLDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFW
FT                   PEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLA
FT                   KKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYD
FT                   FVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            496347..497249
FT                   /locus_tag="MGAS10750_Spy0515"
FT   CDS_pept        496347..497249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0515"
FT                   /product="Haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37465"
FT                   /db_xref="GOA:Q1J7P6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P6"
FT                   /protein_id="ABF37465.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRGRQLKPGTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDVNDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   gene            complement(497357..497980)
FT                   /locus_tag="MGAS10750_Spy0516"
FT   CDS_pept        complement(497357..497980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0516"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37466"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P5"
FT                   /protein_id="ABF37466.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VAFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKIATMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNASLTILETKDYLTYDCLIWNDKSFLEV"
FT   gene            complement(498056..498535)
FT                   /locus_tag="MGAS10750_Spy0517"
FT   CDS_pept        complement(498056..498535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0517"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37467"
FT                   /db_xref="GOA:Q1J7P4"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P4"
FT                   /protein_id="ABF37467.1"
FT                   /translation="MTKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(498628..499236)
FT                   /locus_tag="MGAS10750_Spy0518"
FT   CDS_pept        complement(498628..499236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0518"
FT                   /product="Thiamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37468"
FT                   /db_xref="GOA:Q1J7P3"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P3"
FT                   /protein_id="ABF37468.1"
FT                   /translation="MIGKRYSFCAQKEFFMLPNTNVKYLIEAAIFAALAMTLSFIPDFA
FT                   GWFSPSYGAIALVIFSLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTS
FT                   MGLAGSFSDSLIKTLRRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMS
FT                   AVWYSFSVNGTAGVLTFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(499459..500307)
FT                   /locus_tag="MGAS10750_Spy0519"
FT   CDS_pept        complement(499459..500307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0519"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37469"
FT                   /db_xref="GOA:Q1J7P2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P2"
FT                   /protein_id="ABF37469.1"
FT                   /translation="MRRRIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPSKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARTFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDAVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            500632..501135
FT                   /locus_tag="MGAS10750_Spy0520"
FT   CDS_pept        500632..501135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0520"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37470"
FT                   /db_xref="GOA:Q1J7P1"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P1"
FT                   /protein_id="ABF37470.1"
FT                   /translation="MSAKLMSRIAIMSALCVVLRMAFSSLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFALVLLLWRFVLYPLSQQFPKYQLGCQAF
FT                   LAALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVVMMLFRRLIG
FT                   EQKI"
FT   gene            501119..501502
FT                   /locus_tag="MGAS10750_Spy0521"
FT   CDS_pept        501119..501502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0521"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37471"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7P0"
FT                   /protein_id="ABF37471.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQTQTPSVPKADHHVRLVVKE
FT                   DTNTIDEKVSFGKGDTVLEILKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVFK"
FT   gene            complement(501548..502072)
FT                   /locus_tag="MGAS10750_Spy0522"
FT   CDS_pept        complement(501548..502072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0522"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37472"
FT                   /db_xref="GOA:Q1J7N9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N9"
FT                   /protein_id="ABF37472.1"
FT                   /translation="MIPLTKLSITPRRCHMPNLYDFTVKAQNGNDLSLAAYKEKVVLIV
FT                   NTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTT
FT                   FPRFVKIKVNGKDADPLFAWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPK
FT                   LIEEDLKALLG"
FT   gene            complement(502020..503894)
FT                   /gene="pepF"
FT                   /locus_tag="MGAS10750_Spy0523"
FT   CDS_pept        complement(502020..503894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="MGAS10750_Spy0523"
FT                   /product="Oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37473"
FT                   /db_xref="GOA:Q1J7N8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N8"
FT                   /protein_id="ABF37473.1"
FT                   /translation="MDRFSLHIPLKFCYTSLDYIVKETTMELKKRSEFPENELWDLTAL
FT                   YKDRQDFLLAIEKALQDIDLFKRNYEGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMP
FT                   QTTDFSDESFAQIAQAGDDFMTKASVALSFFDTALANADLDVLDTLEKNPYFSAAIRMA
FT                   KIQKEHLLSPDVEKALANLREVINAPYDIYTKMRAGDFDMEDFEVDGKTYKNSFVSYEN
FT                   FYQNHENAEIREKAFRSFSKGLRKHQNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAE
FT                   QEVDRSLFDRQIDLIMTEFGPVAQKFLKHVAQVNGLEKMTFADWKLDIDNDLNPEVSID
FT                   GAYDLVMKSLAPLGQEYTKEIERYQTERWVDFAANANKDSGGYAADPYKVHPYVLMSWT
FT                   GRMSDVYTLIHEIGHSGQFIFSDNHQSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDD
FT                   PRQKRFALAHRLTDTYFHNFITHLLEAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDF
FT                   WGDAVDIDDDAALTWMRQAHYYMGLYSYTYSAGLVMSTAGYLNLKNNPDGAKEWLDFLK
FT                   SGGSRTPLDTAMLIGADIATEKPLRDTIQFLSDTVDQIINYTEEMSHA"
FT   gene            503963..506776
FT                   /gene="ppc"
FT                   /locus_tag="MGAS10750_Spy0524"
FT   CDS_pept        503963..506776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="MGAS10750_Spy0524"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37474"
FT                   /db_xref="GOA:Q1J7N7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N7"
FT                   /protein_id="ABF37474.1"
FT                   /translation="MVKSGMIEETSKEGDGHLPLKKLESSNNQTIIAEEVALLKEMLEN
FT                   ITRRMIGDDAFTVIESIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISE
FT                   DVDLAYEINHQNNTDTDYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKT
FT                   ILELTTHIHKLLRKYRDAKTGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNV
FT                   MQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCL
FT                   SATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRA
FT                   FHYIQSRLKQTQIQLTNQPAARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKA
FT                   IEQSLLDNGNFALIEGDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVD
FT                   DYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIK
FT                   QHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHD
FT                   IVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGR
FT                   GGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASIN
FT                   RMVTQMITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNI
FT                   GSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHM
FT                   YQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEILDEWQLTKNVILAI
FT                   QDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIA
FT                   TGLRNSG"
FT   gene            506916..508220
FT                   /gene="ftsW"
FT                   /locus_tag="MGAS10750_Spy0525"
FT   CDS_pept        506916..508220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="MGAS10750_Spy0525"
FT                   /product="Cell division protein ftsW"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37475"
FT                   /db_xref="GOA:Q1J7N6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N6"
FT                   /protein_id="ABF37475.1"
FT                   /translation="MIISRSRGKTMKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVS
FT                   LIQAHANPFKSVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARF
FT                   FTTAIKGAHGWIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWP
FT                   TQWNDLRDWRVYSLLMVLLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVMITG
FT                   LSTVFLGTIAVIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGW
FT                   FGQGLGNSIEKRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKN
FT                   PFNAMMALGVGGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNI
FT                   DASEKRDDIFKEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            complement(508237..508377)
FT                   /locus_tag="MGAS10750_Spy0526"
FT   CDS_pept        complement(508237..508377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0526"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N5"
FT                   /protein_id="ABF37476.1"
FT                   /translation="MEFHALFLPQQKAAVWAHVTRKNKKSAEQFKFFEHQTGIVYILKS
FT                   P"
FT   gene            508524..509771
FT                   /locus_tag="MGAS10750_Spy0527"
FT   CDS_pept        508524..509771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0527"
FT                   /product="translation elongation factor Tu (EF-TU)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37477"
FT                   /db_xref="GOA:Q1J7N4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7N4"
FT                   /protein_id="ABF37477.1"
FT                   /translation="MAYRLSIKYILLEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTL
FT                   TAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPG
FT                   HADYVKNMITGAAQMDGAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDD
FT                   EELLELVEMEIRDLLSEYDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPE
FT                   PERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVE
FT                   MFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGR
FT                   HTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIR
FT                   EGGRTVGSGIVSEIEA"
FT   gene            510012..510770
FT                   /gene="tpi"
FT                   /locus_tag="MGAS10750_Spy0528"
FT   CDS_pept        510012..510770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="MGAS10750_Spy0528"
FT                   /product="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37478"
FT                   /db_xref="GOA:Q1J7N3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7N3"
FT                   /protein_id="ABF37478.1"
FT                   /translation="MLRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   gene            complement(510869..512104)
FT                   /locus_tag="MGAS10750_Spy0529"
FT   CDS_pept        complement(510869..512104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0529"
FT                   /product="Factor essential for expression of methicillin
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37479"
FT                   /db_xref="GOA:Q1J7N2"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N2"
FT                   /protein_id="ABF37479.1"
FT                   /translation="MALIEISQEQFDHYCHSLVHHSFIQTSEMASLMAKRGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISHPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   HLTHSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFMVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTEQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGKFDGSDGVLRFKQNFNGFILQKPGTFKCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(512091..513332)
FT                   /gene="murM"
FT                   /locus_tag="MGAS10750_Spy0530"
FT   CDS_pept        complement(512091..513332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="MGAS10750_Spy0530"
FT                   /product="UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-alanyltransferase /
FT                   UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-seryltransferase"
FT                   /EC_number="2.3.2.10"
FT                   /EC_number="2.3.2.-"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37480"
FT                   /db_xref="GOA:Q1J7N1"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N1"
FT                   /protein_id="ABF37480.1"
FT                   /translation="MGIKLMYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKDNWKH
FT                   ERISFYENGVQVAAAACLIRKLPLGFTMIYIPRGPIMDYANFELLDFVIKTLKTFGKSK
FT                   RALFVKIDPSLVIKQTLEGKESKENDVALSIIAFLKKLGVEWSGRTKELEDTIQPRIQA
FT                   NIYAKDFDFDSLPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGK
FT                   SYYQKLLDIYAGQSYITMASLDLPEQKKTLIQQLDKALAEQVRLTDKSKPSKVAENQKT
FT                   IARLQKDLTILSEQLAAGKTRIPLAATLTLIYGETSENLYAGMDDDYRNYQAPLLTWYE
FT                   TAKEAFKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFAGEFNIPVGLVSSLAILTY
FT                   NLRKKLRSTTNGTN"
FT   gene            complement(513317..514126)
FT                   /locus_tag="MGAS10750_Spy0531"
FT   CDS_pept        complement(513317..514126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0531"
FT                   /product="Hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37481"
FT                   /db_xref="GOA:Q1J7N0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7N0"
FT                   /protein_id="ABF37481.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFMSRKLG
FT                   VHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            complement(514276..514509)
FT                   /locus_tag="MGAS10750_Spy0532"
FT   CDS_pept        complement(514276..514509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0532"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37482"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M9"
FT                   /protein_id="ABF37482.1"
FT                   /translation="MEFYALFLSLGSQKSRVTSLPVLTPLLPQQKAAVLAHVTRRNEKL
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(514581..515882)
FT                   /locus_tag="MGAS10750_Spy0533"
FT   CDS_pept        complement(514581..515882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0533"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37483"
FT                   /db_xref="GOA:Q1J7M8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M8"
FT                   /protein_id="ABF37483.1"
FT                   /translation="MNEKVFRDPVHNYIHIDNPLIYDLINTKEFQRLRRIKQVPTTAFT
FT                   FHGAEHSRFSHCLGVYEIARRVTAIFEEKYADIWNKDESLVTMTAALLHDIGHGAYSHT
FT                   FEALFHTDHEAFTQEIITNPETEINAILVRHAPDFPDKVASVINHTYPNKQVVQLISSQ
FT                   IDCDRMDYLLRDSYFSAANYGQFDLMRILRVIRPVEDGIVFEHSGMHAVEDYIVSRFQM
FT                   YMQVYFHPASRAVELILQNLLKRAQHLYPEQQAYFQKTAPGLIPFFEKKANLADYIALD
FT                   DGVMNTYFQVWMTSEDHILSDLASRFINRKILKSVTFDQDSRGELERLRQLVESVGFDP
FT                   DYYTGIHINFDLPYDIYRPELENPRTQIEMMQKDGSLAELSQLSPIVKALTGTTYGDRR
FT                   FYFPKEMLELDDLFAPSKETFMSYISNGHFHFSQ"
FT   gene            515973..516359
FT                   /locus_tag="MGAS10750_Spy0534"
FT   CDS_pept        515973..516359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0534"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37484"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M7"
FT                   /protein_id="ABF37484.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGDYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            516590..519271
FT                   /gene="pacL"
FT                   /locus_tag="MGAS10750_Spy0535"
FT   CDS_pept        516590..519271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="MGAS10750_Spy0535"
FT                   /product="Calcium-transporting ATPase"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37485"
FT                   /db_xref="GOA:Q1J7M6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M6"
FT                   /protein_id="ABF37485.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSEDAGIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGTLQSSSADIAFDNTTLRVMNFANDTKVDPSGKLIGDPTETALVQ
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRPITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(519355..520359)
FT                   /gene="regR"
FT                   /locus_tag="MGAS10750_Spy0536"
FT   CDS_pept        complement(519355..520359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="MGAS10750_Spy0536"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37486"
FT                   /db_xref="GOA:Q1J7M5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M5"
FT                   /protein_id="ABF37486.1"
FT                   /translation="MYAMQRKVTIKDIAELAKTSKTTVSFYLNGRFDKMSEETKNRIKS
FT                   TIEATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNS
FT                   NYDPSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWV
FT                   KTNNYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMII
FT                   DENQTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEW
FT                   TKFSSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(520414..522339)
FT                   /locus_tag="MGAS10750_Spy0537"
FT   CDS_pept        complement(520414..522339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0537"
FT                   /product="Oligohyaluronate lyase"
FT                   /EC_number="4.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37487"
FT                   /db_xref="GOA:Q1J7M4"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M4"
FT                   /protein_id="ABF37487.1"
FT                   /translation="MERKCPMSLAFTRFKETVNPDFCRNYLLDYQTDSYADQKRIADLL
FT                   LTNTFLFEDNWDMEPCHIPYHLDPITWQEAVTDDPEWNFMLNRQTYLQKLILVYLVERD
FT                   ERYLLKAKSFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFNALTKQEES
FT                   LILASLEKQLQFLHANYLDKYSLSNWGILQTTAILLADAYYGSDLDIAAATAFARKELT
FT                   QQIALQILEDGSQFEQSTMYHVEVLKALLELTALVPDYLPQLRPTLLAMSDYLLKMTGP
FT                   DHKQIPLGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLP
FT                   VQTLPTFAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSLCLYYKGQPLFCDAG
FT                   RYTYKEEPLRYALKSASHHSTAFLKEQLPEQIDSSWAYLSYPKSNYCHLRQNGHVYFIE
FT                   GSYQTQFSDRNNYQHDRQILILPPGMFLIIDTIQAQGNHCLVSQFILDNHLDVKTDHLS
FT                   DLRLISDCPFTIEETILSKKYNQYLTSHKFIKRKPFKDKGCTSTLLVPDDTKVTPLTPL
FT                   QTGKRNPIETALSWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNE
FT                   IIRLKH"
FT   gene            complement(522408..523289)
FT                   /gene="agaD"
FT                   /locus_tag="MGAS10750_Spy0538"
FT   CDS_pept        complement(522408..523289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaD"
FT                   /locus_tag="MGAS10750_Spy0538"
FT                   /product="PTS system, N-acetylgalactosamine-specific IID
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37488"
FT                   /db_xref="GOA:Q1J7M3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M3"
FT                   /protein_id="ABF37488.1"
FT                   /translation="MNFTTNLNKSMQQLSKEANKMTGSNKLTKKDYLKTALRAFFLQNG
FT                   FNYSNYQGIGYANVIYPALKKHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVML
FT                   ENDRPEEETRNIKMALMGPLAGIGDSLSQFCLAPLFSTIAASLASDGLVLGPIFFFLAM
FT                   NIILTAIKIGSGLYGYKVGTSFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPI
FT                   TFAAGKVDAANTAQKFVTIQGMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVLLTVL
FT                   IGIIGSWLGILA"
FT   gene            complement(523216..523998)
FT                   /locus_tag="MGAS10750_Spy0539"
FT   CDS_pept        complement(523216..523998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0539"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37489"
FT                   /db_xref="GOA:Q1J7M2"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M2"
FT                   /protein_id="ABF37489.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGMILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFIGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(524017..524505)
FT                   /gene="agaV"
FT                   /locus_tag="MGAS10750_Spy0540"
FT   CDS_pept        complement(524017..524505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaV"
FT                   /locus_tag="MGAS10750_Spy0540"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37490"
FT                   /db_xref="GOA:Q1J7M1"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M1"
FT                   /protein_id="ABF37490.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKYLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDAKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHQVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(524541..525740)
FT                   /locus_tag="MGAS10750_Spy0541"
FT   CDS_pept        complement(524541..525740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0541"
FT                   /product="Unsaturated glucuronyl hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37491"
FT                   /db_xref="GOA:Q1J7M0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7M0"
FT                   /protein_id="ABF37491.1"
FT                   /translation="MTRLLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTPEAREAALKAADKLVQRYQDKGGFIQAWG
FT                   ELGKKQDYRLIIDCLLNIQLLFFASQETGDNRYPDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFGDGSEQSRDSSATAIAVCGIHEMLKTLPDHDPDKKTYEAAMHSM
FT                   LRALIKDYANKDLNPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            525807..526331
FT                   /locus_tag="MGAS10750_Spy0542"
FT   CDS_pept        525807..526331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L9"
FT                   /protein_id="ABF37492.1"
FT                   /translation="MPSLEHIISPDTKSSKEAAVCLAKLASISMAKLRPERTLHVVFGR
FT                   DSIKVAATLKGVPPRRSQRTKVSSSGIKARDNWSCTSAAVISAVKSIAVTFSCLPAINS
FT                   KAETIPLAKCPCPITIIAIINKSPLVYRFTQKYCSAFKILCQYFFKKIFEKEKVNGCAK
FT                   KESKMVFFVTI"
FT   gene            526511..527305
FT                   /gene="idnO"
FT                   /locus_tag="MGAS10750_Spy0543"
FT   CDS_pept        526511..527305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="MGAS10750_Spy0543"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37493"
FT                   /db_xref="GOA:Q1J7L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L8"
FT                   /protein_id="ABF37493.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLAAYRELGIEAHGYVCDVTDEVGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKAVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGTTEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            527330..527971
FT                   /locus_tag="MGAS10750_Spy0544"
FT   CDS_pept        527330..527971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0544"
FT                   /product="Galactose-6-phosphate isomerase LacB subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37494"
FT                   /db_xref="GOA:Q1J7L7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L7"
FT                   /protein_id="ABF37494.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFKEYFFANAEPSELVTYLKSVLEQ"
FT   gene            527961..529001
FT                   /locus_tag="MGAS10750_Spy0545"
FT   CDS_pept        527961..529001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0545"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37495"
FT                   /db_xref="GOA:Q1J7L6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L6"
FT                   /protein_id="ABF37495.1"
FT                   /translation="MNSNSILTRKGDHMSKLLLVGEPLIRVSPNQFQPLTNACDAQLFF
FT                   GGSEVNIARTLGGFGLEARLFTALPDNPVGHAFHQFLKQSGVDMTLTAWQGNRVGLYYL
FT                   ENGFGCRSSQVYYDRCGSSFSALDKDSLDLAAIFEGISHFHFSGISLALGKKTQDLIEI
FT                   LVREAKKRDICVSFDLNFRSSMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFD
FT                   RNKADTTMIRERLAGLYQRYQLQAIYHTERSNDAQGSNHFKAYTYDGQFYESCEVTTPV
FT                   LQRVGSGDAFVAGLLYQLLEGDEKQYNLDFAVATASLKCTVAEDQLYHSAQQVEAVLAN
FT                   QRDVQR"
FT   gene            528988..529641
FT                   /gene="kgdA"
FT                   /locus_tag="MGAS10750_Spy0546"
FT   CDS_pept        528988..529641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgdA"
FT                   /locus_tag="MGAS10750_Spy0546"
FT                   /product="4-Hydroxy-2-oxoglutarate aldolase /
FT                   2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /EC_number="4.1.2.14"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37496"
FT                   /db_xref="GOA:Q1J7L5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L5"
FT                   /protein_id="ABF37496.1"
FT                   /translation="MSRGDDMGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGI
FT                   KTIEVTYTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQLIVGPNFN
FT                   RAVALICHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGMSFIRAIKSPLPQVE
FT                   VMVTGGVSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            529931..530587
FT                   /locus_tag="MGAS10750_Spy0547"
FT   CDS_pept        529931..530587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0547"
FT                   /product="Beta-phosphoglucomutase / Glucose-1-phosphate
FT                   phosphodismutase"
FT                   /EC_number="5.4.2.6"
FT                   /EC_number="2.7.1.41"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37497"
FT                   /db_xref="GOA:Q1J7L4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L4"
FT                   /protein_id="ABF37497.1"
FT                   /translation="MLMIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDF
FT                   IGGNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLEQLKKQG
FT                   IKLAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQ
FT                   LLVVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            531227..532402
FT                   /locus_tag="MGAS10750_Spy0548"
FT   CDS_pept        531227..532402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0548"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37498"
FT                   /db_xref="GOA:Q1J7L3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L3"
FT                   /protein_id="ABF37498.1"
FT                   /translation="MSFFFLEVLTYFDYDSSMTIKAEIKALAKEIGISKIGFTTADNFD
FT                   YLEKSLRASVEEGRNSGFEHKVIEDRISPESLLESAKTIISIGVAYPHKLPQQPQKTPY
FT                   KRGKITPSSWGLDYHYVVGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAG
FT                   IGFIGKNGLVISKEYGSYMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDG
FT                   SMNAKRCLSFQTQDKGMMDTEFRKKIKTVIYGCDICQICCPYNKGINNSPATEIDPELA
FT                   QPELIPFLSLSNGQFKEKFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKN
FT                   NNPIHTATAIWALGEIVKKPNDEMLAFMSHLTLKDEDSRKELELIRRKWQV"
FT   gene            532556..533569
FT                   /gene="prfB"
FT                   /locus_tag="MGAS10750_Spy0549"
FT   CDS_pept        532556..533569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="MGAS10750_Spy0549"
FT                   /product="Bacterial Peptide Chain Release Factor 2 (RF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37499"
FT                   /db_xref="GOA:Q1J7L2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L2"
FT                   /protein_id="ABF37499.1"
FT                   /translation="MEEEIALLENHMTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQ
FT                   ELSDETELLLEMLDEDDSLKEELEENLMQLDKIMGAYEMTLLLSEPYDHNNAILEIHPG
FT                   SGGTEAQDWGDLLLRMYTRFGNANGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKS
FT                   EMGVHRLVRISPFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQN
FT                   VNKVSTGVRLTHIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKG
FT                   DKKEITWGSQIRSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            533588..534280
FT                   /gene="ftsE"
FT                   /locus_tag="MGAS10750_Spy0550"
FT   CDS_pept        533588..534280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="MGAS10750_Spy0550"
FT                   /product="Cell division ATP-binding protein ftsE"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37500"
FT                   /db_xref="GOA:Q1J7L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L1"
FT                   /protein_id="ABF37500.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            534243..535202
FT                   /gene="ftsX"
FT                   /locus_tag="MGAS10750_Spy0551"
FT   CDS_pept        534243..535202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="MGAS10750_Spy0551"
FT                   /product="Cell division protein ftsX"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37501"
FT                   /db_xref="GOA:Q1J7L0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7L0"
FT                   /protein_id="ABF37501.1"
FT                   /translation="MMKKKEIMVTMIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLT
FT                   LVGVFAATLLNIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDK
FT                   IAQIKGVKKITFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITK
FT                   KIRTIEGVEAADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRK
FT                   RDIEIMRLVGAKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNL
FT                   SMYPLDPYVYYLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(535512..536171)
FT                   /locus_tag="MGAS10750_Spy0552"
FT   CDS_pept        complement(535512..536171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0552"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37502"
FT                   /db_xref="GOA:Q1J7K9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K9"
FT                   /protein_id="ABF37502.1"
FT                   /translation="MIFWYTILMKIYKTINHIAGENTYYLVNDQAVILIDPGSNGQEII
FT                   AKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAAWLSSPDDNLSGLG
FT                   RHDDIITVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSWGGVSFVFHSDELVVTGDAL
FT                   FRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTICHEKNANPFFH"
FT   gene            536352..537143
FT                   /locus_tag="MGAS10750_Spy0553"
FT   CDS_pept        536352..537143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0553"
FT                   /product="(R,R)-butanediol dehydrogenase / Acetoin
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.4"
FT                   /EC_number="1.1.1.303"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37503"
FT                   /db_xref="GOA:Q1J7K8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K8"
FT                   /protein_id="ABF37503.1"
FT                   /translation="MTKKYEVEDMSKVAIVTGAGQGIGFAIAKRLHADGFKIGILDYNE
FT                   ETAQAAVDKLSPEDAVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDT
FT                   ITEEQFEKAFAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTK
FT                   FAVRGITQTLAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMDQFAKD
FT                   ITLKRLSEPEDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            537251..539752
FT                   /gene="dinG"
FT                   /locus_tag="MGAS10750_Spy0554"
FT   CDS_pept        537251..539752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="MGAS10750_Spy0554"
FT                   /product="ATP-dependent helicase, DinG family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37504"
FT                   /db_xref="GOA:Q1J7K7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K7"
FT                   /protein_id="ABF37504.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLGHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLVYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKSYQISKSFPINIALLGLEERPKQTQFAQLIDEDYHQGVAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRVQDDKDFARNKVLVFDE
FT                   AQKLMLQLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVPHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRQDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            540088..541281
FT                   /gene="aspC"
FT                   /locus_tag="MGAS10750_Spy0555"
FT   CDS_pept        540088..541281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MGAS10750_Spy0555"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37505"
FT                   /db_xref="GOA:Q1J7K6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K6"
FT                   /protein_id="ABF37505.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNIIYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIETLKEAVRRLHVFMESNEIN"
FT   gene            541302..542648
FT                   /gene="asnS"
FT                   /locus_tag="MGAS10750_Spy0556"
FT   CDS_pept        541302..542648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="MGAS10750_Spy0556"
FT                   /product="Asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37506"
FT                   /db_xref="GOA:Q1J7K5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7K5"
FT                   /protein_id="ABF37506.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGHEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDTLVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            543062..543952
FT                   /locus_tag="MGAS10750_Spy0557"
FT   CDS_pept        543062..543952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0557"
FT                   /product="ATP-binding protein"
FT                   /note="contains P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37507"
FT                   /db_xref="GOA:Q1J7K4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7K4"
FT                   /protein_id="ABF37507.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQASFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            543949..544926
FT                   /locus_tag="MGAS10750_Spy0558"
FT   CDS_pept        543949..544926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0558"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37508"
FT                   /db_xref="GOA:Q1J7K3"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K3"
FT                   /protein_id="ABF37508.1"
FT                   /translation="MKNPKMTVIGGGTGISIILKSLRNEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGNLIIAGISEMQG
FT                   STYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYQGMIDHVYVTN
FT                   TYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEVVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            544923..545834
FT                   /locus_tag="MGAS10750_Spy0559"
FT   CDS_pept        544923..545834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0559"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37509"
FT                   /db_xref="GOA:Q1J7K2"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7K2"
FT                   /protein_id="ABF37509.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSLIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLAAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYVQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   gene            complement(546031..547446)
FT                   /locus_tag="MGAS10750_Spy0560"
FT   CDS_pept        complement(546031..547446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0560"
FT                   /product="Site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37510"
FT                   /db_xref="GOA:Q1CPJ9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ9"
FT                   /protein_id="ABF37510.1"
FT                   /translation="MRKVAIYSRVSTINQAEEGYSIQGQIEALTKYCEAMEWKIYKNYS
FT                   DAGFSGGKLERPAITELIEDGKNNKFDTILVYKLDRLSRNVKDTLYLVKDVFTANNIHF
FT                   VSLKENIDTSSAMGNLFLTLLSAIAEFEREQIKERMQFGVMNRAKSGKTTAWKTPPYGY
FT                   RYNKDEKTLSVNELEAANVRQMFDMIISGCSIMSITNYARDNFVGNTWTHVKVKRILEN
FT                   ETYKGLVKYREQTFSGDHQAIIDEKTYNKAQIALAHRTDTKTNTRPFQGKYMLSHIAKC
FT                   GYCGAPLKVCTGRAKNDGTRRQTYVCVNKTESLARRSVNNYNNQKICNTGRYEKKHIEK
FT                   YVIDVLYKLQHDKEYLKKIKKDDNIIDITPLKKEIEIIDKKINRLNDLYINDLIDLPKL
FT                   KKDIEELNHLKDDYNKAIKLNYLDKKNEDSLGMLMDNIDIRKSSYDVQSRIVKQLIDRV
FT                   EVTMDNIDIIFKF"
FT   gene            complement(547597..548199)
FT                   /locus_tag="MGAS10750_Spy0561"
FT   CDS_pept        complement(547597..548199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0561"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37511"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ8"
FT                   /protein_id="ABF37511.1"
FT                   /translation="MVKLWGVILKNKNIFIRSFIMNLDTVLQQMKECGAYDTWGTKKEV
FT                   KALPEILSDDEIIQYATSGFVNGNTVLVVLTQKRILFIDKGMLYGIRSTEIPLDMVNSV
FT                   SYSKGLILGAIAVMNGATKIEISNIAKDTCPVLTEKIKDCVEQYKYNLYQHQSPQKTAT
FT                   VGSEDAVAEIRKFKKLYDEGILTEEEFIAKKKIILGI"
FT   gene            complement(548165..548914)
FT                   /locus_tag="MGAS10750_Spy0562"
FT   CDS_pept        complement(548165..548914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0562"
FT                   /product="phage transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37512"
FT                   /db_xref="GOA:Q1CPJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ7"
FT                   /protein_id="ABF37512.1"
FT                   /translation="MASTIAFPAMVKELRLGKNLTMEQLAEELGKTKSTISKWEKGTRS
FT                   PKIYEIEEIAKFFGVEPKKMMFGDNPTSINPQVELIPSTLQKINSTSSQLEHSRQIIVL
FT                   DTAETLLEQQKEIKNNEDTIAELFSYNYYDHAASAGTGQYLNDVQVEKIELPVDYDADF
FT                   VIPVYGDSMEPKYHSGDYVFIKLSVELADGDIGVFEYYGDAYIKQLLINDEGAFLHSLN
FT                   GKYEDIPVDRDSDFRIIGEVVGSYSEK"
FT   gene            549301..549459
FT                   /locus_tag="MGAS10750_Spy0563"
FT   CDS_pept        549301..549459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0563"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37513"
FT                   /db_xref="GOA:Q1CPJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ6"
FT                   /protein_id="ABF37513.1"
FT                   /translation="MNWKKLMFGDLEYTFASRDGKEKTSIEFEGGVLPALLVLCGITWL
FT                   IAWFITK"
FT   gene            complement(549558..550199)
FT                   /locus_tag="MGAS10750_Spy0564"
FT   CDS_pept        complement(549558..550199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0564"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ5"
FT                   /protein_id="ABF37514.1"
FT                   /translation="MNFFNFLLCVFKFTSEYLIKNWIALIALFLSYSNYRRNNLQVELI
FT                   AAPVSDWILSVILDNGESIYNPNGTLRANIKIINPSNVDVSYFDLIVFDKNRKYQHYYQ
FT                   KQNNIINDLTGREAIAAVQPDGNTILIEVPEADCGVLKAHSMTRMDLIIQTSEITDRLF
FT                   VAFKVAKKKKLFKANKAGYVNSPYQSFSASFPVELSKKPHYEDILKDLHE"
FT   gene            550292..550498
FT                   /locus_tag="MGAS10750_Spy0565"
FT   CDS_pept        550292..550498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0565"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37515"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ4"
FT                   /protein_id="ABF37515.1"
FT                   /translation="MQENAFEQLIDDSGIKKKVIATKMGFTRSGFYQKRKKPKKSFDAS
FT                   EVAMLADILGVDPGKVLEAILIS"
FT   gene            550504..550785
FT                   /locus_tag="MGAS10750_Spy0566"
FT   CDS_pept        550504..550785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0566"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37516"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ3"
FT                   /protein_id="ABF37516.1"
FT                   /translation="MTKITQNLERTHMNEIENKLEELEEMVINMDEVDVVIPWKVAKNL
FT                   LQRAGYLSEEEHRLLSWRLGKSKYAGKRSEKVRNLLEGLRNSGSSENS"
FT   gene            complement(551116..551346)
FT                   /locus_tag="MGAS10750_Spy0567"
FT   CDS_pept        complement(551116..551346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37517"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ2"
FT                   /protein_id="ABF37517.1"
FT                   /translation="MEIFSYPENAKELYEKHKKAIEQACEPIATMLALNNPELTDLANE
FT                   ALELYARTIYNACVDASIIIRNREYQHYRDQ"
FT   gene            551470..551676
FT                   /locus_tag="MGAS10750_Spy0568"
FT   CDS_pept        551470..551676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0568"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37518"
FT                   /db_xref="GOA:Q1CPJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ1"
FT                   /protein_id="ABF37518.1"
FT                   /translation="MCFGEWVMWGKLSKILSERGMTMYQLAKLSGVNKSHFSDLKSGKI
FT                   KNLSWPNMVKISDALGVSLDEFK"
FT   gene            551749..551994
FT                   /locus_tag="MGAS10750_Spy0569"
FT   CDS_pept        551749..551994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37519"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPJ0"
FT                   /protein_id="ABF37519.1"
FT                   /translation="MEIVHIKDIVTEPYSADDETLGKIFGYTKRQMQDRRYEMVKIPYF
FT                   SKYLLEQGGRVTIDGMREYLFYRKSIEWEKDKEKYL"
FT   gene            551991..552131
FT                   /locus_tag="MGAS10750_Spy0570"
FT   CDS_pept        551991..552131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0570"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37520"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI9"
FT                   /protein_id="ABF37520.1"
FT                   /translation="MKLLDFIFAKPKKQEEKPKWTIENNGWEANTRRYNQKHGLPAKQI
FT                   W"
FT   gene            552141..552353
FT                   /locus_tag="MGAS10750_Spy0571"
FT   CDS_pept        552141..552353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0571"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37521"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI8"
FT                   /protein_id="ABF37521.1"
FT                   /translation="MDQYLINDNEFLRDENTRLNKEFSELNHAVAKANLLDVIIEDGYI
FT                   LQSTLDKCTAKLDEIDQKELKTWKN"
FT   gene            552341..552523
FT                   /locus_tag="MGAS10750_Spy0572"
FT   CDS_pept        552341..552523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI7"
FT                   /protein_id="ABF37522.1"
FT                   /translation="MEKLTLKKEKENTATLPFFVGIDLHAQIKEISTETGIPMRRIIER
FT                   MIRFSLDNLEIMEGD"
FT   gene            552633..552944
FT                   /locus_tag="MGAS10750_Spy0573"
FT   CDS_pept        552633..552944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0573"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI6"
FT                   /protein_id="ABF37523.1"
FT                   /translation="MGSEGLRLRIYINKHKKMIIAPDYNDRYGGISNTTIQLRTGKLTE
FT                   AIEQEVGEAILDIIKKYEPIFDTPIIDDLFREKEQAIRKMVDYDTALTEMVEVEDENY"
FT   gene            552931..553623
FT                   /locus_tag="MGAS10750_Spy0574"
FT   CDS_pept        552931..553623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0574"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37524"
FT                   /db_xref="InterPro:IPR006505"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI5"
FT                   /protein_id="ABF37524.1"
FT                   /translation="MKITKATEITKTHNWRILIYGKPGNGKTYLTNYLQGKTLILDMDH
FT                   SSKTIAGNENIDIIQFDRTHPSDFMTEFLIELPELIKEYDNLVIDNITSWQSDWFIEQG
FT                   RKSKNGITNELQQYNMWTNYYLRVLTTIYSQPINIFVTAWESTQDLTLESGQIITQYIP
FT                   DIRKQVLSQTLGLTDIVGRVQVNPKTGGHGILLQGSDGLYAKNRLDNRTVCKAEELFNF
FT                   GDTVNETT"
FT   gene            553719..554954
FT                   /locus_tag="MGAS10750_Spy0575"
FT   CDS_pept        553719..554954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0575"
FT                   /product="phage DNA/RNA helicase"
FT                   /note="DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37525"
FT                   /db_xref="GOA:Q1CPI4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI4"
FT                   /protein_id="ABF37525.1"
FT                   /translation="MVMAHIAKSATDKGNRVLFFSHRKEINEQVEKTFAVNGVNSNLLT
FT                   IGGVQSLVRKLDSLFQPEVILIDEAHHSKAKSYLKIIDYFKNAYVLMFTGTPVRLNGDG
FT                   FDDIADDLVVGKSVKWLQEHGNIANFKYYAPSMIDNSVLKKRGGEFTKDSVDQSMKSVI
FT                   YGDVIKHYEKLAKGKQAIVYTHSVEASHLVSDTFNQAGYQSQAVSGKTPKNEREEAMRA
FT                   FRDGDLKIMVNCELFTEGIDLPNVDVCIMLRPTQSLSLYLQFAMRPLNPRDGKTAIIID
FT                   HVGNVERFGLPNMDREWRLDGETKQKQSAKIGEPTTRVCDNCYATYWSDTRICPECGHE
FT                   NELTKREIEEIKEAELQEISEQKQLKLKNRVSTYQTPDMCQTMDELTEYRKQHGYKPGW
FT                   QYYIAKKLGILY"
FT   gene            554970..555428
FT                   /locus_tag="MGAS10750_Spy0576"
FT   CDS_pept        554970..555428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0576"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37526"
FT                   /db_xref="InterPro:IPR007731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI3"
FT                   /protein_id="ABF37526.1"
FT                   /translation="MFTIDYSKAKEFASITDGTYETFIEKAVQDATKNGADFINIHFRI
FT                   RKDFQQEFQNNIIFHRIFAKKEDGKYPEGVIHNLAKQAGIPEGTQFKSLDDYLNQLLNK
FT                   CLKITVKNETSEYNGNTYNNLNVKRIEKSDIPSMVNPVEEFKEDDLPF"
FT   gene            555431..556243
FT                   /locus_tag="MGAS10750_Spy0577"
FT   CDS_pept        555431..556243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0577"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37527"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI2"
FT                   /protein_id="ABF37527.1"
FT                   /translation="MRGMIDYAIYYQQKGFSVIPISKDGKKPLVAFADKPAFTEHELRL
FT                   LWKDNPDANIALRTDSFFVIDIDVHNGVDGLKNLREWEHARLIPKTLQATTPSGGRHIY
FT                   LKKPQGVSMAQNIGFVDGVDLKAHVNNYVLVPPSNNAKGMYVWDKVHSPTSGEMTEAPL
FT                   ELITVLQELKPAYEYDASSFTSGDYQGSNKTAKLFETIVLGFGDTGGRNNSLAEFVGGL
FT                   LLRNVDVEIAYTLAKMANHKTVDPLNDKEFDRTFKSMCDKELRRRSGL"
FT   gene            556233..557708
FT                   /locus_tag="MGAS10750_Spy0578"
FT   CDS_pept        556233..557708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0578"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37528"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI1"
FT                   /protein_id="ABF37528.1"
FT                   /translation="MDFEFYREKLNEEPGIEPGKPTTWSAIKSKLIAYRRDWLEEAGKD
FT                   VKNLSELAVAIGINKYLHVITLENGKVAIYDPDQGYYIKDYKFAYKLIHILQPTFNETK
FT                   CRNVLFMLASMDRKYGAMDFEPEFQDVRRYVLVKNGIYDKYKRKLLPFDYRFINFSTIE
FT                   TELIPNAPLPTIDGWDVESWLLDLMSGDKDLVKLLWQVVAASLNGNYSYRKSIWFVGNG
FT                   NDGKGTFQQMISNLVGFKNVAPLKLNQFSERFGLAIIEGKTVIIGDDVQAGIYVDESSN
FT                   FNSVVTGEPVSIEKKGENPYMAIFKKTVIQSTNGMPSFKNKSNGTYRRIIIIPFKKTFS
FT                   SKEDNWAIKDDYINRKEVLEYVLWKAINIDFDRFSEPKATQERMHAFKRDNNTILAFID
FT                   DWFERFTSTVLPTRFLWWLYKEWCKDNGHTPLKQSTFENELSTNIPDGWVKKKSRVAGK
FT                   FFPSDEIPTEYGHFPWNNEKDANGSMQSYVKII"
FT   gene            557970..558383
FT                   /locus_tag="MGAS10750_Spy0579"
FT   CDS_pept        557970..558383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0579"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37529"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPI0"
FT                   /protein_id="ABF37529.1"
FT                   /translation="MYDILKDYEDLPIPSESIYYHDWLIGNITSEEAKEHFYRSDHPKG
FT                   FLELSEDKQEKLLHWCKQLEKTKTYENGHTSYGLKHKFEYRKNGFYVTNGQFKGAMLLA
FT                   GFKPKDKNKLNWVFAFSVKSLRKIIDTKRYVMV"
FT   gene            558380..558700
FT                   /locus_tag="MGAS10750_Spy0580"
FT   CDS_pept        558380..558700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0580"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37530"
FT                   /db_xref="GOA:Q1CPH9"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH9"
FT                   /protein_id="ABF37530.1"
FT                   /translation="MTTESLIQNQIRVGLSQAGHMVFRANVGKVKTADGRFFDTGLPKG
FT                   FCDLFGFKPDGQVFFIEVKNETGRVRPEQKKFMEVMASRGALVGVARSVEDALKIVNDT
FT                   SR"
FT   gene            558684..559040
FT                   /locus_tag="MGAS10750_Spy0581"
FT   CDS_pept        558684..559040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0581"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH8"
FT                   /protein_id="ABF37531.1"
FT                   /translation="MTLVDDFYKQMEPSIKAFLDDNIIITDPEEADRVYKSVKYYKNLN
FT                   RLPPPNVLDWFKQIYTTEEMITLIKQSYRLKQKKTDEDDEIYEKWMFKNYGDVKLVKKV
FT                   KRMDALAKAWEMGL"
FT   gene            559165..559446
FT                   /locus_tag="MGAS10750_Spy0582"
FT   CDS_pept        559165..559446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0582"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37532"
FT                   /db_xref="InterPro:IPR011630"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH7"
FT                   /protein_id="ABF37532.1"
FT                   /translation="MTYKINPESMQVAFDKNYQTFLDKNADYGNSFEKSLDDLGIVAGV
FT                   VRIGDKYNRVCNLIKNKQNVSESLSDTLNDMANYCMMLAVWLEGQKDD"
FT   gene            559439..559624
FT                   /locus_tag="MGAS10750_Spy0583"
FT   CDS_pept        559439..559624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0583"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37533"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH6"
FT                   /protein_id="ABF37533.1"
FT                   /translation="MTKKHVVRVYNKGITATYMVYDKNLFKEHEFATKREAMQFIRKLE
FT                   LANEKRSTEYFMREAE"
FT   gene            559621..559890
FT                   /locus_tag="MGAS10750_Spy0584"
FT   CDS_pept        559621..559890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0584"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37534"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPB5"
FT                   /protein_id="ABF37534.1"
FT                   /translation="MKKPNRYPYSKSKFNGCIYQLHAASFKDEQYVEDLKSCGIHYQIT
FT                   KIGYFPDIFIKIDNLEQLQILIDKTGHDLILSKDQIWIYDDYME"
FT   gene            559900..560313
FT                   /locus_tag="MGAS10750_Spy0585"
FT   CDS_pept        559900..560313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0585"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37535"
FT                   /db_xref="InterPro:IPR010024"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH4"
FT                   /protein_id="ABF37535.1"
FT                   /translation="MIPKFRAFNKKIQKMYSIDGFKSSERKIYRCSLADDEFRSGRLET
FT                   FHFVEDNLDDYILRQSTGLFDKNGVEIFEGDVVKLQYTITSDLEFFKVNQFRGGSWRID
FT                   NRRRGSDLWLRNEDCEVIGNIYQNSDLIESVEE"
FT   gene            560310..560594
FT                   /locus_tag="MGAS10750_Spy0586"
FT   CDS_pept        560310..560594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0586"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37536"
FT                   /db_xref="GOA:Q1CPH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH3"
FT                   /protein_id="ABF37536.1"
FT                   /translation="MTTDELLQNLRDDLNKIINVLKNDWKALLFLAIAIFGMMVTVSYF
FT                   SYRDARQYYESQITGLRTQLSRTQKQLKRASEQNQRQTKRIAEMTGNGG"
FT   gene            560598..561080
FT                   /locus_tag="MGAS10750_Spy0587"
FT   CDS_pept        560598..561080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0587"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37537"
FT                   /db_xref="GOA:Q1CPH2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH2"
FT                   /protein_id="ABF37537.1"
FT                   /translation="MTDIKILDACCGSRLFWFDKNEPHTTFMDVRQEKFEMHGKKINVN
FT                   PDVIGDFRDMPFESNSFNLVVFDPPHLKYVGQNSIMKAQYGQLDKENWKEDISKGFEEC
FT                   MRVLKVGGTLVFKWSDCQVNVREVLSAIPFKPLFGQQRGTTHWMTFVKFELTGNGG"
FT   gene            561046..561834
FT                   /locus_tag="MGAS10750_Spy0588"
FT   CDS_pept        561046..561834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0588"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37538"
FT                   /db_xref="GOA:Q1CPH1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH1"
FT                   /protein_id="ABF37538.1"
FT                   /translation="MLNLSLLEMGDSDVKCELYNDHFENAKRYNIPRAQLIIADIPYNL
FT                   GNNAYASDPRWYENGSNKNGESKLAGKSFFDTDNDFKINNFFDFCSRLLRKEPKEKGKA
FT                   PAMIVFHAWQQRELVIACGKKHGFNNAYPLYFTKKSSPQVLKANMKIVGAVEEATVLYR
FT                   DKLPKFNNGGAMILNHAPWEKDSSYPVIHPTQKPIPVLKRLIEIFTDPDDVVIDPVAGS
FT                   GSTIRAAIEMNRNAYGFEIKKDFYKRAKEEMLSTFQTSLF"
FT   gene            561882..562607
FT                   /locus_tag="MGAS10750_Spy0589"
FT   CDS_pept        561882..562607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0589"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37539"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPH0"
FT                   /protein_id="ABF37539.1"
FT                   /translation="MNTNEAKIGDKVWVEGIINSSFSNGGVHVNHAGVDAFYDLERTKI
FT                   KPDGYAGQSPKYLKNIIAKMRELPEHDRAVWIKGIFKEFGIENDISYYLGHKQGVLQAK
FT                   DSLKPEVPQYVADYIEKCKKRGDTLYLALKVEKSVKQSVYKWLWDGSGDESFIKFAKAW
FT                   IYGYTIEKEKLYTVEIPNPNREGRGHAKFVLERQGNKVFLVKRKSKDCYYNKNSNHLTE
FT                   SEIRKDFEWAWQFAKEVTE"
FT   gene            563050..563487
FT                   /locus_tag="MGAS10750_Spy0590"
FT   CDS_pept        563050..563487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0590"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37540"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG9"
FT                   /protein_id="ABF37540.1"
FT                   /translation="MGNIPTTKANNFLEELKTIPHLIETLERDANLMSRSLVKSPQWSD
FT                   MKVSGGVKQSQEDKNIKMLHMVGYYSDQIEQLKDRRQEMANLIVQSMGICESHVLLTTY
FT                   LDCDGDYERARERLNIGNRNKYFMFVRRGKESLELILKNTN"
FT   gene            complement(563827..564003)
FT                   /locus_tag="MGAS10750_Spy0591"
FT   CDS_pept        complement(563827..564003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0591"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37541"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG8"
FT                   /protein_id="ABF37541.1"
FT                   /translation="MNSKPIAYPILGHFYLSNRNSRNRTDLQPLSLLTTSKVATLVLLV
FT                   VNQMSQSVVNTYT"
FT   gene            564043..565035
FT                   /locus_tag="MGAS10750_Spy0592"
FT   CDS_pept        564043..565035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0592"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37542"
FT                   /db_xref="GOA:Q1CPG7"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG7"
FT                   /protein_id="ABF37542.1"
FT                   /translation="MVAFYCGVKMLKLDEKKIRKGKPVGLPYQGSKKKISKKIVEIIKQ
FT                   NFDADKPIYDVFGGGGAITAECVLNGLEVHYNDLDNDITDMFQRVISQDREWIKTLIIS
FT                   RDEFNKIRQKEPKSVDDNLKLLVNSFGNELSSYLYGADWSDTKYDLAVEIINKHDVFSG
FT                   YKQTETYKKADKPYDEGELEKNKKLTQLEQLQQLGRLQQLEQLQQLGRLQQLEQLQQLG
FT                   RLQQLGRLEQLEPTNYSYEAFSDIEDAIFYLDPPYENTTQKSYKGDFNSQAFYDWAFGM
FT                   SKNNIVLISSYDISDERFECVYEFKTARSTMQGGGAGKRTEKLFMAVIT"
FT   gene            complement(565162..565578)
FT                   /locus_tag="MGAS10750_Spy0593"
FT   CDS_pept        complement(565162..565578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0593"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37543"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG6"
FT                   /protein_id="ABF37543.1"
FT                   /translation="MVCLSHSNQRRIIMLIYPATFTQDTDYIMVTFPDVPEAITQGEDF
FT                   QEAYEMAVEVLGFALEDYTDYPKASAVSDLKEQYPDSDIALIGIDMVAYMKKYHSKKVR
FT                   KNVTIPEWLNDAAEDKNLNFSQVLTEALELKLQA"
FT   gene            complement(565591..565857)
FT                   /locus_tag="MGAS10750_Spy0594"
FT   CDS_pept        complement(565591..565857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0594"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37544"
FT                   /db_xref="GOA:Q1CPG5"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG5"
FT                   /protein_id="ABF37544.1"
FT                   /translation="MRILCVFCIDIYIVYVYNISIESEVSNMPMTPKQMIKLLKKNGFY
FT                   EVSQNGSHKKFRDNNGHQTIVPMHNKDLGKGLEDTILKQAGLK"
FT   gene            566012..566350
FT                   /locus_tag="MGAS10750_Spy0595"
FT   CDS_pept        566012..566350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0595"
FT                   /product="phage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37545"
FT                   /db_xref="GOA:Q1CPG4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG4"
FT                   /protein_id="ABF37545.1"
FT                   /translation="MRPQKLTIAGGRRTTVDYDDRSAEYRDYNRNRWKYDKQAKQFYNS
FT                   RIWRETSKQVLLQNDYICAMCGGEATMTDHIVSVKQDWNKRLDWNNLQASCKACNDSKA
FT                   IRERRKNN"
FT   gene            566521..566988
FT                   /locus_tag="MGAS10750_Spy0596"
FT   CDS_pept        566521..566988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0596"
FT                   /product="phage terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37546"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG3"
FT                   /protein_id="ABF37546.1"
FT                   /translation="MGRNLKLVETTKKHLTKEEKIVRETAQNKASDGLKKLQKTPPEHF
FT                   NNVAKYEYRRIIEDLQNLPLRNLDRGLLELYCTWYAIYKETSRKLDEVGYFTNDPDKGI
FT                   IPSPLILTLEKATANIRSSASQLGLTVDSRMKMFIPKEEEKPKSIFDKFGG"
FT   gene            566991..567221
FT                   /locus_tag="MGAS10750_Spy0597"
FT   CDS_pept        566991..567221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37547"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG2"
FT                   /protein_id="ABF37547.1"
FT                   /translation="MERVKEFSVKLLENGKFPIVEINGEKINGITKLIVKYDSDDAQNN
FT                   PLDNGFLVEYISEEGGRYYMQTIGQSFRIGL"
FT   gene            567222..568979
FT                   /locus_tag="MGAS10750_Spy0598"
FT   CDS_pept        567222..568979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0598"
FT                   /product="Terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37548"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG1"
FT                   /protein_id="ABF37548.1"
FT                   /translation="MIKVEYDYSAISDIYKDDAFYYAKMVVDEQIKSSKKVFRACLRHL
FT                   NDLKKIDGDNFKFIYLPEKAADPINFIEILPDVKTGKPYPLAMFQKFIIGNLYGWRKKT
FT                   DHSLRRFRKAMISVARKNGKTILIAGILLYEFLFGHNPSMSRQLFCTANDRTQAKIAWD
FT                   MAKKQLSSLRAKDADVRKATKIVRDELKNLHDESYIRALSRDTGAVDGFEPYVGVLDEF
FT                   AASKTNEMLELLESGQGQLDNPFILIISTAGMDLNVPMHTIEYPYITKILDGEITDEGY
FT                   FGYVAEQDNEEEIKDESNWIKSNPILEVEALHDKLMDYLRTRRRVSLETGEINKVLIKN
FT                   FNMWRQSSEESYIDKTTWELARIDKPDTNKRRVWLGVDVGRVSDLFAITPVVMMDDFWY
FT                   IDSFSFVATKYGLTAKEKRDGVSYSNLECQGYCEITTLESGVIDDERVLEKIEEMVYSN
FT                   DWEINGICFDPYQFGTLLTMIEKRHPEWPLIEVSQTTMVLNMPTKQFRDDLKKGKIKHS
FT                   GNPLLTMAINNAYIKTDNNGMRIDKNKNSNKIDPLDAALDGYAVCYLEPFDGSGYWTNE
FT                   KIIGGESLF"
FT   gene            568976..569146
FT                   /locus_tag="MGAS10750_Spy0599"
FT   CDS_pept        568976..569146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0599"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37549"
FT                   /db_xref="GOA:Q1CPG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPG0"
FT                   /protein_id="ABF37549.1"
FT                   /translation="MIDFILKNIHTLILLAGLGLLMYGLFLFGDKVGFIASGLILIVLA
FT                   IYVDSVGGKRE"
FT   gene            569139..569363
FT                   /locus_tag="MGAS10750_Spy0600"
FT   CDS_pept        569139..569363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0600"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37550"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF9"
FT                   /protein_id="ABF37550.1"
FT                   /translation="MNKRIKKKRKLETAIVLLIKEVAELRSIVSANAKATNNELAAVKS
FT                   AILDNQVAIKSIGDEVGHIKQNYKRKWRK"
FT   gene            569397..570617
FT                   /locus_tag="MGAS10750_Spy0601"
FT   CDS_pept        569397..570617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0601"
FT                   /product="Portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37551"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF8"
FT                   /protein_id="ABF37551.1"
FT                   /translation="MSFFRPLGSSKVSYDDYISSVLAGDVSQKYLGVSALKNSDILTAT
FT                   SIIAGDIARFPLVKKDVNGDIIHDEDINYLLNVKSTKNASARTWKFAMAVNAILTGNSF
FT                   SRILRDPKTNQALQFQFYRPSETTVEETDSHEIIYTFTDTLTAKQVKCFAHDVVHWKFF
FT                   SHDTILGRSPLLSLGDEIDLQTGGINTLIKFFKDGFSSGILTMKGAQLSGDARQRARQE
FT                   FEKMREGSVGGSPLVFDSTMEYTPLEIDTNVLQLITSNNFSTAQIAKALRVPSYKLGVN
FT                   SPNQSVAQLMEDYVTNDLPFYFDAITSELGLKTLNDKDRRLYRIEFDTRSVTGRNVDEI
FT                   VKLVNNQILTPNQGLIELGKQKSTDPNMDRYQSSLNYVFLDKKEEYQDKVGIKGKGGEV
FT                   NAKEDKS"
FT   gene            570595..571260
FT                   /locus_tag="MGAS10750_Spy0602"
FT   CDS_pept        570595..571260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0602"
FT                   /product="ATP-dependent endopeptidase clp proteolytic
FT                   subunit clpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37552"
FT                   /db_xref="GOA:Q1CPF7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF7"
FT                   /protein_id="ABF37552.1"
FT                   /translation="MPKRINLKGPLIANNSQEVYDYYGMEATSAKSIINQLPEDSSDII
FT                   LEVNSNGGLVTVGSEVYTALRNYKGKVTAEITGMAASAASVAVMGADKVVMSPTAQMMV
FT                   HKALFNWVAGNSDDLDKASNALKSSDKAIVNAYVAKTGLSEDEIMNLMRNETFMSAQDA
FT                   VEKGFADEVMSFEAVASIDNQMLPQAVIDDYYANRSKRKQEISNMLLEIEKEEILQGL"
FT   gene            571273..572472
FT                   /locus_tag="MGAS10750_Spy0603"
FT   CDS_pept        571273..572472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0603"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37553"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF6"
FT                   /protein_id="ABF37553.1"
FT                   /translation="MEEFMFEEKIKEIKATIASLNQAIATKTAEVKNALESDDLETARS
FT                   IKAEVEQAKADLVEAENDLKLYEASIEKGGAENTGGKEVPQETKTYRESVNEFIRSKGT
FT                   VTNEALRFEGKDEVLIPLNQTTPIDPKTDGVKKTDVKPVSSEEILYTPAREVKTVVDLK
FT                   QFTSIHPAKKASGKWPVLQCATEKMVSVEELEKNPKLAKPKFKDVEWKVETYRGAIPLS
FT                   QESIDDADVDLVGIVAETIGQMKVNTTNDAIAKVLKTFEPKADVKTLDEIKKILNVDLD
FT                   PAYNVSFIVSQSFYQSMDTLKDENGRYLLQDSITSVTGKVFLGKPVFVLADEVLGKNKA
FT                   FVGDFKRGVLFADRKDLGLRWVDNDIYGQYLQAVLRFGVAKVDDKAGYYVTFTPEQLPS
FT                   "
FT   gene            572486..572614
FT                   /locus_tag="MGAS10750_Spy0604"
FT   CDS_pept        572486..572614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0604"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF5"
FT                   /protein_id="ABF37554.1"
FT                   /translation="MAKPTSKSTVEEIKRYLTSKGIDFSGKTLKSDLLALAGVEEV"
FT   gene            572617..572919
FT                   /locus_tag="MGAS10750_Spy0605"
FT   CDS_pept        572617..572919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0605"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37555"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF4"
FT                   /protein_id="ABF37555.1"
FT                   /translation="MAVSKELLDSVKLYCKIDFDFEDDIIKEMIESAQEQICFAIEEGS
FT                   TAGTFKESAKFALAVKKQVKEEYDHRGLSADSFRYPLANGVLNIIHQLRLRGDDS"
FT   gene            572916..573263
FT                   /locus_tag="MGAS10750_Spy0606"
FT   CDS_pept        572916..573263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0606"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37556"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF3"
FT                   /protein_id="ABF37556.1"
FT                   /translation="MITRKMNVRITIFSQSGGQNEDGEVVSAIRKDLYTCWAEVLKTQL
FT                   RDFNYQSKFQNASNLPTNKDTKVFLIRYNPELSIDNTMFVEFDKRIYKIDKIESDESGK
FT                   DMIMISGVSMS"
FT   gene            573260..573637
FT                   /locus_tag="MGAS10750_Spy0607"
FT   CDS_pept        573260..573637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0607"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37557"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF2"
FT                   /protein_id="ABF37557.1"
FT                   /translation="MTKGLDEILANLTKLEVKASKTAKAAVTKVAKEFEKTLKSNTPVY
FT                   EIETDERLQEDTVISGFKGSNVGIVSKEIGYGKATGWRAHYPNDGTIYQRGQDFKERTI
FT                   NQMTPRARQIYAEKVKEGLGL"
FT   gene            573634..574059
FT                   /locus_tag="MGAS10750_Spy0608"
FT   CDS_pept        573634..574059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0608"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF1"
FT                   /protein_id="ABF37558.1"
FT                   /translation="MIAETAAYKLLSNDKTLNELLDRLRGGTFKNGFKQGIFTYDIPDN
FT                   PVNLRKVELAPFMRINTTLDGPFDYADDEILCNEQRITINFWCKTASEADQINKCIDNI
FT                   LKQGGFERYTANEKPRYKDRDIDLLMNVRKYRYFDFY"
FT   gene            574075..574683
FT                   /locus_tag="MGAS10750_Spy0609"
FT   CDS_pept        574075..574683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0609"
FT                   /product="Major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37559"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPF0"
FT                   /protein_id="ABF37559.1"
FT                   /translation="MGKVKFGLRDFYYGVLDGNDKVTKAESIKHLPGMKSAKLDITNEL
FT                   VTVPADDGPYVVLSGGISETKLEIELLDLTSDARKDFFGITVEKGVEKYNKNLTPNDIV
FT                   CLFRTSDENGKAIWIALLKGKFNLPGMEAQTKEGAPDPKPDTTTGNFVARGPKEEVLLV
FT                   GREGNSGFNLNEFLKCVFAGCGDAEIKKIPIAEQASTVM"
FT   gene            574736..575062
FT                   /locus_tag="MGAS10750_Spy0610"
FT   CDS_pept        574736..575062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0610"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37560"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE9"
FT                   /protein_id="ABF37560.1"
FT                   /translation="MYEITLKKGGVDKEFKKDFINVEDNLLAVEHQVRQSAVFSDEKRR
FT                   LDSKAHRKLNESYLQMFVDMYAGQFTVDDLKQSDMTVLNTLNDLYIAALGGEQEEDESE
FT                   KKEQ"
FT   gene            575092..575259
FT                   /locus_tag="MGAS10750_Spy0611"
FT   CDS_pept        575092..575259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0611"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37561"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE8"
FT                   /protein_id="ABF37561.1"
FT                   /translation="MWIQSLLKNGYTILDIKKMRLSDIELMVQALEIETVEKEEVIETT
FT                   LDKAFPFLFG"
FT   gene            575272..579195
FT                   /locus_tag="MGAS10750_Spy0612"
FT   CDS_pept        575272..579195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0612"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37562"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE7"
FT                   /protein_id="ABF37562.1"
FT                   /translation="MGNIGDLVATATLDISPFMSNTRNLKTYMKGLDNSLKAVEKSFQG
FT                   HGGRIKGLKAVYAETGSALKGYQELLKTQSQKYSDLKKEIGDVNNATAEQKQKLIGAKS
FT                   AMLETAAQVAELQNRLRALATETSVFTRFGKAAERIGGKMKSFGDSVAGVGAAFTRGVT
FT                   APIVAGAGYAIKAAVDYESAFAGVKKTVDETATVSYAKLSQGIRQMAKELPASAVEIAH
FT                   VAEAAGQLGVKTGDILSFSRTMIDLGESTNLSAEEAATSIAKIANITGLASSEYSRFGS
FT                   AVVALGNNFATTERDIVAMTNRIAASGKLAGLTNQEMLALATAMSSVGIEAEAGGTAMT
FT                   QSLSAIERAVASGGDNLNKFAQIANMSSADFARAWKEKPIVALQEFIKGLGQLDKKGES
FT                   ATKVLDELGLSGIRQSNMLKSLGLASETLGKALGISNKAWKENTALTDEANKRYETTES
FT                   KLKMLKNEVNDVAIEFGGPLVDALRNGLEAGKPIIQMAADLAKQFNSLDKEQQQQIIKW
FT                   GLIAAAAGPALSILGKGIGVIGGTIQAIGKMSKGIGALSGWLRTFKAGAVAASVGAEAA
FT                   TASMGSLTGAVALLSNPVTWGVLLGGAAVIGIGLIADSMYKAQKRTEEWGTAVSATEAT
FT                   ALSNFKKKVDETNTSLQMFEAGAGSVKKVTEAFDDLVGSIEKLAQSKLDKNINLAKKLG
FT                   LSEETINALKSKTESVVNNVKSMNTQIKAIMEKHNGDMSQLSSAEKELVLRNQREMIIA
FT                   QLDLMKFSASEKKALTAALNNELDALNARQLEKVSENTVKMLDKENSAYKTKKAELKEI
FT                   LKQFGSDTSKLSAEELAARQEVLNRLTELNMQHNLKTKALNDQYLAIQRERVQRLKESG
FT                   KSQEEIHRGISQMASDMAQKLGISYDDAYRKMAYYTEKSGETLKVLSRNTANATAEVAA
FT                   ANAQWDSLFTSDNPQQSLNELLSTAEGWNSFEIMVKNADVEPTGRAALAEMLVAGGQWQ
FT                   NMTLEQKKLVVDGQQAMIEIFDSKELLAQWQVLTPEEKVLLAKNLTQEPTMSAQQALDS
FT                   VKQTVPADVNATDKTAGDTQSAQSKIDNVKQKAPADMKASDKTGPDVASANRAVNSPKQ
FT                   NSPAVIRAQDNASGVAENVIWSLARIPRSVTTTITTFVRKIFGHEKGTDFHPGGLAVVN
FT                   DQKGALYRELVTLPTGESFIPTGRNVILPLPRGSKVLKASRTKQLFPHYANGIGFDDTR
FT                   IASLTTRLKSVQDKGTVVVNADPQLAELIKLLKDRDDRNVTNNYTLNATNSSSSEDMFS
FT                   QENMRRLVRELAYYTKGEEGRLA"
FT   gene            579195..579902
FT                   /locus_tag="MGAS10750_Spy0613"
FT   CDS_pept        579195..579902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0613"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37563"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE6"
FT                   /protein_id="ABF37563.1"
FT                   /translation="MRYIEFNGTKSNDLGLLLERERSIKSTNNDVDLIEVAGRDGVLIK
FT                   DNERLKAVEQDFPFSLVGDVTANQQKISEWLHVKGWHDLALSWDKDYIYRASVVNLFEI
FT                   DEILKQFGRLKINFLIHPIKYLKTGKQEVSLVNGSTLQNPGNVQAKPILKIKGIGNGVL
FT                   TINGFKTGLENVQGELVIDMERHLVYKDVLSAWDNIVRTERHRMPLFDVGQNKISWTGS
FT                   FTITAVPNWGVKV"
FT   gene            579899..582043
FT                   /locus_tag="MGAS10750_Spy0614"
FT   CDS_pept        579899..582043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0614"
FT                   /product="phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37564"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE5"
FT                   /protein_id="ABF37564.1"
FT                   /translation="MIPVLYEAKETKFRTFGLGEIADAYEVKATRERNGNYSLYIKYPL
FT                   DGVFASVFKEEMKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIALKPF
FT                   VNGASVGAESALEIWKKNLVGDDKFDVKSDILTLGSFSWEADKIGNARGALGGVAGSIL
FT                   DVYGGEYEFDNRTIILRKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRYTPQ
FT                   PKPQEEAPGKPHVGEHKQPEEQLVTLPEFILDGQYLSLYAQRRIQMVDLSSHFNDDKNK
FT                   KEPTVEEIRKLAQKYLKDNNVGAPKVSIEVDYIDLSQTLDYQDFRVMEEVELCDIVPLY
FT                   YPKFGITTESEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVSERINALENNQKVI
FT                   TNNQKQFELNLPKYLNDINGKRVWYEKPDDNIEHKIGDYWFEKNGKYQRTWIWDGNQWV
FT                   KVLDTEDLNPNQRAFDEAMAEIEKAKKAQEEINQRTDKELEEFRATLKNLALPEEAIKK
FT                   ITEAIKVDDIPSIKQSFDDLKNKVSETSETSRLNAEILGNNGKTRYNKNLLVGDPNRTK
FT                   TYDEDYIEVEANDGGFKRGETYTISFSQTCELLQKVAITLTQANNKGVKLVLTPTKAKT
FT                   DAQTFEVTKDKQSIEVYPLSYTGVLTGDWYKPKQIDLNASDTQELALEMAYKEVVDGKD
FT                   AAITGIWSDSPQIILDGGKK"
FT   gene            582040..583050
FT                   /locus_tag="MGAS10750_Spy0615"
FT   CDS_pept        582040..583050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0615"
FT                   /product="Hyaluronoglucosaminidase"
FT                   /EC_number="3.2.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37565"
FT                   /db_xref="GOA:Q1CPE4"
FT                   /db_xref="InterPro:IPR009860"
FT                   /db_xref="InterPro:IPR041352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE4"
FT                   /protein_id="ABF37565.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWTRSDVILLESEIGFETDTGYAKFGDG
FT                   KNQFSKLKYLNKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESKIELDKKLNLKG
FT                   GVMTGQLQFKPNKSGIKPSSSVGGAINIDMSKSEGAGVVVYSNNDTSDGPLMSLRTGKE
FT                   TFNQSALFVDYSGKTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQIRGVEKALGTLK
FT                   ITHENPNVEANYDENAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLGDD
FT                   KFYVKHDGGFYAKKTSQIDGNLKLKNPTADDHAATKAYVDSEVKKLKALLMDKQV"
FT   gene            583063..584949
FT                   /locus_tag="MGAS10750_Spy0616"
FT   CDS_pept        583063..584949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0616"
FT                   /product="phage infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37566"
FT                   /db_xref="InterPro:IPR012892"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE3"
FT                   /protein_id="ABF37566.1"
FT                   /translation="MSRDPTLTLDESNLVIGKDGRVHYTFTAEDDNPKVRLASKCLGTA
FT                   HFNQLMIERGDQATSYVAPVVVEGTGNPTGLFKDLKEISLELTDTANSQLWSKIKLTNR
FT                   GMLQEYYDGKIKTEIVNSARGVATRISEDTDKKLALINDTIDGIRREYRDADRRLSSSY
FT                   QSGINGLKAQLANDKIGLQAEIQATAQGLSQKYDNELRQLSAKITTTSSGTTEAYESKL
FT                   AGLRAEFTRSNQGMRIELESQISGLRAVQQSTASQISQEIRDRTGAVSRVQQDLESYQR
FT                   RLQDAEDNYSSLTHTVRGLQSDVGSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGD
FT                   SIKLAIQKAGGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTFTTKIAEAI
FT                   KIRADQIIAGTIDAARIRVINLNASSIVGLDANFIKAKIGYAITDLLEGKVIKARNGAM
FT                   LIDLSSAKMDFNSNATINFNSRDNALVRRDDTHTAFVHFSNATPKGYTGSALYAAIGIT
FT                   SSGDGVNSASSGRFAGMRCFRHATGYNHTAAVDQTEIYGDSVLIADDFSINRGFKFRPD
FT                   KMTKVLDMNDLYAAVVALGRCWKHLANVGWNTVHGNFTNAVTNELNNHINKI"
FT   gene            584961..585392
FT                   /locus_tag="MGAS10750_Spy0617"
FT   CDS_pept        584961..585392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0617"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37567"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE2"
FT                   /protein_id="ABF37567.1"
FT                   /translation="MDLTLKNKELNTLYRVLDKIKITNMRANRGRAKLLAKVVDKINEY
FT                   AKDETDLIDMYAAKDKDDKFVIDEHKNIKLADPAKLDELNDLLNELADEEIVIKGGEYS
FT                   KRFIDFLNFLEECEDEFTSSEIILIDNILEQFEESKKGE"
FT   gene            585395..586012
FT                   /locus_tag="MGAS10750_Spy0618"
FT   CDS_pept        585395..586012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0618"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37568"
FT                   /db_xref="InterPro:IPR009796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE1"
FT                   /protein_id="ABF37568.1"
FT                   /translation="MRNWKVTGKYPQFDSTGAVASTHIIITAEDGSVISQLVKQDLIST
FT                   NDTEIIKATLEEFKKSEYVEIAMGEAVQKVDDLEKISQETAKTAKTAQTAAGLAKVSAE
FT                   RTQKMINLQTIHMLMSGGKIDSDIYKGMLELIEPAKKGEYQAYDVFTVVDSTKEEDGEA
FT                   GEGNLVFVHVNEAFEYDKQTLEELESEAKVTVIKYADLVKQD"
FT   gene            586022..586522
FT                   /locus_tag="MGAS10750_Spy0619"
FT   CDS_pept        586022..586522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0619"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37569"
FT                   /db_xref="GOA:Q1CPE0"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPE0"
FT                   /protein_id="ABF37569.1"
FT                   /translation="MATELIFGVGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHAEQNKTLITMTEQIKNLTDDVKDLKRYDERRNQMINLKLRLQNKVT
FT                   LMAILGAIFLLAQQLGIKLPSNIADIANTAVTLLVLLGVVTDPTTKGLSDSEQALTYHE
FT                   PKK"
FT   gene            586638..587843
FT                   /locus_tag="MGAS10750_Spy0620"
FT   CDS_pept        586638..587843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0620"
FT                   /product="phage-associated cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37570"
FT                   /db_xref="GOA:Q1CPD9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPD9"
FT                   /protein_id="ABF37570.1"
FT                   /translation="MTFLDKIKQGCLDGWAKYKILPSLTAAQAILESGWGKHAPHNALF
FT                   GIKADASWTGKSFNTKTQEEYQAGVITDIVDRFRAYDSWDESIADHGQFLVDNPRYQSV
FT                   IGEADYKKACHAIKDAGYATASGYAELLIQIIEENNLQKWDKEAIVRKEKQMINSQCRE
FT                   VIEFFINLANAGMGVDKDSFAGWQCADVPCYAAKHWFDVDLWGNAIDLLDSAAAVGWEV
FT                   HRMPTDANPLTGAFFVQSVPYHQFGHTGIVIEDSDGYTMRTVEQNIDGNPDALYVGAPA
FT                   RFNTRDFTGVIGWFYPPYQGDTVTQPVSTEPQTSETIVETAKTGTFTLDVAEINIRRWP
FT                   SLASEVVGSYKQGDTVSFDNEGYANGYYWISYVGGSGMRNYLGIGQTDKDGNRISLWGK
FT                   LN"
FT   gene            complement(587911..588618)
FT                   /gene="speJ"
FT                   /locus_tag="MGAS10750_Spy0621"
FT   CDS_pept        complement(587911..588618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speJ"
FT                   /locus_tag="MGAS10750_Spy0621"
FT                   /product="Enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37571"
FT                   /db_xref="GOA:Q1CPD8"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPD8"
FT                   /protein_id="ABF37571.1"
FT                   /translation="MKKIHIIKIVFIITVILISTISPIIKSDSKKDISNVKSDLLYAYT
FT                   ITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYI
FT                   LNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKI
FT                   RKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIIN
FT                   MKNFSHFDIYLEK"
FT   gene            complement(588729..589487)
FT                   /locus_tag="MGAS10750_Spy0622"
FT   CDS_pept        complement(588729..589487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0622"
FT                   /product="Streptodornase"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37572"
FT                   /db_xref="GOA:Q1CPD7"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q1CPD7"
FT                   /protein_id="ABF37572.1"
FT                   /translation="MKLSKQKASLLTAVLLLLSLSITTITVDAARVRTYPNVSHANTHY
FT                   KNTVSSKLLPFTANYQLQLGELDNLNRATFSHIQLQDRHETKDVRTKINYDPVGWHNYQ
FT                   FPYGDGSKSSWVMNRGHLVGYQFCGLNDEPRNLVAMTAWLNTGAYSGANDSNPEGMLYY
FT                   ENRLDSWLALHPDFWLDYKVTPIYSGNEVVPRQIELQYVGIDSSGELLTIRLNSNKESI
FT                   DENGVTTVILENSAPNINLDYLNGTATPKN"
FT   gene            589799..591217
FT                   /gene="pepD"
FT                   /locus_tag="MGAS10750_Spy0623"
FT   CDS_pept        589799..591217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="MGAS10750_Spy0623"
FT                   /product="Dipeptidase A"
FT                   /EC_number="3.4.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37573"
FT                   /db_xref="GOA:Q1J7K1"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K1"
FT                   /protein_id="ABF37573.1"
FT                   /translation="MDKKIQRFSCTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIV
FT                   VKPEDQPRHYRSVQSSFEMDLPDNPMTYTSVPDALGEDGIWAEAGVNEANVAMSATETI
FT                   TTNSRVLGADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSD
FT                   KHDIWWLETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLCSADLKDFIDTYH
FT                   LDLTYSHEHFNPRYAFGSQRDKDRHYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYR
FT                   KITVEDVKYVLSSHYQDTVYDPYGSEGTPVSKKIFRPIGINRTSQTAILHIRPNKPQEI
FT                   AAIQWMAYGSMPFNTMVPFFTQVKTIPDYFANTYENVSTDNFYWTNRLIAALADPHYNH
FT                   HETDLDNYLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILF
FT                   DASNLMTNRFSLSD"
FT   gene            591369..592916
FT                   /locus_tag="MGAS10750_Spy0624"
FT   CDS_pept        591369..592916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0624"
FT                   /product="High-affinity zinc uptake system protein znuA
FT                   precursor / hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37574"
FT                   /db_xref="GOA:Q1J7K0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7K0"
FT                   /protein_id="ABF37574.1"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGIVGNDGDVSMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGAGHDHHHEEADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAESFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTEKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEPNAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            complement(592933..593754)
FT                   /locus_tag="MGAS10750_Spy0625"
FT   CDS_pept        complement(592933..593754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0625"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37575"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J9"
FT                   /protein_id="ABF37575.1"
FT                   /translation="MAGFTDHKEVFAYSAQVACDKYGWALAYSVEAGNIHDSQAFPALF
FT                   AKLEPLKPQFIIADSGYNIPSIAKFLIDKEITPVLPYTRPRGKKDLLRPKELIYDEHFD
FT                   CVICPEHQALTYRTTTREGYREYKSDPAICANCPLLSVCTTSKNHQKVVTRHIWKDYLE
FT                   QCEDIRHQRGMKELYQHRKETIERLFGTAKEYHNLRYTREKGKSKMEDKVGLTLACLNL
FT                   KKLVKRMAGEPFYFVQMRWFKHGNSHFYLKTLKKTSTKSMFVFNLSKPNLS"
FT   gene            complement(593732..594391)
FT                   /locus_tag="MGAS10750_Spy0626"
FT   CDS_pept        complement(593732..594391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0626"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37576"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J614"
FT                   /protein_id="ABF37576.1"
FT                   /translation="MLHKEKPDYNRNQYGFYTLDQLVPDEHFLRQVEAVIDFDFIYDLV
FT                   EDTYSSDNGRPSLDPVMLVKIPLIQCFYGIRSMRQTIKDIEVNTAYRWFLGLTLDDKVP
FT                   HFTTYGKNYSRRFQEKGLIESIFTHILGLCINTGLIDPTEIFIDGTHIKAAANNRKFIN
FT                   REVEKQAKFMSEQLEIEINRDREKHGKKPLGPAKELEPVAKKISTTDPESGWFHRS"
FT   gene            594625..595356
FT                   /locus_tag="MGAS10750_Spy0627"
FT   CDS_pept        594625..595356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0627"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37577"
FT                   /db_xref="GOA:Q1J7J7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J7"
FT                   /protein_id="ABF37577.1"
FT                   /translation="MNKMPKEQPLYLQIVDALEVKIRKSMTANDKLLSERELSDLYGVS
FT                   RITIRLALKELELRGLIYKKQGKGTYVSGIKEPATDLSSTYSFTEQMKKMGKMPKTEIL
FT                   SFEQYQVTPYLSGLLELDPDTEVFELERLRIADDMPLMFERSYIPAQPFQGLSIADLKR
FT                   KALYDIFAKDYQETIRLAEEEFYASIALDYEADLLGIKKGDPVLHIIRKTYNDKNILIE
FT                   FTFSIARADQFRYRVQHHPNG"
FT   gene            595376..596575
FT                   /gene="agaS"
FT                   /locus_tag="MGAS10750_Spy0628"
FT   CDS_pept        595376..596575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="MGAS10750_Spy0628"
FT                   /product="Galactosamine-6-phosphate deaminase
FT                   (isomerizing)"
FT                   /EC_number="3.5.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37578"
FT                   /db_xref="GOA:Q1J7J6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J6"
FT                   /protein_id="ABF37578.1"
FT                   /translation="MFTKTQEALEALGAAITTKEIKQEPRLWQETMTFFDETRDSLDSF
FT                   LKRVCKSANGNNVHVIFTGAGTSEYIGNTICPYLKKVGNRQCYLFESVASTDLVAAPDY
FT                   YLAEEETVLLVSFARSGNSPESVAAVNLVNQLVPNSYHLTITCAKDGELAKKAQQDERS
FT                   YLYLMPEDANDAGFAMTGSFTCMMLAALLIFDDANSIAQKEAYVTDMILAGQAVIDQER
FT                   RLQELADLGFERLVYLGSAGLAKLTQEAQLKMLELTAGQVATVYESSMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKTLALLQGGDINFSEDQFRLDTRHLL
FT                   PDAYLAFPMILVAQTLALLTAVTLGNSPDTPSATGMVNRVVKGVTIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(596673..596933)
FT                   /gene="rpmE"
FT                   /locus_tag="MGAS10750_Spy0629"
FT   CDS_pept        complement(596673..596933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="MGAS10750_Spy0629"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37579"
FT                   /db_xref="GOA:Q1J7J5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7J5"
FT                   /protein_id="ABF37579.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(597048..597989)
FT                   /locus_tag="MGAS10750_Spy0630"
FT   CDS_pept        complement(597048..597989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0630"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37580"
FT                   /db_xref="GOA:Q1J7J4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J4"
FT                   /protein_id="ABF37580.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLAWMSQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGQCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSANLEENQAIFRELIAVCQEI"
FT   gene            598383..598832
FT                   /locus_tag="MGAS10750_Spy0631"
FT   CDS_pept        598383..598832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0631"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37581"
FT                   /db_xref="GOA:Q1J7J3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J3"
FT                   /protein_id="ABF37581.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSEQFALTGAIKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            599008..599292
FT                   /locus_tag="MGAS10750_Spy0632"
FT   CDS_pept        599008..599292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0632"
FT                   /product="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37582"
FT                   /db_xref="GOA:Q1J7J2"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J2"
FT                   /protein_id="ABF37582.1"
FT                   /translation="MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   VRENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRQYQTQHLTGGDIND"
FT   gene            599273..600547
FT                   /locus_tag="MGAS10750_Spy0633"
FT   CDS_pept        599273..600547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0633"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37583"
FT                   /db_xref="GOA:Q1J7J1"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7J1"
FT                   /protein_id="ABF37583.1"
FT                   /translation="MVTLMIKSIATLPKPSLKEALGLIGLALPIGVAVGVVDVIFGKGL
FT                   LFLSEYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFQVGHGQKDQIPPILI
FT                   PLILFSTWVTHLFGASAGREGVAVQIGATISHYCQRFVTSQEAARHLLIMGMAAGFAGL
FT                   FQTPIAAVVFALEVLLVGTLRYCALLPSLVAACVASWTSHSLGLEKFTIVLEETLTITP
FT                   LTLVKLIGLGLIFGLVGNSFACLLGWFKPYLSQKLPNPYLRIAFIGVLLSICLMIGHVG
FT                   RYSGLGTHLLAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFAIGASLGIVLA
FT                   PYLGLPVLLVAALGYVTVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMISHRH
FT                   SIYSYQKVVMINLKDMTVNQMDLKK"
FT   gene            600662..601009
FT                   /gene="rplS"
FT                   /locus_tag="MGAS10750_Spy0634"
FT   CDS_pept        600662..601009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="MGAS10750_Spy0634"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37584"
FT                   /db_xref="GOA:Q1J7J0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7J0"
FT                   /protein_id="ABF37584.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            601256..601327
FT                   /locus_tag="MGAS10750_SpyR02277"
FT   tRNA            601256..601327
FT                   /locus_tag="MGAS10750_SpyR02277"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            602037..602606
FT                   /locus_tag="MGAS10750_Spy0635"
FT   CDS_pept        602037..602606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0635"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37585"
FT                   /db_xref="GOA:Q1J7I9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I9"
FT                   /protein_id="ABF37585.1"
FT                   /translation="MKGMNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFILPGDHDAVY
FT                   QKLKESTAIAVATFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILEKIATSGSRNFLI
FT                   SHRDCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDINSGLVIGDRLI
FT                   DKQAGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            602607..604559
FT                   /gene="gyrB"
FT                   /locus_tag="MGAS10750_Spy0636"
FT   CDS_pept        602607..604559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MGAS10750_Spy0636"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37586"
FT                   /db_xref="GOA:Q1J7I8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I8"
FT                   /protein_id="ABF37586.1"
FT                   /translation="MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGL
FT                   HHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVF
FT                   TVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADL
FT                   EVIGTTDVTGTTVHFTPDPEIFTETTQFDYNVLAKRIQELAFLNRGLKISITDKRSGME
FT                   QEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELEGIAVEVAMQYTTSYQETVMSFA
FT                   NNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPN
FT                   PQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRA
FT                   REVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIR
FT                   GKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIR
FT                   TLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSI
FT                   GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPR
FT                   RDFIEENAVYSTLDI"
FT   gene            604927..606651
FT                   /locus_tag="MGAS10750_Spy0637"
FT   CDS_pept        604927..606651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0637"
FT                   /product="Septation ring formation regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37587"
FT                   /db_xref="GOA:Q1J7I7"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7I7"
FT                   /protein_id="ABF37587.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLAHVKHNNEQLKDEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(606783..607241)
FT                   /locus_tag="MGAS10750_Spy0638"
FT   CDS_pept        complement(606783..607241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0638"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37588"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I6"
FT                   /protein_id="ABF37588.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDHAINLKETRLEVILKQTKNDQLSKQTPEKTKSFWKRFLKK"
FT   gene            607468..608775
FT                   /gene="eno"
FT                   /locus_tag="MGAS10750_Spy0639"
FT   CDS_pept        607468..608775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="MGAS10750_Spy0639"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37589"
FT                   /db_xref="GOA:Q1J7I5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7I5"
FT                   /protein_id="ABF37589.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            complement(609364..609885)
FT                   /locus_tag="MGAS10750_Spy0640"
FT   CDS_pept        complement(609364..609885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0640"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37590"
FT                   /db_xref="GOA:Q1J7I4"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I4"
FT                   /protein_id="ABF37590.1"
FT                   /translation="MSAIIRQSTSKRISDKRGIYLVEKLVSLAKQSYFTVTKTSPMIEE
FT                   VRYYAKELLRLSERRQAIFDKMVALAQPLPEDKILRSIPSIAETTATSIIGELGAIRCF
FT                   QSANQINAFIGIDFRHYESGNCLAQEHITERGNPYAPKILFKCIHDIASASHTNPCHIA
FT                   DFYEKRKRQS"
FT   gene            complement(609934..610185)
FT                   /locus_tag="MGAS10750_Spy0641"
FT   CDS_pept        complement(609934..610185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0641"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37591"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I3"
FT                   /protein_id="ABF37591.1"
FT                   /translation="MRKADKLDTEKLAQSQFILVRKPTYVQEEVYQLLRDLSRFYQNLT
FT                   EDNIVRELRIAFRRSYKSLFLNWNTSYLHQLVSNTGMW"
FT   gene            complement(610547..612031)
FT                   /locus_tag="MGAS10750_Spy0642"
FT   CDS_pept        complement(610547..612031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0642"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37592"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I2"
FT                   /protein_id="ABF37592.1"
FT                   /translation="MLDVSEVSIDQLCQETELKKQRVYNLLIEMIKDLEDTLTLTICDD
FT                   TVSIPYKTYQLKMPYFKKLYQTSIFLKMLCFLIEPGELSLHDFIKREYISQATAYRIRT
FT                   NCRKYLKKVGLNVRQNHVVGPEYRIRFLIALLHYQFGMTIYDFDKTSMNKVVSLIINSN
FT                   QAITLNDASKAPYEFSYFAILISLIWKRQHGNLGIPQTDAFKHLKKLSIYHDIKMTSQE
FT                   IIGKWYHPDLTDEDLDYIFLCFCTTNNPFHKDKWTPKKVKELFELVMTKTNGKTLKASL
FT                   RPLLGDNILNSLPFKRILVSFSRLFISNLQVLLPDIHLFHYLRRQQKRNKSFYNTLKTI
FT                   VEEWMSAEGIVGKLPSYHLLLFTIQLEELLKTYLPPIPVYLLTNNTAALDLMTNALSIY
FT                   FPPAIATVMPVNVEIIPFKDIVKEKQSVIIADRQYLNLIQHLYQNQGHLFLYFLFSFRD
FT                   VSEAYIHKVFLDFRQKRYDEFIVTLLDTYHKNLSSP"
FT   gene            612561..616682
FT                   /gene="epf"
FT                   /locus_tag="MGAS10750_Spy0643"
FT   CDS_pept        612561..616682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="MGAS10750_Spy0643"
FT                   /product="Extracellular matrix binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37593"
FT                   /db_xref="GOA:Q1J7I1"
FT                   /db_xref="InterPro:IPR011439"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I1"
FT                   /protein_id="ABF37593.1"
FT                   /translation="MFLKHQDVKQKNWRMRKVKKLFVSSCMLLTVGLGVAVPTGFSQSN
FT                   GVMVVKAAEVPAAEGVFKIETDNLQNWEAETNTQGYKGTFSKSPDSQGFYKVQTNSGAG
FT                   IGVQVAPKGNGRMDIKIGNRVEIPKGYYVGGIRTKTPVLEKDNTYRLSFTTSKTSGTDV
FT                   EFKTRIKDVEANGDLGQEHTIKFDGNTVSTGNPWIKGLTNKKHTVDFIGKGKALSMAFR
FT                   FSPFKTTNITYTFTDMNISNVTPASVPETPSSVYEEATKISGKAVASKDNFNKRTNFLG
FT                   DVVNVYKLDQLVGTAQVKSGNTFEVVLNLKEPLKQGEKLEVEIQNPKSALLSARVPINV
FT                   IAKPYDKAQHLKDSKASLDEAYRQTVENITQDNWLKSSEKQKQTNAAKLAYDQGIIELG
FT                   RSNDKAAINSVVTKYTQKKTGLITKEHILGEKDKVITAAKNAIEEKATAEKTKIDSDNS
FT                   LTTPEKEAQLAQLSTAKEAALTAITESPDADTVGTKQTEGEASVSGIHQGKDLEAIKTA
FT                   AKNAIEEKATAEKTKINNDITLTAKDKEQQLKEVETALTKAKDNVKAAKTADAINDARD
FT                   KGVATIDAVHKAGQDLGARKSGQVAKLEEAAKATKDKISADPTLTSKEKEEQSKAVDAE
FT                   LKKAIEAVNAADTADKVDDALGKGVTDIKNQHKSGKGLDVRKDEHKKALEAVAKRVTAE
FT                   IEADPTLTPEVREQQKAEVQKELELATDKIAEAKDADEADKAYGDGVTAIENAHVIGKG
FT                   IEARKDLAKKDLAEAVAKTKALIIEDKTLTDDQRKEQLSGVDTEYAKGIENIDAAKDAA
FT                   GVDKAYSDGVRDILAQYKEGQNLDDRRNAAKEFLLKEADKVTKLINDDPTLTHDQKVDQ
FT                   INKVEQAKLDAIKSVDDAQTADAINDALGKGIENINNQYQHGDGVDVRKATAKGDLEKE
FT                   AAKVKALIAKDPTLTQADKDKQTAAVDAAKNTAIAAVDKATTAEGINQELGKGITAINK
FT                   AYRPGEAVKARKEAAKADLEKEAAKVKALITNDPTLTKADKAKQTEAVAKALKAAIAAV
FT                   DKATTAEGINQELGKGITAINKAYRPGEAVKARKEAAKADLEREAAKVREAIANDPTLT
FT                   KADKAKQTEAVAKALKAAIAAVDKATTAEGINQELGKGITAINKAYRPGEAVKARKEAA
FT                   KANLEKVAKETKALISGDRYLSETEKAVQKQAVEQALAKALGQVEAAKTVEAVKLAENL
FT                   GTVAIRSAYVAGLAKDTDQATAALNEAKQAAIEALKQAAAETLAKITTDAKLTEAQKAE
FT                   QSENVSLALKTAIATVRSAQSIASVKEAIDKGITAIRAAYVPNKAVAKSSSANHLPKSG
FT                   DANSIVLVGLGVMSLLLGMVLYSKKKESKD"
FT   gene            617547..617708
FT                   /gene="sagA"
FT                   /locus_tag="MGAS10750_Spy0644"
FT   CDS_pept        617547..617708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagA"
FT                   /locus_tag="MGAS10750_Spy0644"
FT                   /product="Streptolysin S precursor"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37594"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7I0"
FT                   /protein_id="ABF37594.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            617930..618880
FT                   /gene="sagB"
FT                   /locus_tag="MGAS10750_Spy0645"
FT   CDS_pept        617930..618880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagB"
FT                   /locus_tag="MGAS10750_Spy0645"
FT                   /product="Streptolysin S biosynthesis protein SagB"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37595"
FT                   /db_xref="GOA:Q1J7H9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H9"
FT                   /protein_id="ABF37595.1"
FT                   /translation="MSFFTKEQQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPTKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYMKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            618877..619935
FT                   /gene="sagC"
FT                   /locus_tag="MGAS10750_Spy0646"
FT   CDS_pept        618877..619935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagC"
FT                   /locus_tag="MGAS10750_Spy0646"
FT                   /product="Streptolysin S biosynthesis protein SagC"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37596"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H8"
FT                   /protein_id="ABF37596.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENALEPETFANLMEVISGLCYNDMLMLEDDYNLEENVMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSEALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHTCTLNPPHSADFDSLERRVLARLQDSTLYQHFANQILPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            619955..621313
FT                   /gene="sagD"
FT                   /locus_tag="MGAS10750_Spy0647"
FT   CDS_pept        619955..621313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagD"
FT                   /locus_tag="MGAS10750_Spy0647"
FT                   /product="Streptolysin S biosynthesis protein SagD"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37597"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H7"
FT                   /protein_id="ABF37597.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKPCPKIIVDDPDIEVILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            621288..621959
FT                   /gene="sagE"
FT                   /locus_tag="MGAS10750_Spy0648"
FT   CDS_pept        621288..621959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagE"
FT                   /locus_tag="MGAS10750_Spy0648"
FT                   /product="Streptolysin S putative self-immunity protein
FT                   SagE"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37598"
FT                   /db_xref="GOA:Q1J7H6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H6"
FT                   /protein_id="ABF37598.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSFESIDSKTFFMGLVFCVLIVLIELVFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEETIYRFLWFNILAFQWHLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYSSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            621956..622639
FT                   /gene="sagF"
FT                   /locus_tag="MGAS10750_Spy0649"
FT   CDS_pept        621956..622639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagF"
FT                   /locus_tag="MGAS10750_Spy0649"
FT                   /product="Streptolysin S biosynthesis protein SagF"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37599"
FT                   /db_xref="GOA:Q1J7H5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H5"
FT                   /protein_id="ABF37599.1"
FT                   /translation="MMLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLVALSYQDFLDVL
FT                   LSLFQFVIIILVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLIL
FT                   IFDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGIAILVDSLFYLGLLILLGEQSLTS
FT                   LATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILMVTYLMI
FT                   SCKEY"
FT   gene            622662..623585
FT                   /gene="sagG"
FT                   /locus_tag="MGAS10750_Spy0650"
FT   CDS_pept        622662..623585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagG"
FT                   /locus_tag="MGAS10750_Spy0650"
FT                   /product="Streptolysin S export ATP-binding protein SagG"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37600"
FT                   /db_xref="GOA:Q1J7H4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H4"
FT                   /protein_id="ABF37600.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLTQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            623594..624721
FT                   /gene="sagH"
FT                   /locus_tag="MGAS10750_Spy0651"
FT   CDS_pept        623594..624721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagH"
FT                   /locus_tag="MGAS10750_Spy0651"
FT                   /product="Streptolysin S export transmembrane protein SagH"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37601"
FT                   /db_xref="GOA:Q1J7H3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H3"
FT                   /protein_id="ABF37601.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLEAKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKVITNNINQQNADLINMLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVD
FT                   YVKVSSIQTSKGMTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIRLTGVSPS
FT                   LLVFGKLIGAMLATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLG
FT                   ISIKNEAFLTVASNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIF
FT                   GGQYNPIPVTLIVNISIGTIFIILALIGMRKQVTT"
FT   gene            624718..625836
FT                   /gene="sagI"
FT                   /locus_tag="MGAS10750_Spy0652"
FT   CDS_pept        624718..625836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagI"
FT                   /locus_tag="MGAS10750_Spy0652"
FT                   /product="Streptolysin S export transmembrane protein SagI"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37602"
FT                   /db_xref="GOA:Q1J7H2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H2"
FT                   /protein_id="ABF37602.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   DVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGG
FT                   TLSQAWPHLLALMGTALALIIFSSLLLKPTRL"
FT   gene            626409..629141
FT                   /locus_tag="MGAS10750_Spy0653"
FT   CDS_pept        626409..629141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0653"
FT                   /product="Endonuclease/Exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37603"
FT                   /db_xref="GOA:Q1J7H1"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H1"
FT                   /protein_id="ABF37603.1"
FT                   /translation="MINKKYIIPVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKSNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERTYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPQKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLVRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLDVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNMPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPTYRYADIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNAAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGRVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKTGDSLVYVITLLGTASLLVPILLLTKGKKES"
FT   gene            629419..629919
FT                   /locus_tag="MGAS10750_Spy0654"
FT   CDS_pept        629419..629919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0654"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37604"
FT                   /db_xref="GOA:Q1J7H0"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7H0"
FT                   /protein_id="ABF37604.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNG
FT                   IFNKAFVYFSFFFATSMFTVAIELYFFGAPFLLTWFTTALGELVSLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            630112..632070
FT                   /gene="lig"
FT                   /locus_tag="MGAS10750_Spy0655"
FT   CDS_pept        630112..632070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="MGAS10750_Spy0655"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37605"
FT                   /db_xref="GOA:Q1J7G9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G9"
FT                   /protein_id="ABF37605.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPHQLSEPLTITVRG
FT                   EAYMSRQSFKAINEARQENGETEFANPRNAAAGTLRQLDTAVVAKRQLATFLYQEASPT
FT                   ARNQQNEVLAELADLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKENFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRQL"
FT   gene            632084..633106
FT                   /locus_tag="MGAS10750_Spy0656"
FT   CDS_pept        632084..633106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0656"
FT                   /product="Diacylglycerol kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37606"
FT                   /db_xref="GOA:Q1J7G8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7G8"
FT                   /protein_id="ABF37606.1"
FT                   /translation="MKKQLRARLIYNPTSGQELMRKSVPEVLDILEGFGYETSAFQTTA
FT                   QKNSALNEARRAAKAGFDLLIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARA
FT                   LKVPRGNPSQAAKLIGKNQTIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFG
FT                   YLAYLAKGVELLPRVSNVPVKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDG
FT                   MFTLILIKTANLFEIVHLLRLILDGGKHITDRRVEYIKTSKIVIEPQCRKRMMINLDGE
FT                   YGGDAPITLENLKNHITFFADTDLISDDALVLDQDELEIEEIVKKFAHEVEDLEQELEE
FT                   "
FT   gene            633498..633710
FT                   /locus_tag="MGAS10750_Spy0657"
FT   CDS_pept        633498..633710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0657"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7G7"
FT                   /protein_id="ABF37607.1"
FT                   /translation="MYDGVFEVLQWLLFLSAVPPVQLLTGWCVTAKAPPDISAISALTA
FT                   VKHGNCSSLTPLLNPVRTRKSLIWP"
FT   gene            633721..634224
FT                   /locus_tag="MGAS10750_Spy0658"
FT   CDS_pept        633721..634224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0658"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37608"
FT                   /db_xref="GOA:Q1J7G6"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7G6"
FT                   /protein_id="ABF37608.1"
FT                   /translation="MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            634291..634488
FT                   /gene="atpE"
FT                   /locus_tag="MGAS10750_Spy0659"
FT   CDS_pept        634291..634488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="MGAS10750_Spy0659"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37609"
FT                   /db_xref="GOA:Q1J7G5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7G5"
FT                   /protein_id="ABF37609.1"
FT                   /translation="MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMIL
FT                   GVAFIEGTFFVTLVMAFILK"
FT   gene            634523..635239
FT                   /gene="atpB"
FT                   /locus_tag="MGAS10750_Spy0660"
FT   CDS_pept        634523..635239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="MGAS10750_Spy0660"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37610"
FT                   /db_xref="GOA:Q1J7G4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G4"
FT                   /protein_id="ABF37610.1"
FT                   /translation="MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLK
FT                   PEGKQTALEYLISFVDGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNG
FT                   YNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTN
FT                   FLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFT
FT                   KLTATYLGKKVNESEE"
FT   gene            635257..635751
FT                   /gene="atpF"
FT                   /locus_tag="MGAS10750_Spy0661"
FT   CDS_pept        635257..635751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MGAS10750_Spy0661"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37611"
FT                   /db_xref="GOA:Q1J7G3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G3"
FT                   /protein_id="ABF37611.1"
FT                   /translation="MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQI
FT                   SRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAK
FT                   RLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE
FT                   A"
FT   gene            635751..636287
FT                   /gene="atpH"
FT                   /locus_tag="MGAS10750_Spy0662"
FT   CDS_pept        635751..636287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="MGAS10750_Spy0662"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37612"
FT                   /db_xref="GOA:Q1J7G2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G2"
FT                   /protein_id="ABF37612.1"
FT                   /translation="MTKKEQALIEQYAKSLVEVASEHHSLDTLQADVLAILETFETTNL
FT                   DQSLSSLAVPHAEKIKLLTLLERNNSVYMNNFLNLILQNEREAYLYQMLQAVLNEIAIV
FT                   SNQYNVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVID
FT                   TSIRRQLQAFKMNLK"
FT   gene            636303..637811
FT                   /gene="atpA"
FT                   /locus_tag="MGAS10750_Spy0663"
FT   CDS_pept        636303..637811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="MGAS10750_Spy0663"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37613"
FT                   /db_xref="GOA:Q1J7G1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G1"
FT                   /protein_id="ABF37613.1"
FT                   /translation="MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLD
FT                   NAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALI
FT                   GRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTI
FT                   VVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDG
FT                   QIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFG
FT                   SDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEE
FT                   ALYDYFDVHYNDLFETIRTTKDLPEEAALDAAIKAFKEHSNFKS"
FT   gene            637827..638702
FT                   /gene="atpG"
FT                   /locus_tag="MGAS10750_Spy0664"
FT   CDS_pept        637827..638702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="MGAS10750_Spy0664"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37614"
FT                   /db_xref="GOA:Q1J7G0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7G0"
FT                   /protein_id="ABF37614.1"
FT                   /translation="MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQI
FT                   YASKIRQITTDLLKSELTIGSDNPMLVSRPVKKTGYIVITSDKGLVGGYNSKILKSVMD
FT                   MITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQPSFEQVRQIISQSVDMFV
FT                   NEIFDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTGFELEPNRHDILDQL
FT                   LPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEIT
FT                   EIVAGANALE"
FT   gene            638864..640270
FT                   /gene="atpD"
FT                   /locus_tag="MGAS10750_Spy0665"
FT   CDS_pept        638864..640270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="MGAS10750_Spy0665"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37615"
FT                   /db_xref="GOA:Q1J7F9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7F9"
FT                   /protein_id="ABF37615.1"
FT                   /translation="MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVL
FT                   EVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEE
FT                   PFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTV
FT                   LIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGAR
FT                   MRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATE
FT                   MGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPA
FT                   VDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGR
FT                   ARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDHLPEDAFRSVGPIED
FT                   VIKKAEKMGF"
FT   gene            640283..640699
FT                   /gene="atpC"
FT                   /locus_tag="MGAS10750_Spy0666"
FT   CDS_pept        640283..640699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="MGAS10750_Spy0666"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37616"
FT                   /db_xref="GOA:Q1J7F8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1J7F8"
FT                   /protein_id="ABF37616.1"
FT                   /translation="MTQMTVQVVTPDGIKYDHHAKCISVTTPDGEMGILPNHINLIAPL
FT                   QVHEMKIRRGGEDEKVDWIAINGGIIEIKDNVVTVVADSAERDRDIDVSRAERAKLRAE
FT                   REIAQAETTHNIDEVRRAKVALRRALNRINVSKK"
FT   gene            640965..641222
FT                   /locus_tag="MGAS10750_Spy0667"
FT   CDS_pept        640965..641222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0667"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37617"
FT                   /db_xref="GOA:Q1J7F7"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F7"
FT                   /protein_id="ABF37617.1"
FT                   /translation="MVCYNNPMELLMKIIAFSCHLFFIGLSYQLLISVIDWTKFSHYHP
FT                   ENLGRLRLFVFLLATALGYLVSHCMLELLQISQTLFFEFR"
FT   gene            641287..642558
FT                   /gene="murA"
FT                   /locus_tag="MGAS10750_Spy0668"
FT   CDS_pept        641287..642558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="MGAS10750_Spy0668"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37618"
FT                   /db_xref="GOA:Q1J7F6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F6"
FT                   /protein_id="ABF37618.1"
FT                   /translation="MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRN
FT                   VPILSDVFTMNNVVRGLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGP
FT                   ILARNGHAKVSMPGGCTIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMD
FT                   FPSVGATQNLMMAATLADGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGV
FT                   TSLHGVEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEE
FT                   YGIRVQANTPKLKPVTVKTLPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLE
FT                   EMRRMGLQSEILRETAMIHGGRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHL
FT                   DRGYYQFHEKLAKLGATISRSSEV"
FT   gene            642562..642750
FT                   /gene="epuA"
FT                   /locus_tag="MGAS10750_Spy0669"
FT   CDS_pept        642562..642750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epuA"
FT                   /locus_tag="MGAS10750_Spy0669"
FT                   /product="EpuA protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37619"
FT                   /db_xref="GOA:Q1J7F5"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F5"
FT                   /protein_id="ABF37619.1"
FT                   /translation="MTNGLKYVLEQMLLLLVIAALACLFLAIGLMIGYSFMGDGHSPWH
FT                   ILSMDKWAELVNKFTGK"
FT   gene            642774..643364
FT                   /locus_tag="MGAS10750_Spy0670"
FT   CDS_pept        642774..643364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0670"
FT                   /product="DNA-entry nuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37620"
FT                   /db_xref="GOA:Q1J7F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F4"
FT                   /protein_id="ABF37620.1"
FT                   /translation="MRGSMLTRKKRKRVLNSFLLILLVLGSNCLAKSDFIASNHPIKQL
FT                   YQTLVGEKKKSLLTHNNLPADVPTEALAASVLTPSIKKQLGPNVQWNGAGAYIINRNKT
FT                   DLTAKVASPPYANNETKWVQEQKVPTRANALLTKSTRQYRNRYQTNNAYRTFKPAGWHR
FT                   LHHLKGSYDHAVDRGHLLGYALVGGLKGFDAYQ"
FT   gene            643348..643650
FT                   /gene="endA"
FT                   /locus_tag="MGAS10750_Spy0671"
FT   CDS_pept        643348..643650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="MGAS10750_Spy0671"
FT                   /product="DNA-entry nuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37621"
FT                   /db_xref="GOA:Q1J7F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F3"
FT                   /protein_id="ABF37621.1"
FT                   /translation="MMLTSNPDNIATQLSWANQVNKPYSTGQNYYEGLVRRALDKGHRV
FT                   RYRVTLLYDGDNLLASGSHLEAKSSDDSLTFNVFVPNVQPGLTVDYRTGQIAINL"
FT   gene            643855..644976
FT                   /gene="pheS"
FT                   /locus_tag="MGAS10750_Spy0672"
FT   CDS_pept        643855..644976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="MGAS10750_Spy0672"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37622"
FT                   /db_xref="GOA:Q1J7F2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F2"
FT                   /protein_id="ABF37622.1"
FT                   /translation="MVPRVNAPLIKWRSGTLFSSLKEGKTMDLQAQLEELKTKTLETLQ
FT                   PLTGNHTKELQDLRVAVLGKKGSLTELLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEE
FT                   QAKIVEAAKIQAQLDAESIDVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFE
FT                   VEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDQHDFSKGPLKMV
FT                   SPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGEERSIRLRPS
FT                   YFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFA
FT                   FGLGQERIAMLRYGINDIRGFYQGDQRFSEQFN"
FT   gene            645171..647591
FT                   /gene="pheT"
FT                   /locus_tag="MGAS10750_Spy0673"
FT   CDS_pept        645171..647591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="MGAS10750_Spy0673"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37623"
FT                   /db_xref="GOA:Q1J7F1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F1"
FT                   /protein_id="ABF37623.1"
FT                   /translation="MGTKIMLVSYKWLKELVDIDVTPAALAEKMSTTGIEVEGIEVPAE
FT                   GLSKLVVGHVLSCEDVPETHLHLCQVDTGDETPRQIVCGAPNVKAGIKVIVAVPGARIA
FT                   DNYKIKKGKIRGMESLGMICSLQELGLSDSIIPKEFSDGIQILPEEAVPGDAIFKYLDL
FT                   DDHIIGLSITPNRADALSMRGVAHEVAAIYGKSVSFPPKNLQESDKATSEAIEVAIASD
FT                   NVLTYASRVVENVKVKPSPQWLQNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDYDK
FT                   FEDHKIVARAARQGESLVTLDGEKRDLTTEDLVITVADKPVALAGVMGGQATEIDANSQ
FT                   TVVLEVAVFDGKSIRKTSGRLNLRSESSSRFEKGVNYATVLEALDFAAAMLQELAEGQV
FT                   LSGHVQAGQLPTEPVEVSTSLDYVNVRLGTELTFADIQRIFDQLGFGLTGDETSFTVAV
FT                   PRRRWDVSIPADLVEEIARIYGYDKLPTTLPEAGGTAAELTPTQALRRKVRGLAEGLGL
FT                   TEIISYALTTPEKAVEFAVAPSHLTELMWPMSVERSALRQNMISGMLDTVAYNVARKQS
FT                   NLALYEIGKIFEQEANPKENLPNEVNHFAFAICGLVAQKDFQTQAQAVDFYHAKGILDT
FT                   LFANLNLKVQYVPTKDLANMHPGRTALILLDEQVIGFVGQVHPGTAKAYSIPETYVAEL
FT                   DMAALEAALSSDQTFVEITKFPAMTRDVALLLDREVSHQAIVTAIESAGVKRLTKIKLF
FT                   DVYEGVTIQAGKKSMAYSLNFQNPNDNLTDEEVAKYMEKITKALTEQVGAEVR"
FT   gene            647665..648078
FT                   /locus_tag="MGAS10750_Spy0674"
FT   CDS_pept        647665..648078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0674"
FT                   /product="Salt-stress induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37624"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7F0"
FT                   /protein_id="ABF37624.1"
FT                   /translation="MEKNIRRWRKIRMYQTKITGNRLYHTVSKGYGDSVTLFGKTDQGE
FT                   TPMSLLVIALSSCVTMCVQGFYHRQFQQDTLAVSVEASYEEEVFELLVRIDDVLDDKKK
FT                   ADLLAYIGTYCRVKQLLKPEVTVTITLEGLSHV"
FT   gene            648071..648457
FT                   /locus_tag="MGAS10750_Spy0675"
FT   CDS_pept        648071..648457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37625"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR016996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7E9"
FT                   /protein_id="ABF37625.1"
FT                   /translation="MSDASLKTYQKQWAYQKYWVMAHSQQHYNALRELFKGNQWSEEKV
FT                   LTFHCLIEEAQAIPPTVKSLRTAYQHVWGYFKKVASQEEKKHFKDLDAQLETKSEEMLC
FT                   FLQEMTAHYQPSYLLSCRLITKGP"
FT   gene            648530..649606
FT                   /locus_tag="MGAS10750_Spy0676"
FT   CDS_pept        648530..649606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0676"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37626"
FT                   /db_xref="GOA:Q1J7E8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7E8"
FT                   /protein_id="ABF37626.1"
FT                   /translation="MFLALNEMKQSKLRYGLIAGLLCLVAYLMFFLSGLAFGLMQENRS
FT                   AVDLWKADSVLLAKDADATLTLSQVSRAQENQITADKVAPLAQLNTVAWSVKNPKDADK
FT                   VKVSLFGIDSNSFIRPNIVKGRLFKTNKEVVLDQSLAKEEAFAIGKDFYTSSSSQALTI
FT                   VGYTQNARFSVAPVVYMNLEAFETLKYGGPLPKDKQVVNAFITKGSLTDYPKKDFQKLD
FT                   IKTFITKLPGYSAQLLTFGFMISFLVIISAIIIGIFMYILTIQKAPIFGIMKAQGISNK
FT                   TITTAVLMQTFFLSFLGSGLGLLGTWLTSLLLPTVVPFQSNWFLYLAIFVSMICFALLG
FT                   TLFSVFNIIRIDPLKAIG"
FT   gene            649613..650284
FT                   /locus_tag="MGAS10750_Spy0677"
FT   CDS_pept        649613..650284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0677"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37627"
FT                   /db_xref="GOA:Q1J7E7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7E7"
FT                   /protein_id="ABF37627.1"
FT                   /translation="MMSVLTFKQVTKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGS
FT                   GKSTFLTIAGCLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQ
FT                   QQLELVDHLTGSKEKAKANQLFDDLGITGLKHQLPQELSGGERQRAAIARALYHDPALI
FT                   LADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLKYCDKVYRMQDGELCQE
FT                   R"
FT   gene            complement(650386..651303)
FT                   /locus_tag="MGAS10750_Spy0678"
FT   CDS_pept        complement(650386..651303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MGAS10750_Spy0678"
FT                   /product="Neutral zinc metallopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:MGAS10750_Spy0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABF37628"
FT                   /db_xref="GOA:Q1J7E6"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:Q1J7E6"
FT                   /protein_id="ABF37628.1"
FT                   /translation="MKTDDLRESQQVEDRRGQSSGSFGGGGLGGGLLLQLLFSRGGWKT
FT                   KLVILLLLLVMGGGGLSGVLGGKPSSTNNNAYQSSQVTRTNGDKASQEQVSFVSKVFAS
FT                   TEDYWTKTFREKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQKVYLDISFYNE
FT                   LSTKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASARQGKSKAKANQLNVKLELQAD
FT                   YYAGAWANYVQGQGLLEKGDIEEAMAAAHAVGDDTLQEETYGRTVPDSFTHGTSKQRQR
FT                   WFDRGYQYGDFEHGDTFSIPYSKL"
FT   gene            651454..654669
FT                   /gene="rexB"
FT                   /locus_tag="MGAS10750_Spy0679"
FT   CDS_pept        651454..654669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexB"
FT